(data stored in ACNUC9435 zone)

EMBL: BX936399.PE99

BX936399.PE99        Location/Qualifiers
FT   CDS_pept        complement(68142..68276)
FT                   /transl_table=11
FT                   /locus_tag="pYV0099"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:pYV0099"
FT                   /db_xref="EnsemblGenomes-Tr:CAF25442"
FT                   /db_xref="UniProtKB/TrEMBL:Q663G7"
FT                   /protein_id="CAF25442.1"
FT                   /translation="MGIFVRVLPVCSGFTHQRLNVLLQCTVYLEYKIHTAVNSLNKDK"
     ttgggaattt ttgttcgagt gctgcccgtc tgttccgggt tcacccatca acgattgaac        60
     gtcttattgc aatgtaccgt ttatctggaa tataaaattc ataccgctgt taattccctg       120
     aataaggata aataa                                                        135
//

If you have problems or comments...

PBIL Back to PBIL home page