(data stored in ACNUC9435 zone)

EMBL: BX936399.PE79

BX936399.PE79        Location/Qualifiers
FT   CDS_pept        55006..56829
FT                   /transl_table=11
FT                   /locus_tag="pYV0079"
FT                   /product="yscC; putative type III secretion protein"
FT                   /note="similar to Y. pestis YPCD1.52"
FT                   /db_xref="EnsemblGenomes-Gn:pYV0079"
FT                   /db_xref="EnsemblGenomes-Tr:CAF25422"
FT                   /db_xref="GOA:Q663I7"
FT                   /db_xref="InterPro:IPR003522"
FT                   /db_xref="InterPro:IPR004845"
FT                   /db_xref="InterPro:IPR004846"
FT                   /db_xref="InterPro:IPR005644"
FT                   /db_xref="InterPro:IPR038591"
FT                   /db_xref="UniProtKB/TrEMBL:Q663I7"
FT                   /protein_id="CAF25422.1"
FT                   /translation="MAFPLHSFFKRVLTGTLLLLSNYSWAQELDWLPIPYVYVAKGESL
FT                   RDLLIDFSANYDATVVVSDKINDKVSGQFEHDNPQDFLQHIASLYNLVWYYDGNVLYIF
FT                   KNSEVASRLIRLQESEAAELKLALQRSGIWEPRFGWRPDASNRLVYVSGPPRYLELVEQ
FT                   TAAALEQQTQIRSEKTGALAIEIFPLKYASASDRTIHYRDDEVAAPGVATILQRVLSDA
FT                   TIQQVTVDNQRIPQAATRASAQAKVEADPSLNAIIVRDSPERMPMYQRLIHALDKPSAR
FT                   IEVALSIVDINADQLTELGVDWRVGIRTGNNHQVVIKTTGDQSNIASNGALGSLIDARG
FT                   LDYLLARVNLLENEGSAQVVSRPTLLTQENAQAVIDHHETYYVKVTGKEVAELKGITYG
FT                   TMLRMTPRVLTQGDKSEISLNLHIEDGNQKPNSSGIDGIPTISRTVVDTVARVGHGQSL
FT                   IIGGIYRDELSVALSKVPLLGDIPYLGALFRRKSELTRRTVRLFIIEPRIIDEGIAHHL
FT                   ALGNGRDLRTGILAVDEISNQSTTLNKLLGVSQCQPLNKAQEVQKWLSQNNKSSYLTQC
FT                   KMDKSLGWRVVEGACTPAESWCVSAPKRGVL"
     atggcttttc cgctacattc ttttttcaag cgcgtactca ccgggacgtt actgttactt        60
     tctaactata gctgggcgca agaacttgat tggttgccta taccttatgt ttatgtggcg       120
     aagggggaaa gtttacgcga tttattaatt gatttcagcg ctaattatga tgctacagtg       180
     gtagtaagcg ataagattaa tgacaaagtt tccggccagt ttgagcatga taaccctcag       240
     gatttcctac agcatattgc ctccctttac aatttggttt ggtactatga tggcaatgtg       300
     ctctacattt ttaaaaatag tgaggtagcg tctcgtctca ttcgtttaca ggaaagtgag       360
     gccgcagagt taaagctggc attacaacgt tctggtatat gggagcctcg ttttggctgg       420
     cgccctgatg ctagcaaccg ccttgtttac gtctctggtc ctcctcgtta tcttgaattg       480
     gttgaacaga ccgcagccgc attggaacaa cagacgcaaa ttcgcagtga aaaaacaggg       540
     gcattagcga ttgagatttt ccctctcaaa tatgcatcag cgagcgatcg aactattcat       600
     taccgtgatg acgaagtggc tgctcctggg gttgcaacga tacttcaacg cgtgttaagc       660
     gatgccacaa tccaacaagt gacagtggat aatcagagaa taccgcaggc cgctacccgg       720
     gcttcagctc aagccaaggt tgaagcggat ccatcgctca atgcgataat agtgcgcgat       780
     tctcctgagc gtatgccaat gtatcaacgg ttaattcatg cgcttgataa acctagcgct       840
     cgtattgaag tggcgttatc cattgtcgat ataaatgccg accaacttac tgaattaggt       900
     gtggactggc gagttggcat tcgtactggc aacaatcatc aggtggtaat aaaaacaacc       960
     ggggatcaaa gtaacatcgc ttcaaacggt gcattgggta gtttgattga tgctcgcggg      1020
     cttgactacc tattagcaag agtcaattta cttgaaaatg aaggttcggc tcaagttgtt      1080
     tcacgtccga ccctgctaac acaagaaaat gcccaagcgg tgattgatca ccatgaaacc      1140
     tattacgtca aagtgacagg taaagaagtg gctgaactga aagggatcac ctacggcact      1200
     atgctgcgta tgacaccaag ggtgctgact caaggagata agtcagaaat cagtctcaat      1260
     ctacacattg aggatgggaa ccaaaaaccg aatagttcag ggattgacgg aatccccact      1320
     atcagtcgta cggtcgttga tactgtcgct cgcgtgggac atggccagag tttgattatt      1380
     ggtggtattt atcgtgacga attgagtgtt gctcttagta aggtgccttt gcttggtgat      1440
     attccttatc ttggcgcact tttccgccgt aaaagtgagt taactcgccg tacggtacgg      1500
     ctgtttatca tcgaaccacg gattattgac gaaggtattg cgcatcattt agcgttaggt      1560
     aatggtcggg atctacgtac tggtatctta gctgttgatg aaatatctaa tcaaagtact      1620
     accttgaata agttattagg tgtctcccag tgtcagcctt taaacaaagc gcaagaagtg      1680
     cagaaatggc tgagtcaaaa caataaatca tcctatctta ctcagtgcaa gatggacaaa      1740
     agtttgggat ggcgcgtggt tgaaggtgct tgtactcccg cggaatcatg gtgtgtttca      1800
     gcgcctaagc gtggcgtatt gtga                                             1824
//

If you have problems or comments...

PBIL Back to PBIL home page