(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_10

ID   CAGLA1_10; SV 2; linear; genomic DNA; GRV; FUN; 1195132 BP.
XX
AC   CR380956_GR;
XX
DT   19-SEP-2006 (Rel. 106, Created)
DT   15-FEB-2011 (Rel. 128, Last updated, Version 21)
XX
DE   Candida glabrata (strain ATCC 2001 / NRRL Y-65 / CBS 138 / IFO 0622)
DE   chromosome J, complete sequence.
XX
KW   complete genome; genome reviews.
XX
OS   Candida glabrata (strain ATCC 2001 / NRRL Y-65 / CBS 138 / IFO 0622)
OC   Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina; Saccharomycetes;
OC   Saccharomycetales; Saccharomycetaceae; Nakaseomyces; mitosporic
OC   Nakaseomyces.
XX
RN   [1]
RX   PUBMED; 15229592.
RA   Dujon B., Sherman D., Fischer G., Durrens P., Casaregola S., Lafontaine
RA   I., de Montigny J., Marck C., Neuveglise C., Talla E., Goffard N.,
RA   Frangeul L., Aigle M., Anthouard V., Babour A., Barbe V., Barnay S.,
RA   Blanchin S., Beckerich J.-M., Beyne E., Bleykasten C., Boisrame A., Boyer
RA   J., Cattolico L., Confanioleri F., de Daruvar A., Despons L., Fabre E.,
RA   Fairhead C., Ferry-Dumazet H., Groppi A., Hantraye F., Hennequin C.,
RA   Jauniaux N., Joyet P., Kachouri R., Kerrest A., Koszul R., Lemaire M.,
RA   Lesur I., Ma L., Muller H., Nicaud J.-M., Nikolski M., Oztas S., Ozier-
RA   Kalogeropoulos O., Pellenz S., Potier S., Richard G.-F., Straub M.-L.,
RA   Suleau A., Swennen D., Tekaia F., Wesolowski-Louvel M., Westhof E., Wirth
RA   B., Zeniou-Meyer M., Zivanovic Y., Bolotin-Fukuhara M., Thierry A.,
RA   Bouchier C., Caudron B., Scarpelli C., Gaillardin C., Weissenbach J.,
RA   Wincker P., Souciet J.-L.
RT   "Genome evolution in yeasts.";
RL   Nature 430:35-44(2004).
XX
CC   This Genome Reviews entry was created from entry CR380956.2 in the
CC   EMBL/Genbank/DDBJ databases on 15 February 2011.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1195132
FT                   /organism="Candida glabrata"
FT                   /strain="ATCC 2001 = NRRL Y-65 = CBS 138 = IFO 0622"
FT                   /mol_type="genomic DNA"
FT                   /chromosome="Chromosome J"
FT                   /db_xref="taxon:284593"
FT   tRNA            complement(10142..10213)
FT                   /gene_name="tRNA-Glu (CTC)"
FT   CDS_pept        12254..12577
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000203673" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17437787"
FT                   /gene_name="RPS25"
FT                   /locus_tag="CAGL0J00165g"
FT                   /product="40S ribosomal protein S25 "
FT                   /cellular_component="ribosome"
FT                   /protein_id="CAG60666.1"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="HOGENOM:HBG391193"
FT                   /db_xref="HOGENOM:HBG610520"
FT                   /db_xref="InterPro:IPR004977"
FT                   /db_xref="UniParc:UPI00003B6999"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FPX5"
FT                   /transl_table=1
FT                   /translation="MPPKQQLSKAAKAAAAMAGGKKSKKKWSKKSHKDKAQHAVILDQE
FT                   KFDRILKEVPTYRYVSVSVLVDRLKIGGSMARVALRHLEREGIIKPISKHSKQAIYTRA
FT                   SAE"
FT   CDS_pept        complement(12843..13682)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000142029" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18501134"
FT                   /locus_tag="CAGL0J00187g"
FT                   /product="Similar to uniprot|P53217 Saccharomyces
FT                   cerevisiae YGR026w"
FT                   /protein_id="CAG60667.1"
FT                   /db_xref="HOGENOM:HBG058177"
FT                   /db_xref="HOGENOM:HBG204339"
