(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_1

ID   CAGLA1_1; SV 1; circular; genomic DNA; GRV; FUN; 20063 BP.
XX
AC   AJ511533_GR;
XX
DT   19-SEP-2006 (Rel. 106, Created)
DT   02-NOV-2010 (Rel. 126, Last updated, Version 11)
XX
DE   Candida glabrata (strain ATCC 2001 / NRRL Y-65 / CBS 138 / IFO 0622)
DE   mitochondrion, complete sequence.
XX
KW   complete genome; genome reviews.
XX
OS   Candida glabrata (strain ATCC 2001 / NRRL Y-65 / CBS 138 / IFO 0622)
OC   Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina; Saccharomycetes;
OC   Saccharomycetales; Saccharomycetaceae; Nakaseomyces; mitosporic
OC   Nakaseomyces.
OG   Mitochondrion
XX
RN   [1]
RX   PUBMED; 12527359.
RA   Koszul R., Malpertuy A., Frangeul L., Bouchier C., Wincker P., Thierry
RA   A., Duthoy S., Ferris S., Hennequin C., Dujon B.
RT   "The complete mitochondrial genome sequence of the pathogenic yeast
RT   Candida (Torulopsis) glabrata.";
RL   FEBS Lett. 534:39-48(2003).
XX
CC   This Genome Reviews entry was created from entry AJ511533.1 in the
CC   EMBL/Genbank/DDBJ databases on 15 February 2011.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..20063
FT                   /organism="Candida glabrata"
FT                   /strain="ATCC 2001 = NRRL Y-65 = CBS 138 = IFO 0622"
FT                   /mol_type="genomic DNA"
FT                   /organelle="mitochondrion"
FT                   /db_xref="taxon:284593"
FT   tRNA            13..86
FT                   /gene_name="tRNA-Met1"
FT   CDS_pept        181..1200
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000138209" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15828060"
FT                   /gene_name="VAR1"
FT                   /product="Ribosomal protein VAR1, mitochondrial "
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="mitochondrial ribosome"
FT                   /protein_id="CAD54417.1"
FT                   /db_xref="EMBL:CAA26652.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005761"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="InterPro:IPR007980"
FT                   /db_xref="UniParc:UPI000017DA18"
FT                   /db_xref="UniProtKB/Swiss-Prot:P21358"
FT                   /transl_table=3
FT                   /translation="MKLMKLLKLNINNNNNNKLLLKNLLLLMNKNRLMNKLSNNNKYLS
FT                   ELNNKGNSLQHLNNMNNWKLQNYNYNKNNTINNYINSKLINKLLYKLMSLKNNKIIISK
FT                   PLYKINMNVINIRFYYYNMNNYNYNNNIYYINMINKLMNRLNINMNNLSNILSYYYNKK
FT                   VIIEPIKLKYLYNNNEIMTKYISLLDNNKYNNGLLMEYQRTLNNIMPKLNDHNISMNYI
FT                   NNINNINKLKYNNILLNNNNNINNIYNNININNNMNLLMFKYLIGWSIMLKGRLNKNIS
FT                   RISTTYLNNGTFNNKKYLWGNLNNNFKLNYINSNNNIYNYNNINKNGKYNIKVKLNYI"
FT   tRNA            1558..1643
FT                   /gene_name="tRNA-Tyr"
FT   tRNA            1661..1732
FT                   /gene_name="tRNA-Asn"
FT   tRNA            1752..1823
FT                   /gene_name="tRNA-Ala"
FT   tRNA            1858..1930
FT                   /gene_name="tRNA-Ile"
FT   tRNA            1936..2006
FT                   /gene_name="tRNA-Trp"
FT   rRNA            2016..5108
FT                   /gene_name="21S ribosomal RNA"
FT   tRNA            5203..5275
FT                   /gene_name="tRNA-Thr2"
FT   tRNA            5290..5362
FT                   /gene_name="tRNA-His"
FT   tRNA            5366..5437
FT                   /gene_name="tRNA-Glu"
FT   CDS_pept        5672..6829
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000255206" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19794642"
FT                   /gene_name="COB"
FT                   /gene_synonym="CYB"
FT                   /gene_synonym="CYTB"
FT                   /product="Cytochrome b"
FT                   /function="electron carrier activity"
FT                   /function="metal ion binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="respiratory electron transport chain "
FT                   /biological_process="transport"
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="mitochondrial inner membrane "
FT                   /cellular_component="respiratory chain"
FT                   /protein_id="CAD54418.1"
FT                   /db_xref="EMBL:CAA37855.1"
FT                   /db_xref="GO:0005743"
FT                   /db_xref="GO:0006810"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0022904"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="GO:0070469"
FT                   /db_xref="HOGENOM:HBG487932"
FT                   /db_xref="InterPro:IPR005797"
FT                   /db_xref="InterPro:IPR005798"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="InterPro:IPR016175"
FT                   /db_xref="UniParc:UPI000017DA19"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q85QA4"
FT                   /transl_table=3
FT                   /translation="MAFRKSNVYLSLVNSYLIDSPQPSTINYWWNLGSLLGLCLVIQIL
FT                   TGIFMAMHYSSNIELAFSSVEHIMRDVQYGWLLRYMHANGASFFFICMYMHIAKGLYYG
FT                   SYRSPRVTVWIVGVIIFVLTMAAAFLGYCCVYGQMSHWGATVITNLFSAIPFVGQDIVQ
FT                   WLWGGFSVSNPTIQRFFALHYLVPFIIAALVVMHFMALHVHGSSNPLGITGNMDRIGMH
FT                   GYFIFKDLITVFVFLIFFSLFVFFSPNTLGHPDNYIPGNPLVTPASIVPEWYLLPFYAI
FT                   LRSIPDKLLGVITMFAAILVLLVLPITDRSVVRGNTFKVLSKFFFFLFIFNFLLLGQIG
FT                   QLHIEPPFVLMGQIATFLYFAYFIIIVPIISTIENVLFYIGRVNN"
FT   tRNA            6889..6959
FT                   /gene_name="tRNA-Met2"
FT   tRNA            7219..7290
FT                   /gene_name="tRNA-Pro"
FT   CDS_pept        join(7463..7702,9163..9309,10505..11088,12423..13056)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000085274" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15828061"
FT                   /gene_name="COX1"
FT                   /product="Cytochrome c oxidase subunit 1 "
FT                   /EC_number="1.9.3.1"
FT                   /function="cytochrome-c oxidase activity"
FT                   /function="electron carrier activity"
