(data stored in ACNUC9435 zone)

EMBL: BX936399.PE82

BX936399.PE82        Location/Qualifiers
FT   CDS_pept        58283..58546
FT                   /transl_table=11
FT                   /locus_tag="pYV0082"
FT                   /product="yscF; putative type III secretion protein"
FT                   /note="identical to Y. pestis YPCD1.55"
FT                   /db_xref="EnsemblGenomes-Gn:pYV0082"
FT                   /db_xref="EnsemblGenomes-Tr:CAF25425"
FT                   /db_xref="GOA:Q663I4"
FT                   /db_xref="InterPro:IPR011841"
FT                   /db_xref="InterPro:IPR021123"
FT                   /db_xref="InterPro:IPR037203"
FT                   /db_xref="UniProtKB/TrEMBL:Q663I4"
FT                   /protein_id="CAF25425.1"
FT                   /translation="MSNFSGFTKGTDIADLDAVAQTLKKPADDANKAVNDSIAALKDKP
FT                   DNPALLADLQHSINKWSVIYNINSTIVRSMKDLMQGILQKFP"
     atgagtaact tctctggatt tacgaaagga accgatatcg cagacttaga tgcggtggct        60
     caaacgctca agaagccagc agacgatgca aacaaagcgg ttaatgactc gatagcagca       120
     ttgaaagata agcctgacaa cccggcgcta cttgctgact tacaacattc aattaataaa       180
     tggtcggtaa tttacaatat aaactcaacc atagttcgta gcatgaaaga cttaatgcaa       240
     ggcatcctac agaagttccc ataa                                              264
//

If you have problems or comments...

PBIL Back to PBIL home page