(data stored in ACNUC9435 zone)

EMBL: BX936399.PE72

BX936399.PE72        Location/Qualifiers
FT   CDS_pept        50162..50428
FT                   /transl_table=11
FT                   /locus_tag="pYV0072"
FT                   /product="yscS; putative type III secretion protein"
FT                   /note="identical to Y. pestis YPCD1.45"
FT                   /db_xref="EnsemblGenomes-Gn:pYV0072"
FT                   /db_xref="EnsemblGenomes-Tr:CAF25415"
FT                   /db_xref="GOA:P69983"
FT                   /db_xref="InterPro:IPR002191"
FT                   /db_xref="InterPro:IPR006306"
FT                   /db_xref="UniProtKB/Swiss-Prot:P69983"
FT                   /protein_id="CAF25415.1"
FT                   /translation="MSQGDIIHFTSQALWLVLVLSMPPVLVAAVVGTLVSLVQALTQIQ
FT                   EQTLGFVIKLIAVVVTLFATASWLGNELHSFAEMTMMKIQGIR"
     atgagtcaag gtgacataat tcacttcacc agtcaggcat tatggctggt gctagtcctt        60
     tcaatgccgc cggtgttagt ggctgcggtg gtaggaactt tggtatcttt agtacaagct       120
     ttaacgcaaa tccaagagca aactctgggc ttcgttatca aattgatcgc tgtggtggtc       180
     acactgtttg ctaccgcctc gtggcttggt aatgaattgc acagttttgc agaaatgacc       240
     atgatgaaga tacaaggcat aagatga                                           267
//

If you have problems or comments...

PBIL Back to PBIL home page