(data stored in ACNUC9435 zone)

EMBL: BX936399.PE74

BX936399.PE74        Location/Qualifiers
FT   CDS_pept        51210..52274
FT                   /transl_table=11
FT                   /locus_tag="pYV0074"
FT                   /product="yscU; putative type III secretion protein"
FT                   /note="identical to Y. pestis YPCD1.47"
FT                   /db_xref="EnsemblGenomes-Gn:pYV0074"
FT                   /db_xref="EnsemblGenomes-Tr:CAF25417"
FT                   /db_xref="GOA:P69987"
FT                   /db_xref="InterPro:IPR006135"
FT                   /db_xref="InterPro:IPR006307"
FT                   /db_xref="InterPro:IPR029025"
FT                   /db_xref="PDB:2ML9"
FT                   /db_xref="UniProtKB/Swiss-Prot:P69987"
FT                   /protein_id="CAF25417.1"
FT                   /translation="MSGEKTEQPTPKKIRDARKKGQVAKSKEVVSTALIVALSAMLMGL
FT                   SDYYFEHFSKLMLIPAEQSYLPFSQALSYVVDNVLLEFFYLCFPLLTVAALMAIASHVV
FT                   QYGFLISGEAIKPDIKKINPIEGAKRIFSIKSLVEFLKSILKVVLLSILIWIIIKGNLV
FT                   TLLQLPTCGIECITPLLGQILRQLMVICTVGFVVISIADYAFEYYQYIKELKMSKDEIK
FT                   REYKEMEGSPEIKSKRRQFHQEIQSRNMRENVKRSSVVVANPTHIAIGILYKRGETPLP
FT                   LVTFKYTDAQVQTVRKIAEEEGVPILQRIPLARALYWDALVDHYIPAEQIEATAEVLRW
FT                   LERQNIEKQHSEML"
     atgagcggag aaaagacaga gcaacccacc ccgaagaaaa tccgtgatgc gcgcaaaaag        60
     ggacaggtag cgaaaagtaa ggaagtggtc tctactgcgc ttatcgtcgc gctgagtgcg       120
     atgttaatgg ggctttctga ctactatttc gagcatttta gtaagctgat gctaatcccc       180
     gcagagcaga gctatcttcc tttctcgcag gcgcttagct atgtggttga caatgtgttg       240
     ctcgagtttt tttatctctg ttttcctttg ttaacagtgg cggcattaat ggcgatcgca       300
     tctcatgttg tgcagtatgg ttttcttata agtggtgaag caattaaacc ggatattaaa       360
     aaaatcaatc caatagaggg tgccaagcgt atcttttcca tcaaaagttt agtggagttt       420
     ctcaaatcca ttctcaaggt tgttttgctc agtatactca tctggataat cattaaggga       480
     aatctagtca cactcttgca gttgccaacc tgtggaattg aatgtattac ccctttattg       540
     gggcaaatac tccggcagtt gatggttatc tgtactgttg gctttgtggt catctccata       600
     gccgactatg cctttgaata ctatcaatat attaaggaac ttaaaatgag caaggatgag       660
     atcaaacgcg agtacaaaga aatggagggt agcccagaaa tcaaaagcaa gcgtcgtcag       720
     tttcatcaag agatccaatc gaggaacatg cgggaaaatg ttaaacgctc atcagtggtg       780
     gtagctaatc cgacccatat tgctattggt attctttaca agcgagggga aacaccacta       840
     ccgttggtaa cattcaaata taccgatgcc caagttcaga ctgtgcgcaa aatagcagaa       900
     gaagaagggg tgcctatttt acaacgtatc ccattagccc gtgctcttta ttgggatgcg       960
     ctcgtcgatc actatattcc ggctgagcaa atagaggcca cagctgaagt gctacgatgg      1020
     ctagaaaggc aaaatatcga gaaacaacat tccgaaatgt tataa                      1065
//

If you have problems or comments...

PBIL Back to PBIL home page