(data stored in ACNUC9435 zone)

EMBL: BX936399.PE98

BX936399.PE98        Location/Qualifiers
FT   CDS_pept        complement(67275..68141)
FT                   /transl_table=11
FT                   /locus_tag="pYV0098"
FT                   /product="yopP, yopJ; putative targeted effector protein"
FT                   /note="similar to Y. pestis YPCD1.71c"
FT                   /db_xref="EnsemblGenomes-Gn:pYV0098"
FT                   /db_xref="EnsemblGenomes-Tr:CAF25441"
FT                   /db_xref="GOA:P31498"
FT                   /db_xref="InterPro:IPR005083"
FT                   /db_xref="UniProtKB/Swiss-Prot:P31498"
FT                   /protein_id="CAF25441.1"
FT                   /translation="MIGPISQINISGGLSEKETSSLISNEELKNIITQLETDISDGSWF
FT                   HKNYSRMDVEVMPALVIQANNKYPEMNLNLVTSPLDLSIEIKNVIENGVRSSRFIINMG
FT                   EGGIHFSVIDYKHINGKTSLILFEPANFNSMGPAMLAIRTKTAIERYQLPDCHFSMVEM
FT                   DIQRSSSECGIFSFALAKKLYIERDSLLKIHEDNIKGILSDGENPLPHDKLDPYLPVTF
FT                   YKHTQGKKRLNEYLNTNPQGVGTVVNKKNETIVNRFDNNKSIVDGKELSVSVHKKRIAE
FT                   YKTLLKV"
     atgatcggac caatatcaca aataaatatc tccggtggct tatcagaaaa agagaccagt        60
     tctttaatca gtaatgaaga gcttaaaaat atcataacac agttggaaac tgatatatcg       120
     gatggatcct ggttccataa aaattattca cgtatggatg tagaagtcat gcccgcattg       180
     gtaatccagg cgaacaataa atatccggaa atgaatctta atcttgttac atctccattg       240
     gacctttcaa tagaaataaa aaacgtcata gaaaatggag ttagatcttc ccgcttcata       300
     attaacatgg gggaaggtgg aatacatttc agtgtaattg attacaaaca tataaatggg       360
     aaaacatctc tgatattgtt tgaaccagca aactttaaca gtatggggcc agcgatgctg       420
     gcaataagga caaaaacggc tattgaacgt tatcaattac ctgattgcca tttctccatg       480
     gtggaaatgg atattcagcg aagctcatct gaatgtggta tttttagttt tgcactggca       540
     aaaaaacttt acatcgagag agatagcctg ttgaaaatac atgaagataa tataaaaggt       600
     atattaagtg atggtgaaaa tcctttaccc cacgataagt tggacccgta tctcccggta       660
     actttttaca aacatactca aggtaaaaaa cgtcttaatg aatatttaaa tactaacccg       720
     cagggagttg gtactgttgt taacaaaaaa aatgaaacca tcgttaatag atttgataac       780
     aataaatcca ttgtagatgg aaaggaatta tcagtttcgg tacataaaaa gagaatagct       840
     gaatataaaa cacttctcaa agtataa                                           867
//

If you have problems or comments...

PBIL Back to PBIL home page