FT                   /db_xref="UniParc:UPI00003B699A"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPX4"
FT                   /transl_table=1
FT                   /translation="MAKKIKIIKKRDRKRVDPLAKQKLAWTTGHSLVVVCGILFSIAYF
FT                   FQILLFFKYRNWKWLFLRENKNYTFIKGTRWYHTILRHTPLLLYKTSLIGVFVSYGVTL
FT                   LQNWKGVDPSWNDLLASQNFQSIMIAALWFVSGGKSFYKLVPFMVLSYLHLINMKNEFN
FT                   GVDNHKEFSKKYKFQLNIVAYSELVVMLRLLIDALVMRTGTSGYMFVIYLGIYWLRLNY
FT                   SAYAQASVVQIIKLVDHKIPKQAQPLWTGFKKFLSLKISECIERNRQIEKEDAIIAT"
FT   CDS_pept        14366..15079
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000204890" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17437788"
FT                   /gene_name="THG1"
FT                   /locus_tag="CAGL0J00209g"
FT                   /product="tRNA(His) guanylyltransferase "
FT                   /EC_number="2.7.7.-"
FT                   /function="tRNA guanylyltransferase activity"
FT                   /biological_process="tRNA modification"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAG60668.1"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006400"
FT                   /db_xref="GO:0008193"
FT                   /db_xref="HOGENOM:HBG029648"
FT                   /db_xref="HOGENOM:HBG329601"
FT                   /db_xref="InterPro:IPR007537"
FT                   /db_xref="InterPro:IPR016904"
FT                   /db_xref="UniParc:UPI00003B699B"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FPX3"
FT                   /transl_table=1
FT                   /translation="MAKSKYEYVKQFESHDTLLPQCYIVVRIDGKKFHEFSKYYDFKKP
FT                   NDERALKLMNACAKNVVLQYRHEMILAYGESDEYSFVLKKDTELYKRRRDKLSTLIVSL
FT                   FTSNYVALWSKFFPGTNLHPKHLPFFDSRCVIYPNLETIRDYVTWRYVDTHINNLYNTA
FT                   FWQLIQKCGMNPQEAEKRLSGTVSSEKNEILFKECGINYNNEPEMYKKGSLITNKGEIL
FT                   HINVIDSLDSLFEGY"
FT   tRNA            complement(15352..15423)
FT                   /gene_name="tRNA-Asp (GTC)"
FT   CDS_pept        complement(15883..17376)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19348972"
FT                   /locus_tag="CAGL0J00253g"
FT                   /product="Similar to uniprot|P53214 Saccharomyces
FT                   cerevisiae YGR023w MTL1"
FT                   /protein_id="CAG60669.1"
FT                   /db_xref="HOGENOM:HBG123712"
FT                   /db_xref="InterPro:IPR007567"
FT                   /db_xref="UniParc:UPI00003B699C"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPX2"
FT                   /transl_table=1
FT                   /translation="MFVVLLLLSFAFAQIEPPAGGVGINNNNNNNNNNGTDLSSSNIIP
FT                   SSDPYSFTPDESTQLQVPSSTSSVVPVEPSSFTNSFSTLISQSPSTFSSTFSSTFSSII
FT                   PSSFSSLPSSSRSSQYTPSSTISSISSSSSLSSSSSYFSSSISVRSSYSSSSRSSSSII
FT                   SSSSRSTIAPSSSSSSFFSSAITSSSSSVYSSFSSFSSSYSSSSSSISPSSTLSTFSSS
FT                   SSILPSSTTSSSTTSISSSISSTTITTSSTPSSSSSINTSNVIITSVIEGKTILSNSYT
FT                   TITYSPESTAHKSPQNKSGNHGLSSKNKKIVIGCVVGIGVPLLIAILVLLYIFCIMPTR
FT                   TDFIDSDGKVITAYKRNIFVTIWYSLLGKNLDDARNFSSESPMGSDDNSSDFIITNDKD
FT                   VANTYEVPDIDTTQASANEEDDLINNIRGRNFKAHRHSTSLTSNIYTESSVDEFTTPSQ
FT                   GRQYDHLSIVNSIASENIIPEDFDDGYYHRGGNLNVTNY"
FT   CDS_pept        complement(19390..20301)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000229504" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17437789"
FT                   /locus_tag="CAGL0J00275g"
FT                   /product="Similar to uniprot|Q05636 Saccharomyces
FT                   cerevisiae YDR280w RRP45"
FT                   /function="3'-5'-exoribonuclease activity"
