(data stored in ACNUC9435 zone)

EMBL: BX936399.PE88

BX936399.PE88        Location/Qualifiers
FT   CDS_pept        61086..61718
FT                   /transl_table=11
FT                   /locus_tag="pYV0088"
FT                   /product="yscL; putative type III secretion protein"
FT                   /note="similar to Y. pestis YPCD1.61"
FT                   /db_xref="EnsemblGenomes-Gn:pYV0088"
FT                   /db_xref="EnsemblGenomes-Tr:CAF25431"
FT                   /db_xref="GOA:P69977"
FT                   /db_xref="InterPro:IPR012842"
FT                   /db_xref="InterPro:IPR018035"
FT                   /db_xref="UniProtKB/Swiss-Prot:P69977"
FT                   /protein_id="CAF25431.1"
FT                   /translation="MQPFVQIIPSNLSLACGLRILRAEDYQSSLTTEELISAAKQDAEK
FT                   ILADAQEVYEQQKQLGWQAGMDEARTLQATLIHETQLQCQQFYRHVEQQMSEVVLLAVR
FT                   KILNDYDQVAMTLQVVREALALVSNQKQVVVRVNPDQAGAIREQIAKVHKDFPEISYLE
FT                   VTADARLDQGGCILETEVGIIDASIDGQIEALSRAISTTLGQMKVTE"
     atgcagccat ttgttcaaat aataccaagt aatctctcgc tcgcttgcgg tctgcgtatt        60
     ttgcgcgccg aagattacca atccagttta acaaccgaag agttgattag tgccgcaaaa       120
     caggatgctg aaaagatcct ggctgacgcc caagaggttt atgagcaaca aaagcagtta       180
     ggatggcagg ctggcatgga tgaggcgcgt accttacagg cgactttgat tcatgaaaca       240
     cagttacaat gtcagcaatt ttatcgccac gtcgaacaac agatgagtga agttgtactt       300
     ttggcggtac gtaaaatcct caatgactat gatcaagtgg ctatgacact gcaagttgtg       360
     cgggaggctt tagccttggt gagtaatcag aagcaagtcg tggtcagggt caaccctgat       420
     caggcaggag ctattcgtga acaaatagct aaagtacata aagacttccc ggaaataagc       480
     tatttagagg tgactgccga tgcgcgtttg gatcaagggg gctgtatatt agagactgag       540
     gtaggtatta ttgacgcgag tattgatggg caaattgaag cactttctcg ggcaatatct       600
     accactttag gacaaatgaa agttacagaa tag                                    633
//

If you have problems or comments...

PBIL Back to PBIL home page