FT                   /function="heme binding"
FT                   /biological_process="aerobic respiration"
FT                   /biological_process="electron transport chain"
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="mitochondrial inner membrane "
FT                   /cellular_component="respiratory chain"
FT                   /protein_id="CAD54419.1"
FT                   /db_xref="GO:0004129"
FT                   /db_xref="GO:0005743"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0009060"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0020037"
FT                   /db_xref="GO:0022900"
FT                   /db_xref="GO:0070469"
FT                   /db_xref="HOGENOM:HBG603668"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="UniParc:UPI000017DA1A"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q85QA3"
FT                   /transl_table=3
FT                   /translation="MVQRWLYSTNAKDIAVLYFMIALFSGMAGTAMSMIIRLELAAPGS
FT                   QYLAGNNQLFNVLVVGHAVLMIFFLVMPALIGGFGNYMLPLMIGASDMAFPRLNNVGFW
FT                   LIVPALVCLVTSTLVEAGAGTGWTVYPPLSSIQAHSGPSVDLAIFALHLTSISSLLGSI
FT                   NFIVTTLNMRTNGMTMHKLPLFVWAIFITAFLLLLSLPVLSAGVTMLLLDRNFNTSFFE
FT                   VAGGGDPILYQHLFWFFGHPEVYILIIPGFGIISHIVSTYSKKPVFGEISMVYAMASIG
FT                   LLGFLVWSHHMYIVGLDADTRAYFTSATMIIAIPTGIKIFSWLATIYGGSIRLAVPMLY
FT                   AIAFLFLFTIGGMTGVALANASLDVAFHDTYYVVGHFHYVLSMGAVFSTIAGYYYWSPQ
FT                   ILGLYYNEKLAQIQFWLIFVGANVTFMPMHFLGINGMPRRIPDYPDAFAGWNYVASVGS
FT                   FIAMISLVLFIYILYDQFVNGLTNKANNKSVLYTKSPDFVESNEIFNLNTIKTSSIEFL
FT                   LTSPPAVHSFNTPAVQS"
FT   CDS_pept        <7703..8818
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000138212" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19794643"
FT                   /gene_name="i-Cg1I"
FT                   /product="I-Cg1I protein"
FT                   /function="DNA binding"
FT                   /function="endonuclease activity"
FT                   /biological_process="intron homing"
FT                   /cellular_component="mitochondrion"
FT                   /protein_id="CAD54420.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0004519"
FT                   /db_xref="GO:0005739"
FT                   /db_xref="GO:0006314"
FT                   /db_xref="HOGENOM:HBG756797"
FT                   /db_xref="InterPro:IPR001982"
FT                   /db_xref="UniParc:UPI000017DA1B"
FT                   /db_xref="UniProtKB/TrEMBL:Q85QA2"
FT                   /transl_table=3
FT                   /translation="KMNTYNNYYIKYNYNNNKLYNYNKLYNNNNSKRYINNNKLYIMNM
FT                   KRYMSLYNKDKLYIMNMKRDMSLYNKDKLGPYLSGLIEGNGTIWVPEYNNKTKPLINII
FT                   FHIMNKPLADYLCNMLNIGKVYDRSNKGKYCIWQLTKIEDLYIFINLINGYLRTPKYET
FT                   LIKLINWMNMYIDNNKLNNNNNNINYIKYKSIDNSLLMNNGWLSGFSDMNSNFIMMMNK
FT                   KRTNNMIKLNYNLEIKQLYKNNNNNFNYYNLMMNIANLFNNNLLIKMKNMKLKNNNYKT
FT                   YYLYNISINNNMNNLLLVNNYYMKYPLLSIKYLNYMNWSNLLLNIHNNNNSFTNINSIN
FT                   LYNKLIINNNNINRIINNYNWKHLNNNYYMK"
FT   CDS_pept        <9310..10443
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000138211" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15828062"
FT                   /gene_name="i-Cg1II"
FT                   /product="I-Cg1II protein"
FT                   /function="DNA binding"
FT                   /function="endonuclease activity"
FT                   /biological_process="intron homing"
FT                   /cellular_component="mitochondrion"
FT                   /protein_id="CAD54421.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0004519"
FT                   /db_xref="GO:0005739"
FT                   /db_xref="GO:0006314"
FT                   /db_xref="HOGENOM:HBG677132"
FT                   /db_xref="HSSP:1P8K"
FT                   /db_xref="InterPro:IPR001982"
FT                   /db_xref="UniParc:UPI000017DA1C"
FT                   /db_xref="UniProtKB/TrEMBL:Q85QA1"
FT                   /transl_table=3
FT                   /translation="FMMCSYKMSTDAWKTLYFLSLYNKMYLLKYLIYYNNNNNKLVKMF
FT                   NIMGWYASMLYYNMYNNNMFQRTNVTKLIHTNNMKMNNMKMNNLNMNEWLVGMTDSNGM
FT                   FNIYINNNNKIIFTYKISLMINNIQLLYKIKNYLKIGSINYTNNMVMYTINNNNDLLNI
FT                   ILPIFDKYKLLTSKRFNYLLFKKCLLINNNNNFNQLLKINLINNIINNNNNNKYNNNYI
FT                   SDSWYNIYKNYKNININNMKMMNNMLENNLLMINKIMTKSWLIGYMETKSSFKLIKKDN
FT                   KIIHYFNINMMKLDYIVMYSIKLLLNININMNNYKLETFDNKSIEYIINYLKFNNHKSR
FT                   LLGMKSYEYTIWKRSYYKYKNNNKKLLIIKMLLDKNI"
FT   CDS_pept        <11090..11929
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19794644"
FT                   /gene_name="i-Cg1III"
FT                   /product="I-Cg1III protein"
FT                   /function="endonuclease activity"
FT                   /cellular_component="mitochondrion"
FT                   /protein_id="CAD54422.1"
FT                   /db_xref="GO:0004519"
FT                   /db_xref="GO:0005739"
FT                   /db_xref="HOGENOM:HBG492423"
FT                   /db_xref="InterPro:IPR004860"
FT                   /db_xref="UniParc:UPI000017DA1D"
FT                   /db_xref="UniProtKB/TrEMBL:Q85QA0"
FT                   /transl_table=3
FT                   /translation="IYPFSKDNMLIMNNYFNNIFYTTYNYYNKYNNNNNKYYIINNNIK
FT                   DLVIYGTNLESNVNKPNFTKDIMNMMNIPNNLLYIIVGILLMDGQINYSSKKNLDNKNI
FT                   IDINCKFKLKLSMKNKEYLIYVYKLLEHYCISMPKLKKDMMRGKEYLKLEFYTRSLPCF
FT                   TLLRKHFYKGRMKIVPNDLYDLLNYESLAHMIMCNSSFIKNKGIYLNMTSFTLKEMIFI
FT                   MNIFIIKFNLNCTLHKLNNNYIIYIKFKSIKLLYNNIKNYITPSMKYKFYYKLKLLK"
FT   CDS_pept        13275..13421
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000034188" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15828063"
FT                   /gene_name="ATP8"
FT                   /product="ATP synthase protein 8 "
FT                   /function="hydrogen ion transmembrane transporter activity "
