(data stored in ACNUC9435 zone)

EMBL: BX936399.PE9

BX936399.PE9         Location/Qualifiers
FT   CDS_pept        complement(7489..7806)
FT                   /transl_table=11
FT                   /locus_tag="pYV0009"
FT                   /product="hyothetical protein"
FT                   /note="similar to Y. pestis YPCD1.83c"
FT                   /db_xref="EnsemblGenomes-Gn:pYV0009"
FT                   /db_xref="EnsemblGenomes-Tr:CAF25352"
FT                   /db_xref="GOA:Q663F8"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q663F8"
FT                   /protein_id="CAF25352.1"
FT                   /translation="MTQPKQTKRRFSPEFKLEAIEQVVKYQRSTIEVARALELDPSQLR
FT                   KWIRQYKEEVSGVTPDNPALTPEQREIQSLRAQIKRLEMEKEILKQAAVLMSEFPIKSL
FT                   R"
     atgactcaac ctaaacagac caaacgccgt ttttctcctg aattcaaact ggaagctatt        60
     gagcaggtcg ttaagtatca gcggtcaacc atcgaggttg cacgcgctct ggagctggat       120
     cccagccaat tgcgtaaatg gatacgccag tacaaagaag aagtcagcgg ggtgacgccg       180
     gacaatcctg cactgacacc agagcaacgt gaaatccagt cgctcagggc gcagattaaa       240
     cggctggaaa tggaaaaaga aatactaaag caggcagccg tgttgatgag cgagttcccc       300
     atcaaatctt tgcgttaa                                                     318
//

If you have problems or comments...

PBIL Back to PBIL home page