(data stored in ACNUC9435 zone)

EMBL: BX936399.PE94

BX936399.PE94        Location/Qualifiers
FT   CDS_pept        complement(64366..65772)
FT                   /transl_table=11
FT                   /locus_tag="pYV0094"
FT                   /product="yopH; putative protein-tyrosine phosphatase Yop
FT                   effector"
FT                   /note="similar to Y. pestis YPCD1.67c"
FT                   /db_xref="EnsemblGenomes-Gn:pYV0094"
FT                   /db_xref="EnsemblGenomes-Tr:CAF25437"
FT                   /db_xref="GOA:P08538"
FT                   /db_xref="InterPro:IPR000242"
FT                   /db_xref="InterPro:IPR000387"
FT                   /db_xref="InterPro:IPR003546"
FT                   /db_xref="InterPro:IPR003595"
FT                   /db_xref="InterPro:IPR015103"
FT                   /db_xref="InterPro:IPR016130"
FT                   /db_xref="InterPro:IPR029021"
FT                   /db_xref="InterPro:IPR036484"
FT                   /db_xref="PDB:1K46"
FT                   /db_xref="PDB:1M0V"
FT                   /db_xref="UniProtKB/Swiss-Prot:P08538"
FT                   /protein_id="CAF25437.1"
FT                   /translation="MNLSLSDLHRQVSRLVQQESGDCTGKLRGNVAANKETTFQGLTIA
FT                   SGARESEKVFAQTVLSHVANVVLTQEDTAKLLQSTVKHNLNNYDLRSVGNGNSVLVSLR
FT                   SDQMTLQDAKVLLEAALRQESGARGHVSSHSHSALHAPGTPVREGLRSHLDPRTPPLPP
FT                   RERPHTSGHHGAGEARATAPSTVSPYGPEARAELSSRLTTLRNTLAPATNDPRYLQACG
FT                   GEKLNRFRDIQCCRQTAVRADLNANYIQVGNTRTIACQYPLQSQLESHFRMLAENRTPV
FT                   LAVLASSSEIANQRFGMPDYFRQSGTYGSITVESKMTQQVGLGDGIMADMYTLTIREAG
FT                   QKTISVPVVHVGNWPDQTAVSSEVTKALASLVDQTAETKRNMYESKGSSAVGDDSKLRP
FT                   VIHCRAGVGRTAQLIGAMCMNDSRNSQLSVEDMVSQMRVQRNGIMVQKDEQLDVLIKLA
FT                   EGQGRPLLNS"
     atgaacttat cattaagcga tcttcatcgt caggtatctc gattggtgca gcaagagagc        60
     ggtgattgta ccgggaaatt aagaggtaac gttgctgcca ataaagaaac tacctttcaa       120
     ggtttgacca tagccagtgg tgccagagag tcagaaaaag tatttgctca aactgtacta       180
     agccacgtag caaatgttgt tctaactcaa gaagataccg ctaagctatt gcaaagtacg       240
     gtaaagcata atttgaataa ttatgactta agaagtgtcg gcaatggtaa tagtgtactt       300
     gtcagtttac gtagtgacca aatgacacta caagacgcca aagtgctgtt ggaggccgca       360
     ttgcgacaag agtcgggagc gagggggcat gtatcatctc attcacattc agcccttcac       420
     gcaccgggaa ccccggtgcg tgaaggactg cgttcacatc tagaccccag aactccaccg       480
     ttgccaccgc gtgaacgacc acacacttct ggccatcacg gggctggcga agccagagcc       540
     accgcaccaa gcactgtttc tccttatggc ccagaagcgc gcgcagaact cagcagccgc       600
     ctcaccacat tgcgcaatac gctggcgcca gcaacgaatg atccgcgtta cttacaagcc       660
     tgcggcggtg aaaagctaaa ccgatttaga gatattcaat gctgtcggca aaccgcagta       720
     cgcgccgatc ttaatgccaa ttacatccag gtcggtaaca ctcgtaccat agcgtgccag       780
     tatccgctac aatctcaact tgaaagccat ttccgtatgc tggcagaaaa ccgaacgcca       840
     gtgttggctg ttttagcgtc cagttctgag atagccaatc aaagattcgg tatgccagat       900
     tatttccgcc agagtggtac ctatggcagt atcactgtag agtctaaaat gactcagcaa       960
     gttggtctcg gtgacgggat tatggcagat atgtatactt taacgattcg tgaagcgggt      1020
     caaaaaacaa tctctgttcc tgtggttcat gttggcaatt ggcccgatca gaccgcagtc      1080
     agctctgaag ttaccaaggc actcgcttca ctggtagatc aaacagcaga aacaaaacgc      1140
     aatatgtatg aaagcaaagg aagttcagcg gtaggagatg actccaaatt acggccggta      1200
     atacattgcc gtgcgggtgt tggccgtact gcgcaactga ttggcgcaat gtgcatgaat      1260
     gatagtcgta atagtcagtt aagcgtagaa gatatggtca gccaaatgcg agtacaaaga      1320
     aatggtatta tggtacaaaa agatgagcaa cttgatgttc tgattaagtt ggctgaagga      1380
     caagggcgac cattattaaa tagctaa                                          1407
//

If you have problems or comments...

PBIL Back to PBIL home page