FT                   /biological_process="ATP synthesis coupled proton transport"
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="mitochondrial proton-transporting ATP
FT                   synthase complex, coupling factor F(o)"
FT                   /protein_id="CAD54423.1"
FT                   /db_xref="EMBL:CAA26110.1"
FT                   /db_xref="GO:0000276"
FT                   /db_xref="GO:0015078"
FT                   /db_xref="GO:0015986"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG398772"
FT                   /db_xref="InterPro:IPR009230"
FT                   /db_xref="UniParc:UPI000012636A"
FT                   /db_xref="UniProtKB/Swiss-Prot:P05040"
FT                   /transl_table=3
FT                   /translation="MPQLIPFYFMNQLTYGLLLITVLLILFSQFFLPMILRLYVSRLFI
FT                   SKL"
FT   CDS_pept        13614..14396
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000253874" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15828064"
FT                   /gene_name="ATP6"
FT                   /product="ATP synthase subunit a "
FT                   /function="hydrogen ion transmembrane transporter activity "
FT                   /biological_process="ATP synthesis coupled proton transport"
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="mitochondrial inner membrane "
FT                   /cellular_component="proton-transporting ATP synthase
FT                   complex, coupling factor F(o)"
FT                   /protein_id="CAD54424.1"
FT                   /db_xref="GO:0005743"
FT                   /db_xref="GO:0015078"
FT                   /db_xref="GO:0015986"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0045263"
FT                   /db_xref="HOGENOM:HBG734175"
FT                   /db_xref="InterPro:IPR000568"
FT                   /db_xref="InterPro:IPR023011"
FT                   /db_xref="UniParc:UPI000017DA1E"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q85Q99"
FT                   /transl_table=3
FT                   /translation="MQNTLLRTYINSPLEQFEVKTFLGLNTPFIDLSGLNITTFTLYTI
FT                   IVLLVVSSLYVLSNNNNKIIGSRWLLSQEVIYDTILNMVKGQIKGKDWGYYFPFIYTLF
FT                   MFILISNLISMIPYSYALTAQFVFIISLSMIIWLGITILSLFKHGWVFFSLFVPSGTAL
FT                   PLVPLLVVIELLSYVARAFSLGLRLSANIFSGHLLMAILAGLTMTFVQINIFTLILGFI
FT                   PLAIILIIMCLEFGIAIIQAYVFSILASSYLKDGLYLH"
FT   pro_peptide     13614..13646
FT                   /gene_name="ATP6"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q85Q99 "
FT   mat_peptide     13647..14393
FT                   /gene_name="ATP6"
FT                   /product="ATP synthase subunit a "
FT                   /db_xref="UniProtKB/Swiss-Prot:Q85Q99 "
FT   CDS_pept        14631..14861
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000235245" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15828065"
FT                   /gene_name="ATP9"
FT                   /product="ATP synthase subunit 9, mitochondrial "
FT                   /function="hydrogen ion transmembrane transporter activity "
FT                   /function="lipid binding"
FT                   /biological_process="ATP synthesis coupled proton transport"
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="mitochondrial membrane"
FT                   /cellular_component="proton-transporting ATP synthase
FT                   complex, coupling factor F(o)"
FT                   /protein_id="CAD54425.1"
FT                   /db_xref="GO:0008289"
FT                   /db_xref="GO:0015078"
FT                   /db_xref="GO:0015986"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0031966"
FT                   /db_xref="GO:0045263"
FT                   /db_xref="HOGENOM:HBG753983"
FT                   /db_xref="InterPro:IPR000454"
FT                   /db_xref="InterPro:IPR002379"
FT                   /db_xref="InterPro:IPR020537"
FT                   /db_xref="UniParc:UPI000017DA1F"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q85Q98"
FT                   /transl_table=3
FT                   /translation="MQLALAAKYIGAGISTIGLIGAGIGIGIVFAALINGVSRNPSLKD
FT                   TLFSYSILGMALSEATGLFCLMISFMLLFAV"
FT   CDS_pept        15384..16067
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000264988" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18098779"
FT                   /gene_name="COX2"
FT                   /product="Cytochrome c oxidase subunit 2 "
FT                   /EC_number="1.9.3.1"
FT                   /function="copper ion binding"
FT                   /function="cytochrome-c oxidase activity"
FT                   /function="electron carrier activity"
FT                   /function="heme binding"
FT                   /biological_process="respiratory electron transport chain "
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="mitochondrial inner membrane "
FT                   /cellular_component="respiratory chain"
FT                   /protein_id="CAD54426.1"
FT                   /db_xref="EMBL:CAA49205.1"
FT                   /db_xref="GO:0004129"
FT                   /db_xref="GO:0005507"
FT                   /db_xref="GO:0005743"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0020037"
FT                   /db_xref="GO:0022904"
FT                   /db_xref="GO:0070469"
FT                   /db_xref="HOGENOM:HBG390534"
FT                   /db_xref="InterPro:IPR001505"
FT                   /db_xref="InterPro:IPR002429"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR011759"
FT                   /db_xref="InterPro:IPR015964"
FT                   /db_xref="UniParc:UPI000017DA20"
FT                   /db_xref="UniProtKB/Swiss-Prot:P43373"
FT                   /transl_table=3
FT                   /translation="MLNLLNTLFLNVISNDVPTPYGIYFQDSATPNQEGILELHDNIMF
FT                   YLFIILGLVSWMLFTIVKTYSKNPMAYKYIKHGQTIEIIWTMFPAVILLIIAFPSFILL
FT                   YLCDEVISPAMTIKAIGYQWYWKYEYSDFINDNGETIEFESYVIPDDLLEEGQLRLLDT
