(data stored in ACNUC9435 zone)

EMBL: BX936399.PE84

BX936399.PE84        Location/Qualifiers
FT   CDS_pept        58892..59389
FT                   /transl_table=11
FT                   /locus_tag="pYV0084"
FT                   /product="yscH, yopR, lcrP; putative type III secretion
FT                   protein"
FT                   /note="similar to Y. pestis YPCD1.57"
FT                   /db_xref="EnsemblGenomes-Gn:pYV0084"
FT                   /db_xref="EnsemblGenomes-Tr:CAF25427"
FT                   /db_xref="GOA:Q663I2"
FT                   /db_xref="InterPro:IPR013349"
FT                   /db_xref="InterPro:IPR041814"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q663I2"
FT                   /protein_id="CAF25427.1"
FT                   /translation="MTVTLNRGSITSLMSSSQAVSTLQPVASELKTQLENKLKSESAEK
FT                   TREVLWQQYYASNPPDHAVLEVLAMPVREALLARFGQHQGSVVPAIDLPELRSVLQQFD
FT                   SFGKRWEAILLQVLEGIKPNESQVGLPYLSELINKELMILLPSNSIVDSLLHNSHQIDM
FT                   DT"
     atgacggtta cccttaatag aggttccatt acatcgttga tgtcttcgtc tcaggcagtc        60
     tctacgctac aaccggtagc atctgagctg aaaacacaac tggagaataa gctaaaaagt       120
     gaatccgctg aaaagacacg ggaagttctg tggcagcaat attatgccag taaccctcct       180
     gaccatgccg ttcttgaggt tttggcgatg ccagtacgtg aggcgttact ggcgcgtttc       240
     ggtcaacatc aagggtctgt tgtaccggct atagatttac ctgaattgcg tagtgtattg       300
     cagcagtttg actcgtttgg taagcggtgg gaagcaatat tgctccaagt attagagggt       360
     ataaaaccca atgagagcca ggttggatta ccttatttat cagagttaat aaataaagaa       420
     ttaatgatcc tattaccgtc taactcgatt gtagatagcc tacttcataa cagccatcaa       480
     attgatatgg atacataa                                                     498
//

If you have problems or comments...

PBIL Back to PBIL home page