(data stored in ACNUC9435 zone)

EMBL: BX936399.PE76

BX936399.PE76        Location/Qualifiers
FT   CDS_pept        53369..54184
FT                   /transl_table=11
FT                   /locus_tag="pYV0076"
FT                   /product="lcrF, virF; putative thermoregulatory protein"
FT                   /note="identical to Y. pestis YPCD1.49"
FT                   /db_xref="EnsemblGenomes-Gn:pYV0076"
FT                   /db_xref="EnsemblGenomes-Tr:CAF25419"
FT                   /db_xref="GOA:Q663J0"
FT                   /db_xref="InterPro:IPR003313"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR037923"
FT                   /db_xref="UniProtKB/TrEMBL:Q663J0"
FT                   /protein_id="CAF25419.1"
FT                   /translation="MASLEIIKLEWVTPIFKVVEHSQDGLYILLQGQISWQSSGQTYDL
FT                   DEGNMLFLRRGSYAVRCGTKEPCQLLWIPLPGSFLSTFLHRFGSLLSEIGRDNSTPKPL
FT                   LIFNISPILSQSIQNLCAILERSDFPSVLTQLRIEELLLLLAFSSQGTLFLSALRHLGN
FT                   RPEERLQKFMEENYLQGWKLSKFAREFGMGLTTFKELFGTVYGISPRAWISERRILYAH
FT                   QLLLNGKMSIVDIAMEAGFSSQSYFTQSYRRRFGCTPSQARLTKIATTG"
     atggcatcac tagagattat taaattagaa tgggtcacac ctatatttaa ggttgttgag        60
     cattcacaag atggcctata tattcttttg caaggtcaga tttcatggca gagcagcggt       120
     cagacatatg atttagatga ggggaatatg ctgtttttgc gtcgtggcag ctatgctgtt       180
     cgatgtggta caaaagaacc ctgccaatta ctttggattc cattacccgg cagttttttg       240
     agtacttttt tgcatcgctt tggttctttg cttagtgaaa ttggacgaga caactccaca       300
     cccaaaccat tgttaatttt taatatttca ccaatattat cacaatccat tcaaaatcta       360
     tgtgccatat tggaacggag tgattttccg tcagtattaa cgcaactgcg tattgaggaa       420
     ttactgcttt tgcttgcctt tagctcgcaa gggactttat ttctctcggc tctgcgccat       480
     ttaggcaacc gcccagaaga acggttgcaa aaatttatgg aggaaaatta tctacaaggg       540
     tggaagctaa gcaaatttgc gcgagaattc ggcatgggat taaccacatt caaagaactg       600
     tttggtacag tttatggcat ttcaccacgc gcctggataa gcgagcgacg tattctctat       660
     gctcaccaat tacttcttaa tggtaagatg agtattgttg atattgccat ggaagcgggg       720
     ttctcgagtc agtcttattt cactcaaagt tatcgacgtc gcttcggatg cactccaagc       780
     caagcccgtc ttactaaaat agcaaccaca ggctaa                                 816
//

If you have problems or comments...

PBIL Back to PBIL home page