FT                   DTSVVVPVDTHIRFVVTGADVIHDFAIPSLGIKVDANPGRLNQVSALIQREGVFYGQCS
FT                   ELTRC"
FT   tRNA            16211..16282
FT                   /gene_name="tRNA-Phe"
FT   tRNA            16291..16364
FT                   /gene_name="tRNA-Thr1"
FT   tRNA            16383..16454
FT                   /gene_name="tRNA-Cys"
FT   tRNA            16471..16543
FT                   /gene_name="tRNA-Val"
FT   CDS_pept        16756..17565
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000264954" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18098780"
FT                   /gene_name="COX3"
FT                   /product="Cytochrome c oxidase subunit 3 "
FT                   /EC_number="1.9.3.1"
FT                   /function="cytochrome-c oxidase activity"
FT                   /biological_process="mitochondrial electron transport,
FT                   cytochrome c to oxygen"
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="mitochondrial inner membrane "
FT                   /protein_id="CAD54427.1"
FT                   /db_xref="GO:0004129"
FT                   /db_xref="GO:0005743"
FT                   /db_xref="GO:0006123"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG565518"
FT                   /db_xref="InterPro:IPR000298"
FT                   /db_xref="InterPro:IPR013833"
FT                   /db_xref="UniParc:UPI000017DA21"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q85Q96"
FT                   /transl_table=3
FT                   /translation="MTHLERSRHQQYPYHMVLPSPWPMLLSFALLSLTLSLGLTMHGYI
FT                   GNMNLVYLALLVVTLTSVFWFRDVIAEATYLGDHTIAVRKGINLGFLLFVLSEVLIFAG
FT                   LFWAYFHSAMSPDIVLGASWPPVGIQAVQPTELPLLNTIILLSSGATITYSHHALICRN
FT                   RNKALSGLFITIWLIIIFVTCQYIEYTNAAFTISDGVYGSVFYAGTGLHFLHMVMLAVM
FT                   LIICYWRMRTYQFTSTHHVGFETTILYCHVLDIIWLFLYIVFYWWGV"
FT   tRNA            17616..17697
FT                   /gene_name="tRNA-Leu"
FT   tRNA            17715..17785
FT                   /gene_name="tRNA-Gln"
FT   tRNA            17818..17889
FT                   /gene_name="tRNA-Lys"
FT   tRNA            17915..17987
FT                   /gene_name="tRNA-Arg"
FT   tRNA            18004..18075
FT                   /gene_name="tRNA-Gly"
FT   tRNA            18085..18156
FT                   /gene_name="tRNA-Asp"
FT   tRNA            18180..18262
FT                   /gene_name="tRNA-Ser1"
FT   tRNA            18281..18367
FT                   /gene_name="tRNA-Ser2"
FT   rRNA            18404..20053
FT                   /gene_name="15S ribosomal RNA"
XX
SQ   Sequence 20063 BP; 8349 A; 1536 C; 2004 G; 8174 T; 0 other;
     aaaatatttt aaacttgtat agtttaaatg gttaaaacat ttgtctcata aacaaataat        60
     gtaaggttca aatccttcta caagtattaa ctacaattta ataatattat aatatataat       120
     ataatatatt ataataatct aattaattaa taattagata aaataaaaat aaaataaaat       180
     atgaaattaa taaaattatt aaaattaaat attaataata ataataataa taaattatta       240
     ttaaagaatt tattattatt aataaataag aatagattaa taaataaatt aagtaataat       300
     aataaatatt taagtgaatt aaataataaa ggtaatagtt tacaacattt aaataatata       360
     aataattgaa aattacagaa ttataattat aataaaaata atcttattaa taattatatt       420
     aatagtaaat taattaataa attattatat aaattaatat cattaaaaaa taataaaatt       480
     attattagta aaccattata taaaattaat ataaatgtaa ttaatattag attttattat       540
     tataatataa ataattataa ttataataat aatatttatt atattaatat aattaataaa       600
     ttaataaata gattaaatat taatataaat aatttaagta atattttaag ttattattat       660
     aataaaaaag ttattattga acctattaaa ttaaaatatt tatataataa taatgaaatt       720
     ataactaaat atattagttt attagataat aataaatata ataatggttt attaatagaa       780
     tatcaaagac tattaaataa tattatgcct aaattaaatg atcataatat ctctataaat       840
     tatattaata atattaataa tattaataaa ttaaaatata ataatatttt attaaataat       900
     aataataata ttaataatat ttataataat attaatatta ataataatat aaatttatta       960
     atgtttaaat atttaattgg ttgatctatt atgttaaaag gtagattaaa taaaaatatt      1020
     agtagaatta gtactctata tttaaataat ggtactttta ataataaaaa atatttatga      1080
     ggtaatttaa ataataattt taaattaaat tatattaata gtaataataa tatctataac      1140
     tataataata ttaataaaaa tggtaaatat aatattaaag ttaaattaaa ttatatttaa      1200
     taaatatatc taacaaaata tattataaat ataataataa taataaacat aaatatttaa      1260
     tatttaaaat aaattatttt aaatatatat atataataat atataatatt ttaattaaat      1320
     tatatacaat aataatataa tatttaatat ttaaattata tttaattatt taataatata      1380
     tataataata atataatatt aaagttaaaa tatatttaaa ttatatataa taatataata      1440
     tttaatattt aaattatatt taattattta ttaattaatt aattaattta ttaataatat      1500
     ttatatatat tattatataa tataatattc tttatataag taattatata taatatagga      1560
     gggatttcca atgttggtaa ttggagttga gctgtaaact caatgattat atatcttcat      1620
     aggttcaatt cctattccct tcattttatt aattaattta gtctttatgg cttagtggtt      1680
     aaagcatctc actgttaatg agaatacata ggttcaattc ctattgaaga cgtatatata      1740
     atataaataa gggggttata gttaaattgg tagaacaatt gtgttgcatg caatagatat      1800
     gagttcaatt ctcattaact ccataaatat atatatatat atatgtatat aattatagaa      1860
     actataattc aattggttag aatagtattt tgataaggta ccaatatagg ttcgattcct      1920
     gttagtttca atataaagga tatagtttaa tggtaaaact attgatttca aatcaatcat      1980
     taagagttcg aatcttttta tccttggtat aagtaataat aataaaaata atagatttga      2040
     aatatttatt atatagattt aaagagataa tcatggaata catatattat aataatatta      2100
     tattataata atactattaa tagttaatta ggttactaat aaaatatata tattatatta      2160
     tatatatttt taatacctaa aggtaaacct taaattatat atatatatta atttatttta      2220
     tatataataa aataagacta agtgaactga aacatcttag taacttaagg aataaaaatc      2280
     aacagagata ttatgagtat tggtgagaga aaataataat aggtcgtaaa aagtattatg      2340
     tattaattaa tatgtaagaa tataggatta acaatttcta agactaaata ctattaataa      2400
     gttaagaaag taccgtgagg gaaagtatgt aaatggttat tttataagca attatagata      2460