FT                   /function="RNA binding"
FT                   /biological_process="RNA processing"
FT                   /protein_id="CAG60670.1"
FT                   /db_xref="GO:0000175"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0006396"
FT                   /db_xref="HOGENOM:HBG339832"
FT                   /db_xref="HOGENOM:HBG737187"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR015847"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniParc:UPI00003B699D"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPX1"
FT                   /transl_table=1
FT                   /translation="MAKDIEISTSEATFIVEALRQKQRLDGRRLDQFRDVQIEFGKEYG
FT                   DVTVRMGKTLVQCRISCQITEPYEDRPFEGLFVISTEISPMAGPQFENGNSTGEDEVLC
FT                   ARIIEKAVRRSGALDVEGLCIVAGSKCWAVRADVHYLNCDGGFIDASCIAVMAALSHFR
FT                   KPDISVHGEDVVVYPVDEREPVPLGILHIPICVTFSFFNPQDTEENIKGDSNAEISIID
FT                   ATTKEELLRDGVLTVTLNKNREVVQVSKAGGLPMDALQLMQCCHKAYEITEQLTDMILK
FT                   EVKHDLAKRDKYSSILSSENAR"
FT   CDS_pept        21048..22742
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000141974" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17437790"
FT                   /locus_tag="CAGL0J00297g"
FT                   /product="Similar to uniprot|P38775 Saccharomyces
FT                   cerevisiae YHR045w"
FT                   /protein_id="CAG60671.1"
FT                   /db_xref="HOGENOM:HBG058084"
FT                   /db_xref="HOGENOM:HBG203747"
FT                   /db_xref="UniParc:UPI00003B699E"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPX0"
FT                   /transl_table=1
FT                   /translation="MFDIGFLIKLSITVLAFVLGTNWLLSSFVLDFMRDWTQVALNQQS
FT                   NVSSVRKEKESAHYRNFLIPLGFPLTTGLSLSLGYKSRNGNVCDIWNAVMEVGEGQNTI
FT                   QLYNENGQLEKFSLSRLNGLVKKILQLEGIEKCRRIGITVPINTIQGFVLTIAGMVRSV
FT                   THSAPIQMLSSVPRSKIDGLDIIVIPTWKSYTRLNGSENWYSKILILEKEPMIENIPAN
FT                   VIFWDDLVNGSLTDSEFDYTCPEDMSDDKKDLMYVTSPQNQTNRFSQMNLVSTVASCIK
FT                   GFPVDHSLSEKDNLLVGAQQSKPLESLSVWPKLFAVLLHGGSVSFLKVTDTNLNNLDGV
FT                   TLASLSRQEIEILHREILSNNTSIFDRIKKKWAETLFSEGIFTQFAKKKISSIKNMRCI
FT                   YVVNELLNADIISSLDSSKIESYDTATVGNVLSSKLLGDIRSEFGCRVVQELVCPYMLM
FT                   GIISGTNYYDYRVFPENVDKLLACFGTLETNLEAKMVEVISKKKLDVTKRQGMLCIRGY
FT                   SIGKPLDEERLNHALQLSDTVGGADGWMPLIGVFGLFGTDGCLYIYK"
FT   CDS_pept        complement(22849..23733)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000282238" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20195751"
FT                   /locus_tag="CAGL0J00319g"
FT                   /product="Strain CBS138 chromosome J complete sequence "
FT                   /function="inositol or phosphatidylinositol phosphatase
FT                   activity"
FT                   /protein_id="CAG60672.1"
FT                   /db_xref="GO:0004437"
FT                   /db_xref="HOGENOM:HBG426470"
FT                   /db_xref="HOGENOM:HBG730251"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="InterPro:IPR020550"
FT                   /db_xref="InterPro:IPR020583"
FT                   /db_xref="UniParc:UPI00003B699F"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPW9"
FT                   /transl_table=1
FT                   /translation="MDLLSIEKFLCDLSVNQVGPIIKKKSGTQHVYDLKTGERAVDIVT
FT                   AIDKQVEKLIWDSLKEQYPDFKFVGEESYVKGVTTITDDPTFIVDPIDGTTNFVHDFPF
FT                   SCTSLGLTINKEPVVGVIYNPHLDLLISASKGNGIRINREPFDHKAKLESMGPLYLNKS
FT                   VVALQPGSAREGNNFKTKMKTYESLLSCDEGFVHGFRNLGSTAMTLAYIATGNLDSYWD
