(data stored in ACNUC9435 zone)

EMBL: BX936399.PE80

BX936399.PE80        Location/Qualifiers
FT   CDS_pept        56826..58085
FT                   /transl_table=11
FT                   /locus_tag="pYV0080"
FT                   /product="yscD; putative type III secretion protein"
FT                   /note="similar to Y. pestis YPCD1.53"
FT                   /db_xref="EnsemblGenomes-Gn:pYV0080"
FT                   /db_xref="EnsemblGenomes-Tr:CAF25423"
FT                   /db_xref="GOA:Q663I6"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR012843"
FT                   /db_xref="InterPro:IPR032030"
FT                   /db_xref="InterPro:IPR032034"
FT                   /db_xref="PDB:4D9V"
FT                   /db_xref="UniProtKB/TrEMBL:Q663I6"
FT                   /protein_id="CAF25423.1"
FT                   /translation="MSWVCRFYQGKHRGVEVELPHGRCVFGSDPLQSDIVLSDSEIAPV
FT                   HLVLMVDEEGIRLTDSAEPLLQEGLPVPLGTLLRAGSCLEVGFLLWTFVAVGQPLPETL
FT                   QVPTQRKEPTDRLPRSRLGIGLGVLSLLLLLTFLGLLGHGLWREYNQDGQLVEQEVRRL
FT                   LATAAYKDVVLTSPKKEGEPWLLTGYIQDNHARLSLQNFLESHGIPFRLELRSMEELRQ
FT                   GAEFILQRLGYHGIEVSLAPQAGWLQLNGEVSEEIQKQKIDSLLQAEVPGLLGVESKVR
FT                   IAGNQRKRLDALLEQFGLDSDFTVNVKGELIELRGQVNDEKLNSFNQLQQTFRQEFGNR
FT                   PKLELVNVGGQPQHDELNFEVQAISLGKVPYVVLDNHQRYPEGAILNNGVRILAIRRDA
FT                   VIVSKGKREFVIQLNGGKPR"
     gtgagttggg tctgtcgttt ttatcaaggg aagcaccgtg gtgttgaagt tgagcttcct        60
     catgggcgct gtgtttttgg ttcagacccg ttgcagtcag atattgttct ttctgacagc       120
     gaaatagcac ccgtgcattt agtgctgatg gtcgatgaag aaggtattcg cctaactgat       180
     tctgcagaac ctctactaca agaagggctt cccgtgccgt tggggactct tcttcgcgcg       240
     ggctcttgtc tggaagtagg ttttttactg tggacatttg tcgccgtagg gcaacctttg       300
     ccagagacgt tacaggttcc cacgcagaga aaagagccaa ccgacaggtt acctcgttca       360
     cgacttggga ttgggcttgg agttctttct ttattgttgc ttttgacttt tttggggctg       420
     ctagggcacg gattgtggcg cgagtataac caggatggac aacttgttga gcaagaagta       480
     cggcgcttgc tggcaactgc tgcttacaag gatgtcgttt taacatcgcc caaaaaagag       540
     ggtgaacctt ggttattaac tggttatatc caggataatc atgcccgctt gtcactgcaa       600
     aattttcttg agagccatgg cattccattc cggcttgaac tgcgcagcat ggaagaactg       660
     cgtcaggggg cagaattcat cctgcaacgg ttgggatacc atggaattga ggtttcttta       720
     gcaccgcaag cgggatggct acaattgaat ggggaagtgt cagaggaaat acaaaagcaa       780
     aaaattgata gcctgctgca agctgaagtg ccagggctgc tcggtgtaga aagtaaagtg       840
     cggattgccg gtaatcaacg caagcggctt gatgcattac ttgaacaatt tggtctggat       900
     tcagatttca ctgtaaatgt taaaggtgag ctgattgaat tacgcgggca agtcaatgat       960
     gaaaaattga attcatttaa tcaactacaa caaacttttc gccaagagtt tggcaatcga      1020
     cctaaattag aactggtcaa tgtcgggggg caaccccagc atgatgaatt gaatttcgag      1080
     gtgcaagcta tctcgttagg gaaagtgccc tatgtggtac tcgacaatca tcaacgctat      1140
     ccagaaggtg ccatacttaa caatggcgtt cgtattctgg ctattcgacg cgatgcggtg      1200
     attgtgagta aaggaaaacg ggaatttgtg atccaactca atggaggtaa acctcgatga      1260
//

If you have problems or comments...

PBIL Back to PBIL home page