     ttatatataa tatcaataat gtaccttttg tataatgggt cagcaagtaa ttaatattag      2520
     caaaattaaa taattatata aaaatagaaa taaatatata tataaaaata tattaagagt      2580
     taatattaat tgacccgaaa gcatatgatc ttactatgac aagatggtta aaaacgatcg      2640
     aacaggttaa tgttgcaaaa ttatctgatt agttgtggta aggtatgaaa gataaatctg      2700
     atatgcagat agctggtttt ctatgaaata tatgttagta tagcccttat aattaaataa      2760
     ttaataataa tataataatt tattatatta ttattgaatg gtacagcaat taatatatat      2820
     tggggaatta ttataatttt atcaataata tttaatctcg aaatatttaa ttatatataa      2880
     ttaatttaat taattatata atttataagg agtcagatta tgtgcgataa ggtaaataat      2940
     ctaaagggaa acagcccaga ttaatatata aagttccaaa ttttataaaa tatatataaa      3000
     aaaaatatat ttaatttata aatttaattt ataaataata ataagtgaaa ataatattaa      3060
     aatattatta aataatcagt taatgggttt gacaataacc attttttaat gaacatgtaa      3120
     caatgcactg atcaataata ttatataata tttcaaatta aattaatttt taattaattt      3180
     attaataaac aatatacgga tcttattaat tataaaaatt attaaactga atatttaaat      3240
     attattaatt attattaaaa taattaataa tatggtaata gaacatctaa tgaaagagta      3300
     tattaattaa atattaatat attaataaat aattagatag agaatgctga catgagtaac      3360
     gataaaaagg tttaaacctt ttcacctaaa acataaggtt ttactataaa agtacggcac      3420
     ctaatataaa tatgaatata aatatattat agatggtaaa aatctaattt aataataaaa      3480
     atctttatag atatatatta tatatatata taaattaata aagatcagga aataaattat      3540
     taaatgtata ccgtaatgta taccgactca ggtatgttag tagagaatat gaaggtgtat      3600
     tagataatta aggataagga actcggcaaa aatagctcta acgttagtca ataaagagat      3660
     ataaaaacaa ggttgtacaa ctgtttacta aaaacaccgc actttgcaaa aactatttaa      3720
     gttatagtat aaggtgtgaa ctctgctcaa tgcttaatat ataaattata tatttattaa      3780
     agaatatata aataaattta agtaaatagc agccttatta tgagggttat aatgtagcga      3840
     aattccttgg ctgataatta cagtcccgca tgaatgacgt aatgatacaa caactgtctc      3900
     atccttaaac taagtgaaat tgaatttgca gtgaagatgc tgtatatttg tagttagaca      3960
     agaagaccct atgcagcttt actataatta gatagatcga attattattt attatattca      4020
     gcatattaag taatttatat atatatatat atatataata atcgtttaga tataaatgag      4080
     atacttatta taataatata ataattctaa tctttaataa atatatatat atttaataga      4140
     aaattaatat attcttaaat atattttata atattattat tattaataat attatatatt      4200
     aagagacaat ctctaattgg tagttttgat ggggcgtcat tttcagcaaa agtatctgaa      4260
     taagtccata tataaattat tataaaattt tatttataat ataaagtata tattatatat      4320
     actaattata aaatatatta tatattttta tatatataat ataataatag aaaaattata      4380
     tacagtaaaa ttgtctggaa aacaataata tttatttatt tttaataaat attaaattaa      4440
     tataatagta taactgtgta aagattatga cacaaacaag tggaataagt acgtaagtat      4500
     ggtataatga acaaataata ctgattgtaa aggttattga taacgaataa aagttacgct      4560
     agggataaca gggtaatata acgaaagagt agaaattgta agttatgttt gccacctcga      4620
     tgtcgactct acctatccta ttggttgtaa aagctaataa gggttcgact gttcgtcgat      4680
     taaaaggtaa cgtgagttgg gttaaatacg acgtgagtca gtatggtttt tatctactac      4740
     aaataatatt atcttattaa atctcattat tagtacgcaa ggaccataat gaattaacct      4800
     atggtgtacc tattaattat tatattaaat aatacataaa taatttattt attatttaat      4860
     caatattaat ttatatctta ataattgtta tagtaggtaa gctaagttaa taaataataa      4920
     atattgaata catataaaat atgaagtagt tttaaaacga taatatatac taataatctt      4980
     atactaagat taatataggt tttatatata ttttaatata cataaaatac taatttatta      5040
     gttatctata taatatctaa tctattattt ttattattat tattaatatt atataaaaat      5100
     aatttataat aatattatat aaaattattt ataataatat tatataaaat aatttataat      5160
     aatattatat taatttaata tttattatat taatttaata aagttatatt agctcaattg      5220
     gtagagcatt cgttttgtaa tcgaaaggtt tggggttcaa atccctaata taacatatat      5280
     atatataaag gtaaatatat ttcaatggta gaaaatacgc ttgtggtgcg ttaaatctaa      5340
     gttcgattct tagtatttac ccttagatct tatcgtctaa tggttacgac atcaactttt      5400
     catgttgaaa atgttggttc aatcccaact aagattaata tataaaatat tataataata      5460
     ataaaattat aatattattt atttattaaa taataataat taaaattatt taattaaatt      5520
     aattaattta ttatatatat taattatatt atatataata agaatatata aattataaat      5580
     atataatttt atatatataa agtatatata tatatatata ttatatttat gtgtatatat      5640
     atgtatatat ttagagtaaa atatttttat tatggcattt agaaaatcaa atgtttattt      5700
     aagtttagtg aatagttatt taattgattc accacaacca tcaacaatta attattgatg      5760
     aaatttaggt tcattattag gattatgttt agtaattcaa attttaacag gtatttttat      5820
     ggctatgcat tattcatcaa atattgaatt agcattttca tcagtagaac atattatgag      5880
     agatgtacaa tatggttgat tattaagata tatgcatgca aatggagcat catttttctt      5940
     tatttgtatg tatatgcata ttgctaaagg tttatattat ggttcatata gatcacctag      6000
     agtactagta tgaattgtag gtgttattat ttttgtatta actatggctg ctgctttctt      6060
     aggttattgt tgtgtatatg gacaaatgtc acattgaggt gcactagtaa ttactaattt      6120
     attctcagct attcctttcg ttggtcaaga tattgtacaa tgattatgag gaggtttctc      6180
     agtatctaat cctactattc aaagattctt tgcattacat tatttagtac catttattat      6240
     tgctgcttta gtagtaatgc attttatggc tttacatgta catggttcat ctaatccttt      6300
     aggtattaca ggtaatatgg atagaattgg aatgcatggt tatttcattt ttaaagattt      6360
     aattactgtt tttgtattct taattttctt ctcattattt gtattcttct cacctaatac      6420
     tttaggacat cctgataatt atattcctgg taatccttta gtaacaccag catctattgt      6480
     acctgaatga tatttattac cattttatgc tattttaaga tctattcctg ataaattatt      6540
     aggtgttatt cttatgtttg ctgctatttt agttttatta gtattaccta ttactgatag      6600
     aagtgttgta agaggaaata cttttaaagt attatctaaa ttcttcttct tcttatttat      6660
     ctttaatttc ttattattag gacaaatcgg acaattacat attgaaccac ctttcgtatt      6720
     aatgggacaa attgctacat tcttatactt cgcttacttt attattatcg tacctattat      6780
     ctctactatt gaaaacgtat tattctatat cggtagagtt aataattaat taatattaat      6840
     aatttaatat atataatatt cttactttaa ttataagtaa ttataaatgt aatatgatgt      6900