FT                   GGCYSWDVCAGWCILKEAGGIIVGANPGEWDIPIDNRSYLAVRGTTEEGGKELQKKYVD
FT                   DFWKCVKGKLSYD"
FT   CDS_pept        complement(24103..26676)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000106482" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17437791"
FT                   /locus_tag="CAGL0J00341g"
FT                   /product="Strain CBS138 chromosome J complete sequence "
FT                   /function="metallopeptidase activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="proteolysis"
FT                   /protein_id="CAG60673.1"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="GO:0008237"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG403372"
FT                   /db_xref="HOGENOM:HBG515894"
FT                   /db_xref="InterPro:IPR001930"
FT                   /db_xref="InterPro:IPR014782"
FT                   /db_xref="UniParc:UPI00003B69A0"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPW8"
FT                   /transl_table=1
FT                   /translation="MDREILPSNVTPLHYDLVLEPSFETFKFDGSVTIDLQVNDSTVDS
FT                   ISLNTLEIDIKAVTLDGSITPSEIKVDEAAQVTEFVFEKGTLSEKKSVKLEIKFIGILN
FT                   DQMAGFYRAKYEDKQTGETKYMATTQMEATDARRAFPCFDEPNLKSTFDVTLISDKHLT
FT                   QLSNMDVKSETIEGEKKITKFNTTPKMSTYLIAFIVAELKYVESKEFRIPVRIYSTPGD
FT                   EHLGEFAASLTARTLKFFESTFDIEYPLPKMDMVAVHEFSAGAMENWGLVTYRVVDLLL
FT                   DKENSTLDRIQRVAEVIQHELAHQWFGNLVTMDWWEGLWLNEGFATWMSWYSCNEFQPQ
FT                   WNVWQQYVADSLQRALSLDSLRSSHPIEVPVKNADEINQIFDAISYSKGSSLLRMISKW
FT                   LGEDIFIKGVAEYLNKFKYGNAKTEDLWDSLSEASGKDVTKVMNIWTKQIGYPIVTVNE
FT                   EGEKISFTQHRFLSTGDVKPEEDETLYPVFLAIKTKDGIDNNINLDEREKTIELKDNEF
FT                   FKINGNQAGVYVTCYSDERWAKLSKQAEFLSVEDRTGLVADVKSLASSGYTSTTNFLNL
FT                   ISNWSNEESFVVWTQMINSISALESAWVFEDESIKTGLKNYVTKLSIEKAHKLGWEFSN
FT                   EDSYSTQKLKVLLFDVACSNDDEKAQSAAIDMFNKYISGDKKAIPALIKPSVFNTVASK
FT                   GGEESYQKLYNIYKNPMATDEKLAALRALGKFKEDKLITKTLSYLLDGTVLSQDFYIPM
FT                   QGLRTHKEGILAMWEFLKQNWTEIIKKLQPGSPVLGGVLTVSVSSLASVEKIDDVKQFF
FT                   SDKPTKGFDQTLAQALDTATSKSKWVARDGEVVRKYLEDNGYFIN"
FT   CDS_pept        27627..29123
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000160689" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19348973"
FT                   /locus_tag="CAGL0J00363g"
FT                   /product="Similar to uniprot|P38776 Saccharomyces
FT                   cerevisiae YHR048w"
FT                   /function="transporter activity"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="membrane"
FT                   /protein_id="CAG60674.1"
FT                   /db_xref="GO:0005215"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG434120"
FT                   /db_xref="HOGENOM:HBG676874"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI00003B69A1"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPW7"
FT                   /transl_table=1
FT                   /translation="MSESISMKDSDSCNQIDAESKSALSANEQTEFEVSFSEDGDPDPE
FT                   NIARHLPLVRKYYISSLITLTSTVITIISSCWSLASPNIMKHFHISHEVSTLGITLYIF
FT                   GLGFGPLFLSPISELYGRRITFVSSLFLSIIWQCLTTWSKTIEGVLFGRFLSGFFGSVF
FT                   LSVAGGAISDIFSKKQIGIPMAIYTTAAFLGPSLGPIISGALYHANYKWTFVTLLIASG
FT                   VCLTLIVISVPETYAPVLLIKKAQRLREETGDDRYYAPLEITRKETSIFKSVVLSAKRP
FT                   FGLLLRDPMMGVLCFYTGLVLAIVYLYFVAFPYVFETLYHFTVMEVGCSYIGLMVGMLL
FT                   ASPTSYIFQKRYDAKVERNGGVRTPEMRFEPLYYGAFCTPIGLMIFAWTCYSHVHWIGP
FT                   QIGSAIFGVGVYFVFVGVFGYTVDAYRKYAASGMACNSFVRSVMSGVFPLFGLQMYKGM
FT                   GVNWAGFLIAMVTVLMIPVPFLFDRYGPYLRSKSPYAWDD"
