(data stored in ACNUC9435 zone)

EMBL: BX936399.PE77

BX936399.PE77        Location/Qualifiers
FT   CDS_pept        54263..54361
FT                   /transl_table=11
FT                   /locus_tag="pYV0077"
FT                   /product="hypothetical protein"
FT                   /note="similar to Y. pestis YPCD1.50"
FT                   /db_xref="EnsemblGenomes-Gn:pYV0077"
FT                   /db_xref="EnsemblGenomes-Tr:CAF25420"
FT                   /db_xref="GOA:Q663I9"
FT                   /db_xref="InterPro:IPR035181"
FT                   /db_xref="UniProtKB/TrEMBL:Q663I9"
FT                   /protein_id="CAF25420.1"
FT                   /translation="MSQISTKHRTVLFRRWMAIICCLIINMAYLVY"
     atgagccaaa tttcaacgaa acatagaaca gtattgtttc gccgctggat ggcaataata        60
     tgttgtttaa taatcaatat ggcttatctg gtttattaa                               99
//

If you have problems or comments...

PBIL Back to PBIL home page