     aattggttaa catattaggt tcatgaccta attatatacg ttcaaatcgt attattgcta      6960
     tatatatata tatataatat atattatata aagaaaagtc ataaataata ataatatatt      7020
     attatttaat taaataataa taatatattt aaataaataa tataaataat taaattgaaa      7080
     tatatattta ttttaataaa atattatata ttaataatat tttaaatata attaattaat      7140
     ataattaatt atattatagt tatataatat acataaataa gcttatatat agtatatagt      7200
     atatatatat attttataca gatagaagcc aaaaggtcag gcgctttctt tgggtgaaag      7260
     atctagttag ttcgagtcta tcctatctga atatattata atttataaat atataaatta      7320
     taaataataa aaattaatta aaataattta aattaaatat atatattaat attatattaa      7380
     tatatatata tatattttat atatatatat atgtattgat ttatttatat atatattaat      7440
     gaaataatta tgtaatataa ttatggtaca aagatgatta tattcaacaa atgctaaaga      7500
     tattgcagta ttatatttta tgattgcatt atttagtggt atggcaggta cagctatgtc      7560
     tatgattatt agattagaat tagctgctcc tggttcacaa tatttagcag gtaataatca      7620
     attattcaat gtattagttg taggacatgc tgttttaatg attttcttct tagttatgcc      7680
     agcattaatt ggaggttttg gtaaaataaa cctttataat aattattata ttaaatataa      7740
     ttataataat aataaattat ataattataa taaattatat aataataata attctaaaag      7800
     atatattaat aataataaat tatatattat aaatataaaa agatatataa gtttatataa      7860
     taaagataaa ttatatatta taaatataaa aagagatata agtttatata ataaagataa      7920
     attaggacct tatttatcag gtttaattga aggaaatggt actatttgag taccagaata      7980
     taataataaa cttaagcctt taattaatat tatttttcat attataaata aacctttagc      8040
     tgattattta tgtaatatat taaatattgg taaagtttat gatagaagta ataaaggtaa      8100
     atattgtatt tgacaattac ttaaaattga agatttatat atttttatta atttaattaa      8160
     tggttattta agaactccta aatatgaaac tttaattaaa ttaattaatt gaataaatat      8220
     atatattgat aataataaat taaataataa taataataat attaattata ttaaatataa      8280
     atctattgat aattcattat taataaataa tggttgatta tcaggtttta gtgatataaa      8340
     tagtaatttt attataataa taaataaaaa aagaactaat aatataatta aattaaatta      8400
     taatttagaa attaaacaat tatataaaaa taataataat aattttaatt attataattt      8460
     aataataaat attgctaatt tatttaataa taatttatta attaaaataa aaaatataaa      8520
     attaaaaaat aataattata aactttatta tttatataat atttcaatta ataataatat      8580
     aaataattta ttattagtta ataattatta tataaaatat cctttattat ctattaaata      8640
     tttaaattat ataaattgat ctaatttatt attaaatatt cataataata ataattcttt      8700
     tcttaatatt aatagtatta atttatataa taaattaatt attaataata ataatattaa      8760
     tagaattatt aataattata attgaaaaca tttaaataat aattattata taaaatagtt      8820
     gccgttatat attgtaaaat atataattat tatatcacta tattctggaa actcctaaag      8880
     ctttatataa tatatactaa taattataat aataaataaa tttattttat ttattaattt      8940
     ataaattata aatttatata ttgataatta taaagataat tttatataaa taatatttat      9000
     ataaaataaa tggacaatca gaaggaaacg aagataatat atattgtata tattatataa      9060
     taggatcctc agagactaca cgtgataaat ataattaatt atattaatta attatattaa      9120
     gatatagtcc agattatata gaaatatata atatttatta agaactatat gttaccatta      9180
     atgattggtg catcagatat ggcatttcca agattaaata atgttggttt ctgattaatt      9240
     gttcctgctt tagtttgttt agttacttct acattagtag aagcaggtgc tggtactggt      9300
     tgaactgtat ttatgatatg cagttataaa atgtcacttg atgcatgaaa aaccttatat      9360
     tttttatctt tatataataa aatatattta ttaaaatact taatttatta taataataat      9420
     aataataaat tagttaaaat gtttaatatt ataggttgat atgccagcat attatattat      9480
     aatatatata ataataatat gtttcagaga ctaaacgtga caaaattaat tcatctaaat      9540
     aatataaaaa taaataatat aaaaataaat aatttaaata taaatgaatg attagtaggt      9600
     ataactgata gtaatggaat atttaatatt tatattaata ataataataa aattattttt      9660
     acatataaaa tttcattaat aattaataat attcaattat tatataaaat taaaaattat      9720
     ttaaaaattg gttctattaa ttatactaat aatatagtaa tatatctaat taataataat      9780
     aatgatttat taaatattat tttacctatt tttgataaat ataaattatt aacatcaaaa      9840
     agatttaatt atttattatt taaaaaatgt ttattaatta ataataataa taattttaat      9900
     caattattaa aaattaattt aattaataat attattaata ataataataa taataaatat      9960
     aataataatt atatttctga ttcatgatat aatatttata aaaattataa aaatattaat     10020
     attaataata taaaaataat aaataatata ttagaaaata atttattaat aattaataaa     10080
     attataacta aatcatgatt aattggttat atagaaacta aaagttcatt taaattaatt     10140
     aaaaaagata ataaaattat tcattatttt aatattaata taataaaatt agattatatt     10200
     gtaatatata gtattaaatt attattaaat attaatatta atataaataa ttataaatta     10260
     gaactatttg ataataaaag tattgaatat attattaatt atttaaaatt taataatcat     10320
     aaatcaagat tattaggtat aaaaagttat gaatatctaa tttgaaaaag atcatattat     10380
     aaatataaaa ataataataa aaaattatta attattaaaa tattattaga taaaaatatt     10440
     tagaaagaat taatttaaga tatagtccaa tcaatatagt aatatattgt taatatttaa     10500
     aggatatcca ccattatcat caattcaagc tcattcagga cctagtgttg atttagctat     10560
     ttttgcatta catttaactt ctatttcatc attattaggt tcaattaatt ttattgttac     10620
     aacattaaat atgagaacta atggtatgac aatgcataaa ttaccattat ttgtatgagc     10680
     tattttcatt acagctttct tattattatt atcattacca gtattatcag caggtgttac     10740
     aatgttatta ttagatagaa acttcaatac ttcattcttt gaagtagctg gaggtggtga     10800
     tcccatttta taccaacatt tattctgatt ctttggtcat ccagaagtat atattttaat     10860
     tattcctgga tttggtatta tttcacatat tgtatctact tattctaaaa aaccagtatt     10920
     tggtgaaatt tctatggtat atgctatggc atctattggt ttattaggat tcttagtatg     10980
     atcacatcat atgtatattg taggattaga tgctgatact agagcttatt tcacttctgc     11040
     tactatgatt attgctattc ctacaggaat taaaattttc tcatgattaa tttatccctt     11100
     tagtaaggat aatatgttga tcataaataa ttattttaat aatatcttct acactcttta     11160
     taattattat aataaatata ataataataa taataaatat tatattatta ataataatat     11220
     taaagattta gtaatttatg gtcttaattt agaatctaat gtaaataaac ctaattttct     11280