FT   CDS_pept        29762..30487
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000194266" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19348974"
FT                   /locus_tag="CAGL0J00385g"
FT                   /product="Similar to uniprot|P38777 Saccharomyces
FT                   cerevisiae YHR049w"
FT                   /protein_id="CAG60675.1"
FT                   /db_xref="HOGENOM:HBG192745"
FT                   /db_xref="HOGENOM:HBG383462"
FT                   /db_xref="InterPro:IPR005645"
FT                   /db_xref="UniParc:UPI00003B69A2"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPW6"
FT                   /transl_table=1
FT                   /translation="MTASAAPRLLFLHGFLQNGKVFSEKSSGIRKLLKKADIQCDYIDA
FT                   PVMLEKKDLPFEMDDEKWAATLEADVNRAWFYHSEISKELDLTEAINTVANHIKENGPY
FT                   DGIVGFSQGAALSTIITNKISELVPSHPEFKVSLVISGYSFTEPDPENPGQLRITEKYR
FT                   ESFKPNPESQTKMLFVYGASDMAVPSERSKYLYNLYKESFGEDAEGTKLHAFEHPGGHM
FT                   VPNKKDIIRPIVEQITSSL"
FT   CDS_pept        31269..32894
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000152204" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19348975"
FT                   /locus_tag="CAGL0J00407g"
FT                   /product="Strain CBS138 chromosome J complete sequence "
FT                   /function="transporter activity"
FT                   /cellular_component="membrane"
FT                   /protein_id="CAG60676.1"
FT                   /db_xref="GO:0005215"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG312498"
FT                   /db_xref="HOGENOM:HBG370455"
FT                   /db_xref="InterPro:IPR001046"
FT                   /db_xref="UniParc:UPI00003B69A3"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPW5"
FT                   /transl_table=1
FT                   /translation="MPVARESSRNSLSQMFLREESEELPMIATSSRMQNLIRIGKKYAR
FT                   FIGPGLMVSVSYMDPGNYSTAVAAGSAHKYKLLFSMFVSNLMAGFLQCLCARLGAVTGL
FT                   DLAQNCKKHLPYGLNITLYILAEIAIIATDLAEVVGTAISLNILLGIPLPIGVVLTVID
FT                   VLIVLMAYKPNGDLKLIRYFELFVSFLVICTVICFAIELFYVKLGPASDIFKGFLPSKA
FT                   VIEGDGLYLSLAILGATAMPHSLYLGSGVVQPRLRDYDIKHGYYSPDELDIDNNHQDYK
FT                   PSLESVQETLHYTVAELLVSLFTIALFVNCAILIVSGATLFETPQDADIADLFSIYELL
FT                   SNTLSKSAGTIFALALLFSGQSAGIVCTLSGQIVSEGFLNWTIAPALRRSLTRAVAITP
FT                   CLILVMVSGRSGLSNSLYASQVVLSVLLPFVSAPLLYFTSNKNIMRIEMIDRKLPATSI
FT                   FSTPGNVEQNKKKYGKVRLDEDEEEVIPLQDMETETETDQSQHQDQNIEYKDMSNSTFV
FT                   NILAVTVWLLISGLNLYMLKNLDK"
FT   CDS_pept        34645..35103
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000160656" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20195752"
FT                   /locus_tag="CAGL0J00429g"
FT                   /product="Similar to uniprot|P00427 Saccharomyces
FT                   cerevisiae YHR051w COX6"
FT                   /function="cytochrome-c oxidase activity"
FT                   /protein_id="CAG60677.1"
FT                   /db_xref="GO:0004129"
FT                   /db_xref="HOGENOM:HBG118891"
FT                   /db_xref="HOGENOM:HBG381551"
FT                   /db_xref="InterPro:IPR003204"
FT                   /db_xref="UniParc:UPI00003B69A4"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPW4"
FT                   /transl_table=1
FT                   /translation="MLSRTLLRAPVFKRTLLTSATRATPLSLRVATWSPQITSIRKYSD
FT                   HHDEETFEEFTARYEKEFDEAYDLFEVQRVLNNCFSYDLVPAPAVIEKALRAARRVNDL
FT                   PTAVRVFEALKYKVENEDQYKAYLDELKEVREELGVPLKEDLFPSSSQ"
