(data stored in ACNUC9435 zone)

EMBL: BX936399.PE83

BX936399.PE83        Location/Qualifiers
FT   CDS_pept        58548..58895
FT                   /transl_table=11
FT                   /locus_tag="pYV0083"
FT                   /product="yscG; putative type III secretion protein"
FT                   /note="similar to Y. pestis YPCD1.56"
FT                   /db_xref="EnsemblGenomes-Gn:pYV0083"
FT                   /db_xref="EnsemblGenomes-Tr:CAF25426"
FT                   /db_xref="GOA:Q663I3"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013348"
FT                   /db_xref="UniProtKB/TrEMBL:Q663I3"
FT                   /protein_id="CAF25426.1"
FT                   /translation="MKYKLNVLLAEIALIGTGNHCHEEANCIAEWLHLKGEEEAVQLIR
FT                   LSSLMNRGDYASALQQGNKLAYPDLEPWLALCEYRLGLGSALESRLNRLARSQDPRIQT
FT                   FVNGMREQLKT"
     atgaaatata aactcaacgt actgttagca gagattgctc tgattggaac cggcaaccac        60
     tgccacgaag aagcgaattg cattgctgaa tggttacatt tgaaaggtga agaagaggcg       120
     gttcaattga ttcgcctttc ctctttgatg aaccgtgggg actacgcaag cgccttgcaa       180
     caaggaaata aattagctta tcctgatttg gaaccttggt tagccttatg tgaatatcgc       240
     ctcgggttgg ggagcgcctt agagtcacgt ttaaatcgtc tcgcaaggag tcaggatcct       300
     agaatacaga catttgtgaa tggaatgagg gagcaactaa aaacatga                    348
//

If you have problems or comments...

PBIL Back to PBIL home page