     taaagatatt ataaatataa taaatattcc taataattta ttatatatta ttgtaggtat     11340
     tttattaata gatggtcaaa ttaattattc atctaaaaag aatttagata ataaaaatat     11400
     tattgatatt aattgtaaat ttaaattaaa attatctata aaaaataaag aatatttaat     11460
     ttatgtatat aaattattag aacattattg tatttcaata cctaaattaa aaaaagatat     11520
     aataagaggt aaagaatatt taaaattaga attttatact agatctttac catgttttac     11580
     attattaaga aaacattttt ataaaggtag aataaaaatt gtacctaatg atttatatga     11640
     tttattaaat tatgaatctt tagctcatat aattatatgt aatagttcat ttattaaaaa     11700
     taaaggtatt tatttaaata tactatcatt tctattaaaa gaaataatct ttattataaa     11760
     tatctttatt attaaattta atttaaattg tactttacat aaattaaata ataattatat     11820
     tatttatatt aaatttaaat ctattaaatt attatacaat aatattaaaa attatattct     11880
     accttctata aaatataaat tttattataa attaaaatta ttaaaataat tataagaagc     11940
     aaactcgagg gaaaccctat attaaaaaat tataaatata atttatatat atataaaata     12000
     tatataatat attaattata ttaaattatt aagaaattaa tatattaatt atataaatta     12060
     ttaaggaatt aatataggat aatcgtcgaa ctaaattata ttaagaaatt aatatataaa     12120
     agcgtagaga ctagatgctt ctgataatct aagtaattaa ataattaaat atttaattat     12180
     atgattatat aaggtatagt ccaatggaat cagtaatgat tttgaagcaa tacttcaaat     12240
     attaatatat atatatatat taatatccta cctaaattat tatattatat aataattatt     12300
     aaaaagggaa aaaataatat atttaattat tatttttttt ataaatttaa ctaactaata     12360
     aatagtatat attataatat attatttata gaatctgaga tgatttaagg ttaaatatta     12420
     agagcaacaa tttatggagg ttctattaga ttagcagttc ctatgttata tgctattgca     12480
     ttcttatttt tattcactat tggtggtatg acaggagtag cattagcaaa tgcatcatta     12540
     gatgtagcat tccatgatac atattatgta gtaggtcatt tccattatgt attatcaatg     12600
     ggagcagtat tttcaactat tgcaggatat tattattgaa gtcctcaaat tttaggatta     12660
     tattataatg aaaaattagc acaaattcaa ttctgattaa tttttgtagg agctaatgta     12720
     ctatttatgc ctatgcattt cttaggtatt aatggtatgc ctagaagaat tcctgattat     12780
     cctgatgctt ttgctggttg aaactatgta gcatcagtag gatcatttat tgctatgatc     12840
     tcattagttt tatttattta catcttatat gatcaatttg taaatggttt aactaataaa     12900
     gctaataata aatcagtatt atatactaaa tcacctgatt ttgtagaatc taatgaaatc     12960
     tttaacttaa atactattaa aacttcttct attgaattct tattaacttc accaccagct     13020
     gttcattcat ttaatacacc agctgtacaa tcataattta taataaataa attaattata     13080
     atattcttta attataaata aaaaatatat tcatataatt atataataat ataataattt     13140
     actattatta tattatgtaa gttattaatc ttatatatat ataatatata taagaatatt     13200
     aaaataatct attaataata atttatttat tattaatgtt gtatttatat taaatatata     13260
     aaaaatatat aaatatgcca caattaattc cattttattt tatgaatcaa ttaacatatg     13320
     gtttattatt aattactgta ttattaattt tattttcaca attcttttta cctataattt     13380
     taagattata tgtatcaaga ttatttattt ctaaattata aatataatta ataataataa     13440
     tatataatta taatataata taattaataa tatataatta taatataata taattaataa     13500
     taatttatat atattaattt aaaatatttt ttttttttat taatataaaa tataatatta     13560
     tttattatat aataatatta attttaataa gttataatat atatttataa agtatgcaga     13620
     atacattatt aagaacatat attaattcac cgttagaaca atttgaagtt aagctatttt     13680
     taggtttaaa tacaccattt attgatttaa gtggtttaaa tattacaaca tttacattat     13740
     atactattat tgtattatta gtagtatcat cattatatgt attaagtaat aataataata     13800
     aaattattgg ttcaagatga ttattatcac aagaagtaat ttatgataca attttaaata     13860
     tggttaaagg acaaattaaa ggtaaagatt gaggatatta ttttccattt atttatacat     13920
     tatttatgtt tattttaatt tctaatttaa ttagtatgat tccttattca tatgctttaa     13980
     cagcacaatt tgtatttatt atttcattaa gtatgattat ttgattaggt attactattt     14040
     taagtttatt taaacatggt tgagtattct tctcattatt tgtaccatca ggtacagctt     14100
     tacctttagt acctttatta gttgtaattg aattattatc ttatgttgct agagctttct     14160
     ctttaggttt aagattatct gctaatatct tctctggaca tttattaatg gctatcttag     14220
     ctggtttaac tataactttt gtacaaatta atatctttac tttaatttta ggatttatcc     14280
     ctttagctat tatcttaatt attatgtgct tagaatttgg tattgctatt atccaagcct     14340
     acgttttctc tatcttagcc tcttcttact taaaagatgg tttatactta cattaattta     14400
     tataatacaa ataaattaat tatattataa tattctttaa ttaattatta ttaataataa     14460
     taatataagt aattattata taaaatatta tatacattat ataataataa tttataaaaa     14520
     aaagtatata ttaataataa taataaaata ataattatat aaatatatat atatatatat     14580
     atatattaat tatttaaata tataataaag attataaaaa atataatatt atgcaattag     14640
     cattagccgc aaaatatatt ggagctggaa tttcaacaat tggattaatt ggagcaggta     14700
     ttggtattgg tatcgtattc gctgcattaa ttaatggagt ttcaagaaat ccatcattaa     14760
     aagatacatt attctcatat tctattttag gaatggcttt atcagaagct acaggattat     14820
     tctgtttaat gatctcattc atgttattat tcgctgttta ataataataa tgtttactat     14880
     taatatagta atattataat attcttaata aataaatatt taaatatata aataaatatt     14940
     ataatatata ttataataat atatactaat taatatatat taattatatt aataatatat     15000
     atatataatt attaaatata ctaattatat atttaatata ttatataata ctaattatat     15060
     atttaatata ttatataata ctaattatat tttataatat atatataata atatataata     15120
     tttaatatat taaataatat atataatatt tattatataa ataatatata aatattaatt     15180
     tatataaaat aatatataaa tattaattta tattcaataa tatataaata taaatttatt     15240
     attaattatt taataatatt aataataata ataattattt tattagttta tatatatgta     15300
     tgtatatttt attttttaag gaaatagata taagtaatat ataaaggaca cgaaagtcta     15360
     aaaagattaa gaaagtataa attatgttaa atttattaaa tacattattt ttaaatgtta     15420
     ttagtaatga tgtgccaaca ccttatggta tttattttca agattcagct acacctaatc     15480
     aagaaggtat tttagaatta catgataata ttatgtttta tttatttatt attttaggtt     15540
     tagtatcatg aatgttattt acaattgtta aaacatattc aaaaaatcct atggcatata     15600
     aatatattaa acatggacaa actattgaaa ttatttgaac tatgtttcca gcagtaattt     15660
     tattaattat tgctttccct agtttcattt tattatattt atgtgatgaa gttatttcac     15720