FT   CDS_pept        complement(36171..37169)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000071678" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17437792"
FT                   /gene_name="GPD1"
FT                   /locus_tag="CAGL0J00451g"
FT                   /product="Glyceraldehyde-3-phosphate dehydrogenase 1 "
FT                   /EC_number="1.2.1.12"
FT                   /function="NAD or NADH binding"
FT                   /function="glyceraldehyde-3-phosphate dehydrogenase
FT                   (phosphorylating) activity"
FT                   /biological_process="glycolysis"
FT                   /biological_process="oxidation-reduction process "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAG60678.1"
FT                   /db_xref="GO:0004365"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006096"
FT                   /db_xref="GO:0051287"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG269967"
FT                   /db_xref="HOGENOM:HBG571736"
FT                   /db_xref="InterPro:IPR006424"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR020828"
FT                   /db_xref="InterPro:IPR020829"
FT                   /db_xref="InterPro:IPR020830"
FT                   /db_xref="InterPro:IPR020831"
FT                   /db_xref="UniParc:UPI00003B69A5"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FPW3"
FT                   /transl_table=1
FT                   /translation="MVRVAINGFGRIGRIVLRIAMKRDGIDVVAINDPFITNDYAAYMF
FT                   KYDSTHGRYDGEVTHDDKDLIIDGKAIKCYQERDPADLPWGDNDIDIVIEATGVFTAKD
FT                   LAEKHITAGAKKVVITGPSATAPMFVKGVNDDKYTSDVTVISNASCTTNCLAPLAKVLQ
FT                   DNFGIEEALMSTVHSQTATQKTVDGPSKKDWRGGRTASANIIPSSTGAAKAVTKVLPEL
FT                   EGKLTGMAFRVPTVDVSVVDLTVRFAKDVTYDEIKAAIKKASEGEMKGILAYTEDAVVS
FT                   TDFLGDTHSSIFDASAGIQLSPRFVKLVSWYDNEYGFSARVVDMVELVSKA"
FT   CDS_pept        39305..40402
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000871" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20195753"
FT                   /locus_tag="CAGL0J00473g"
FT                   /product="Similar to uniprot|P38779 Saccharomyces
FT                   cerevisiae YHR052w"
FT                   /function="RNA binding"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="RNA processing"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="CAG60679.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006396"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG059154"
FT                   /db_xref="HOGENOM:HBG203749"
FT                   /db_xref="InterPro:IPR002143"
FT                   /db_xref="InterPro:IPR016094"
FT                   /db_xref="UniParc:UPI00003B69A6"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPW2"
FT                   /transl_table=1
FT                   /translation="MAKKGVKKQVKNKEEGLSRERIGRALGSLKKYLEAQEGGEKTQLL
FT                   EDESLGDLQLLFTNAESFTGSKKSFKLKLVDVKHSLYAKWKAASATEIKDFKVLLILKD
FT                   SDVSKVTQDELYDQLNESGIEIDEIICGKDLKTTYKAYEARNAFISQFSLVIADDSVVT
FT                   ALPKLLGGKAYSKVETTPIPIRCNLKGQFSLNALTNQIKKIYLHKLPVRAPRGNMLNVH
FT                   LGRVNWFTDEEIIDNIESVADALIKDAKIRNIMLKTTTSPSLPIYRNDNVIDEMVKENT
FT                   VDDEKAEDVKTVKIGEVDVELSNFDRALMEVANPEEYETMFSKQISKAKRAREEEPEVE
FT                   EKTPVKKGKNDSKQVKGKKSPKSKK"
FT   CDS_pept        complement(40807..42804)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000177026" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20195754"
FT                   /locus_tag="CAGL0J00495g"
FT                   /product="Strain CBS138 chromosome J complete sequence "
FT                   /function="antiporter activity"
