(data stored in ACNUC9435 zone)

EMBL: BX936399.PE73

BX936399.PE73        Location/Qualifiers
FT   CDS_pept        50425..51210
FT                   /transl_table=11
FT                   /locus_tag="pYV0073"
FT                   /product="yscT; putative type III secretion protein"
FT                   /note="identical to Y. pestis YPCD1.46"
FT                   /db_xref="EnsemblGenomes-Gn:pYV0073"
FT                   /db_xref="EnsemblGenomes-Tr:CAF25416"
FT                   /db_xref="GOA:P69985"
FT                   /db_xref="InterPro:IPR002010"
FT                   /db_xref="InterPro:IPR006304"
FT                   /db_xref="UniProtKB/Swiss-Prot:P69985"
FT                   /protein_id="CAF25416.1"
FT                   /translation="MIADLIQRPLLTYTLLLPRFMACFVILPVLSKQLLGGVLLRNGIV
FT                   CSLALYVYPAVANQPYIEVDAFTLMLLIGKEIILGLLIGFVATIPFWALESAGFIVDNQ
FT                   RGAAMASLLNPGLDSQTSPTGLLLTQTLITIFFSGGAFLSLLSALFHSYVNWPVASFFP
FT                   AVSEQWVDFFYNQFSQILLIAAVLAAPLLIAMFLAEFGLALISRFAPSLNVFVLAMPIK
FT                   SAIASLLLVIYCMQMMSHASKAMLLVMDPISLLIPVLEK"
     atgatagcgg atttaatcca aagaccattg ctcacttata ccctgctgtt gcctcgtttt        60
     atggcttgtt ttgttatatt gccagtgtta agtaaacagc tcctcggtgg agtattgctg       120
     cgtaatggta ttgtctgttc attggctctt tatgtctatc ctgccgtcgc taaccaacct       180
     tatattgagg ttgatgcgtt tacgttgatg ctgcttatcg gcaaagagat catactgggg       240
     ttattgattg ggtttgtggc caccattcct ttctgggcct tagaatccgc aggatttatt       300
     gtagataacc aaagaggtgc cgcgatggca tctctactca atcctggact tgatagtcaa       360
     actagtccga ctggtttact tttgactcaa acgttaataa caattttctt cagcggaggg       420
     gctttcctct ctttgctttc agccctcttt cacagctatg taaattggcc ggtggccagc       480
     tttttccctg cagttagtga acagtgggtt gatttctttt ataaccaatt cagccagata       540
     ctattaatcg ccgctgtatt ggctgctcct ttactcatcg ctatgttttt agctgaattt       600
     ggacttgcac tcatcagtcg ttttgcgcct tctttaaacg tctttgtgct ggctatgccg       660
     ataaaaagcg cgatagcaag cctgttgttg gttatctact gtatgcaaat gatgagtcat       720
     gccagtaaag caatgctgtt ggttatggat cctataagtt tactgatccc tgttttggag       780
     aagtaa                                                                  786
//

If you have problems or comments...

PBIL Back to PBIL home page