     cagctatgac tattaaagct attggatatc aatgatattg aaaatatgaa tattctgatt     15780
     ttattaatga taatggtgaa ctaattgaat ttgaatcata tgttattcct gatgatttat     15840
     tagaagaagg acaattaaga ttattagata ctgatacttc agtagtagta cctgttgata     15900
     cacatattag atttgtagta acaggagctg atgttattca tgattttgct attcctagtt     15960
     taggtattaa agtagatgct aatcctggta gattaaatca agtatcagct ttaattcaaa     16020
     gagaaggagt attctatgga caatgttcag aattactgcg gtgttaatca tgctgccatg     16080
     cctattaaaa ttgaagctgt atcattacct aaattcttag aatgattaaa tgaacaataa     16140
     ataaataaat atatatatac actatatatt tatatataat attcttattt tatatatata     16200
     agtaataata gcctttatag cttagtggta aagcgataaa ctgaagattt atttacatgt     16260
     agttcgattc tcattaaggg cattaatata agtagatata atttaatcgg taaaatgtat     16320
     gtttttaggt acatattatc taagttcaaa tcttagtatt tacaaataaa taaaaataaa     16380
     aaggaggtgt tgtttaaagg ttaagctatt agattgcaga tctacttatt aagagttcga     16440
     ttctcttcat ctctttataa tatatacatt aggatattag cttaattggt atagcattcg     16500
     ttttacacac gaaagattat aggttcgaat cctatatttc ctacatttaa taatatataa     16560
     taatattatt aattaattaa attataatat atataatata taatatgaat tatatataat     16620
     tataatatta tattaaatat atattttata tatatattta atttttatta atatattaat     16680
     atatatatat gtatattatt gtatatatat atatatatat ttaaagatat taaatttata     16740
     aatttattaa aataaatgac acatttagaa agatcaagac atcaacaata tccatatcat     16800
     atggtattac catcaccatg accaatgtta ttatcatttg cattattatc attaacatta     16860
     tcattaggat taacaatgca tggttatatt ggtaatatga atttagtata tttagcatta     16920
     ttagtagttc tattaacaag tgtattttga tttagagatg taattgcaga agcaacatat     16980
     ttaggtgatc atacaattgc agttagaaaa ggtattaatt taggtttttt attatttgta     17040
     ttatcagaag tattaatttt tgcaggttta ttttgagcat attttcattc agcaatgagt     17100
     ccagatattg tattaggagc tagttgacct ccagtaggaa ttcaagcagt acaacctaca     17160
     gaattacctt tattaaatac tattatttta ttatcatcag gtgctactat tacatatagt     17220
     catcatgcat taatttgtag aaatagaaat aaagctttat caggtttatt tattactatt     17280
     tgattaatta ttatttttgt aacttgtcaa tatattgaat atactaatgc tgctttcact     17340
     attagtgatg gtgtttatgg atcagtattc tatgctggta ctggtttaca tttcttacat     17400
     atggttatgt tagctgttat gttaattatt tgttattgaa gaatgagaac atatcaattc     17460
     acatctactc atcatgtagg ttttgaaact actattttat attgtcatgt attagatatt     17520
     atctgattat tcttatatat cgtattctat tgatgaggtg tataatataa tataatatat     17580
     ataatattct ttattattat aagtaattat atatagctat tttggtggaa ttggtagaca     17640
     cgatactctt aagatgtatt actttatagt atgaaggttc aaatccttca aatagcatat     17700
     cttaataatt atatgagtcg tagactaata ggtaagttac caaaatttga gtttggagtt     17760
     tgtttgttcg aatcaaaccg attcaatatt aattattaat ataaaatata ttttatagag     17820
     agtattgttt aaaggtaaaa cagttgtctt ttaagcaacc catgcttggt tcgaatccag     17880
     ctattctcaa ttaatatata tatataacat tatagctctc ttagcttaat ggttaaagca     17940
     taatacttct aatattaata ttccatgttc aaatcatgga gagagtataa gtaataaaat     18000
     aaaatagata taagttaatt ggtaaactga atgtcttcca cacattgatt gtgagttcga     18060
     ttctcactat ctatatattt taatggatcc atagcttaat agtaaagtcc tattttgtca     18120
     taatagagga tgtcagtgca aatctgattg gattcgttat atatatatat aaatatatag     18180
     gaaaattcac cataggtaag gtaaattatt tgctatgtaa ttgaatttat tattcttatg     18240
     agttcgaatc tcatattttc cgtcttatta tataaataaa ggatggttga ctgagtggtt     18300
     taaggtgtga tatttgagct atcattagtt ttaataaact acgtaggttc aaatcctaca     18360
     tcatccgtaa tatataatat atatatataa gtaaggaata ataaataaat aataaagaac     18420
     atgatgttgg ttcagattaa acgctaaata aggacatgac acatgcaaat caaacattta     18480
     ttattgataa aataataaat atgtggtgta aacgtgagta ataatataag aattaatgaa     18540
     ctataaaata gattaaatat ctaataaata tatatatata atatatatat atatattaaa     18600
     taaatattta tttaaagtat aatatttgtt tatagtcaag cttataatag tttaggtagt     18660
     aggttaatta atagtttata acctagccaa cgatctatag ttaataatga aagttataat     18720
     aaccacgttg actttgaaat atagtcaata tctataagat acagcagtga ggaatattga     18780
     acaatgatcg aaagattgat tcagttactt attagaacaa tatataataa tatttattaa     18840
     tatataatat taatatataa aatatatata taaattgatt aaaaataaag ttcataaata     18900
     gtttaaataa tgatataaac taatctttta ttaataaaga tatatattta agttattatt     18960
     atttaataat tttaatttaa atatatttta atagtcctaa ccaaaatttg tgccagcagc     19020
     tgcggtaata caaagagggc tagcgttaat cataatggtt taaaggatac gtagaattaa     19080
     tataatataa aattatattt agagttaata tatattaatt aaagaattat aatagtaaag     19140
     atgaaataat tatgataatt ataagactgg tatatgtgaa aatattaatt aatttattaa     19200
     ctgacattga ggtattaaga ctagagtagc gaaacggatt cgatacccgt gtagttctag     19260
     tagtaaacta tgagtactat atattataat atatatattt ataatatata catgaaaatg     19320
     taagtattcc acctgaagag tacgttagca ataatgaaac tcaaaacaat agacggttac     19380
     agacttaagc agtggagcat gttatttaat tcgataatcc acgattaatc ttaccatatt     19440
     ttgaatattt atatatatat aataatatat atataattac aggcgttaca ttgttgtctt     19500
     tagttcgtgc tgcaaagtct tagattaagt tcattaacga acacaactcc atatatataa     19560
     taatatatta tatataatta atataattta ttataaatta tattataaag gaattaagac     19620
     aaatcataat gatccttata atatgggcta tagacgtgct ataataaaat gataataaaa     19680
     ttatataata tataataata ataaaattat atataattaa taatataaaa cattttatat     19740
     ttttatatat ttttatataa tatataatat gaattataat ctgaaattcg attatatgaa     19800
     ataagaattg ctagtaatac gtaaattagt atattacggt gaatattcta actgtttcgc     19860
     actaatcact catcacgcgt tgaaatatat tattatctta atatataata acatatctat     19920
     atttttatat aaataaatat atattaatat aatatataat tatatagttg aaataatatt     19980
     aattaatgcg aagttgaaat acagttactg taggggaacc tgcagtggga ttataaaact     20040
     ctttaatatt ctttataaat aaa                                             20063
//

If you have problems or comments...

PBIL Back to PBIL home page