FT                   /function="drug transmembrane transporter activity "
FT                   /cellular_component="membrane"
FT                   /protein_id="CAG60680.1"
FT                   /db_xref="GO:0015238"
FT                   /db_xref="GO:0015297"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG334116"
FT                   /db_xref="HOGENOM:HBG398292"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniParc:UPI00003B69A7"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPW1"
FT                   /transl_table=1
FT                   /translation="MPNQFKYTTDERRSSVIYSTSVGKGGLYVPQDYIPPEATERVIDE
FT                   EMERGDSSDEPLTYQSLSVNRNSNAGSNKRRSDEYQSLIEANNARTLQREHNARQSITN
FT                   ADGYGAISNYRKNSINKELLEEERDLLIDNHLLDTSKSRRHSQSVGINAAQDFFLGQGY
FT                   NENTNSVHPDLFIEGEEEVEEEEEEEEIINTWEDAIESGKEISTSFHREIQVISVNAFP
FT                   LVFTFILQNSLSLASIFSVSHLGTKELGGVTLGSMTANITCLAAIQGLCTCLDTLCSQA
FT                   YGARNNHLVGVLVQRCAIITCLAFLPVMYIWFFWSDRILASMIPEKELCSLAASYLKIT
FT                   AIGVPGFIFFECGKRFLQCQGIFHASTIVLVICAPLNAILNYILVWDKNIGIGYLGAPT
FT                   SVAISYWAMALGLLAYTVLTKHPANPMKCWNGVIKPNQLFRNWKKMFNLALPGIIMVEA
FT                   EFLGFEILTVFASRIGTAPLGAQSIVATVASLAYQVPFSISVSTSTRVANFIGASLYKS
FT                   CIITCKVSLLLSFACSSLNMLIIFTFKKQIAGLFSSEEDVVSLVVSTLPILAFMQLFDA
FT                   FNASTAGCLRGQGRQKIGGYINLFAFYCIGIPMAYCLAFVFNTGVGGLWYGITCALVMM
FT                   SICQGYAVFHCDWKQIIEAAKVRNSESCRP"
FT   CDS_pept        44256..46373
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000132960" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17437793"
FT                   /locus_tag="CAGL0J00517g"
FT                   /product="Similar to uniprot|P38766 Saccharomyces
FT                   cerevisiae YHR031c RRM3"
FT                   /function="nucleoside-triphosphatase activity"
FT                   /function="nucleotide binding"
FT                   /protein_id="CAG60681.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0017111"
FT                   /db_xref="HOGENOM:HBG055752"
FT                   /db_xref="HOGENOM:HBG398055"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010285"
FT                   /db_xref="UniParc:UPI00003B69A8"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPW0"
FT                   /transl_table=1
FT                   /translation="MRRQAKKDPKQKSINSFFFKAAKSKSLIVNSSSRSQAHSTLPSSQ
FT                   GSSRSDGTSFGSGRVMKQRSTLTKSNLFTFQGSFNDEDCNPQNEFRKLMNPQEINNFKT
FT                   PSLSRMPSFTRSNSSMSLSPVKRTTTVLSSDDEFREVTTFQSQDAKRQLSFTSSVDTSA
FT                   MRQHNNLINTNNDLANFSGLKFRKLKAPNQNSNKKSTSSPYGKPLISLTKEQQTVVDYV
FT                   VKKNMNVFYTGSAGTGKSVILRTIIDKLSSMYGKESIAITASTGLAANTIGGSTLHKWS
FT                   SCGIGNKSVDHLVRQIRRYHDQYAIWRHTKVLIIDEISMLDGHYLDKLEAVAKQLRNND
FT                   RPFGGIQLVLTGDFFQLPPVSKKDDDKNVVFCFDSKMWKKCIQKTILLTKVFRQQDNEL
FT                   VDILNAIRYGELQNDMIKRIKSLGRDVYYPDGISPTELFPTRREVDISNSRQLEALPGE
FT                   AKIYESVDVAPPSYQNMLDNSVMAEKKLTLKEDAQVMMLKNKPESELFNGTLGRVLFFS
FT                   TEKLIRRMKELYGSSPLDEDLITDMRLVSRVIARPDIASSERFMKEVNMRPMERFHKLQ
FT                   TMINDAVTTSIKEQVFPYVKWSLNHGRYNYELMLPERFPVDIPGDKLGLERNQLPLMLC
FT                   WALSIHKAQGQTIQRLRVDLKNIFESGQVYVALSRAISMDSLQVLNFNPKKISIDPKVK
FT                   EFYRQLEILDT"
FT   CDS_pept        47095..48561
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000233024" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21044603"
FT                   /locus_tag="CAGL0J00539g"
FT                   /product="Similar to uniprot|Q00772 Saccharomyces
FT                   cerevisiae YHR030c SLT2"
