(data stored in ACNUC9435 zone)

EMBL: BX936399.PE71

BX936399.PE71        Location/Qualifiers
FT   CDS_pept        49507..50160
FT                   /transl_table=11
FT                   /locus_tag="pYV0071"
FT                   /product="yscR; putative Yop secretion membrane protein"
FT                   /note="identical to Y. pestis YPCD1.44"
FT                   /db_xref="EnsemblGenomes-Gn:pYV0071"
FT                   /db_xref="EnsemblGenomes-Tr:CAF25414"
FT                   /db_xref="GOA:P69981"
FT                   /db_xref="InterPro:IPR005773"
FT                   /db_xref="InterPro:IPR005838"
FT                   /db_xref="UniProtKB/Swiss-Prot:P69981"
FT                   /protein_id="CAF25414.1"
FT                   /translation="MIQLPDEINLIIVLSLLTLLPLISVMATSFVKFAVVFSLLRNALG
FT                   VQQIPPNMAMYGLAIILSLYVMAPVGFATQDYLQANEVSLTNIESVEKFFDEGLAPYRM
FT                   FLKQHIQAQEYSFFVDSTKQLWPKQYADRLESDSLFILLPAFTVSELTRAFEIGFLIYL
FT                   PFIVIDLVISNILLAMGMMMVSPMTISLPFKLLLFVLLDGWTRLTHGLVISYGG"
     atgatccagt taccggatga aattaatctc atcatcgttt tatctttgct gactctgctt        60
     ccattgattt cggtaatggc tacatcgttt gtcaaatttg cggtggtctt ttcactactc       120
     cgcaatgccc ttggggtaca gcaaatcccc cccaacatgg caatgtatgg cttagcaatc       180
     atccttagtc tttatgtaat ggcacccgtt ggcttcgcga cgcaagacta tttacaagct       240
     aatgaggtta gcctcacgaa catagaatct gttgagaaat tctttgatga agggcttgcc       300
     ccctatcgca tgttccttaa gcagcatatt caagcgcaag aatactcttt ttttgttgac       360
     agcactaaac agttatggcc caagcagtat gctgaccggt tagagtcaga cagcctgttc       420
     attttattgc ctgcgtttac ggtgagtgag ttgactcgag catttgagat aggctttctc       480
     atctatttac catttatcgt cattgacctg gttatttcca atatcttgtt ggcaatgggg       540
     atgatgatgg tttcccccat gactatttca ctgccattta aattgctgct atttgtttta       600
     cttgatggct ggacacgact cacgcatggg ctggtgatta gctacggagg gtga             654
//

If you have problems or comments...

PBIL Back to PBIL home page