(data stored in ACNUC9435 zone)

EMBL: BX936399.PE78

BX936399.PE78        Location/Qualifiers
FT   CDS_pept        54587..55000
FT                   /transl_table=11
FT                   /locus_tag="pYV0078"
FT                   /product="hypothetical protein"
FT                   /note="identical to Y. pestis YPCD1.51"
FT                   /db_xref="EnsemblGenomes-Gn:pYV0078"
FT                   /db_xref="EnsemblGenomes-Tr:CAF25421"
FT                   /db_xref="GOA:Q663I8"
FT                   /db_xref="InterPro:IPR010261"
FT                   /db_xref="InterPro:IPR013353"
FT                   /db_xref="UniProtKB/TrEMBL:Q663I8"
FT                   /protein_id="CAF25421.1"
FT                   /translation="MQNLLKNLAASLGRKPFVADKQGVYRLTIDKHLVMLAPHGSELVL
FT                   RTPIDAPMLREGNNVNVTLLRSLMQQALAWAKRYPQTLVLDDCGQLVLEARLRLQELDT
FT                   HGLQEVINKQLALLEHLIPQLTPFSVASRVGWN"
     atgcaaaatt tactaaaaaa cttggcggcc agtttaggaa gaaaaccgtt tgttgccgat        60
     aaacaaggtg tttaccgttt aactatagat aagcatcttg tcatgctggc tccgcatggt       120
     tcagaactgg tattacgcac tcctattgac gcaccaatgt tacgtgaagg aaataacgtt       180
     aacgtcacat tgcttcgctc cctaatgcaa caagcgttgg catgggctaa acgttaccct       240
     caaactttag tattggatga ttgtggtcaa ttggtactgg aggcgcgttt acgtctacaa       300
     gagcttgata ctcacggatt gcaagaagta ataaataaac aactggctct gctagaacat       360
     ttaattcctc agttaacacc attttctgta gcgtctcgcg tggggtggaa ttaa             414
//

If you have problems or comments...

PBIL Back to PBIL home page