FT                   /function="ATP binding"
FT                   /function="MAP kinase activity"
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="CAG60682.1"
FT                   /db_xref="GO:0004707"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG537393"
FT                   /db_xref="HOGENOM:HBG755340"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR003527"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI00003B69A9"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPV9"
FT                   /transl_table=1
FT                   /translation="MDVERQTFKVFNQDFTIDKRFELIKEIGHGAYGIVCSARFTEASE
FT                   ETTVAIKKVTNIFSKTLLCKRSLRELKLLRHFRGHKNITCLYDMDIVFYPDGSINGLYL
FT                   YEELMECDMHQIIKSGQALTDAHYQSFTYQILCGLKYIHSADVLHRDLKPGNLLVNADC
FT                   QLKICDFGLARGYSENPEENNQFLTEYVATRWYRAPEIMLSYQGYTKAIDIWSTGCILA
FT                   EFLGGKPLFKGKDYVDQLNRILQVLGTPPDETLRRVGSKNVQDYIHQLGYIQKIPFSEL
FT                   FPNANEDALDLLEGMLAFDPQKRITVDKALEHPYLTIWHDPADEPECNEKFEFSFESVN
FT                   EMEDLKRMVVDEVQSFREFVRQPLMDDKSQEDEQQQGSPENYQQTSPTNISPQRLHNNG
FT                   SHDLLQEPEFLTQTPNQNSTIPDQLQESFVGIHSDNLPEHDTDFPPRPQENILASPMGL
FT                   PSASDRNSMNNDSFLDLERELEFGLDRRYL"
FT   CDS_pept        48915..49796
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000251511" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17437794"
FT                   /locus_tag="CAGL0J00561g"
FT                   /product="Similar to uniprot|P38765 Saccharomyces
FT                   cerevisiae YHR029c"
FT                   /function="catalytic activity"
FT                   /biological_process="biosynthetic process"
FT                   /protein_id="CAG60683.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0009058"
FT                   /db_xref="HOGENOM:HBG437425"
FT                   /db_xref="HOGENOM:HBG563743"
FT                   /db_xref="InterPro:IPR003719"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="UniParc:UPI00003B69AA"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPV8"
FT                   /transl_table=1
FT                   /translation="MLQVPFKQVNVFSGEPFKGNPVAVINCLDLDESNYLTDEEMQSIA
FT                   NWTNLSETTFIYKSQNPQADYKVRIFTPVSELPFAGHPTVGTCKAYLDIVGKPISGNYI
FT                   VHQECAAGLVPIEIKDGIVSFSAPRVAPTELSDEVIAEYTKIVGHPYTHRPQMIDSGPQ
FT                   WVVYLVEDADTCYNINPNFQNLKLLNLDNDHSGVIIAGPRSDNEWEMRAFVPVLSVPED
FT                   PVCGSGAAAFIGHLQQRFQYKETTNVKITQGGRLNRNGLIVGQINLDNEKPVYKIGGVP
FT                   VTVVDGTITVRV"
FT   CDS_pept        50462..52915
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000189891" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21044604"
FT                   /locus_tag="CAGL0J00583g"
FT                   /product="Strain CBS138 chromosome J complete sequence "
FT                   /function="serine-type endopeptidase activity"
FT                   /biological_process="proteolysis"
FT                   /cellular_component="membrane"
FT                   /protein_id="CAG60684.1"
FT                   /db_xref="GO:0004252"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG398049"
FT                   /db_xref="HOGENOM:HBG518985"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR002469"
FT                   /db_xref="InterPro:IPR002471"
FT                   /db_xref="UniParc:UPI00003B69AB"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPV7"
FT                   /transl_table=1
FT                   /translation="MEEQPERIRDDAFYWKKRFVVDRMLKFAVLLVLLVWGSVLLLKMV
FT                   TPLKEDHKRHQLPSNTTVDGKLLINFDNIRNGTFKPTRHNLQWIKSTKKGSDDDMGLYA
FT                   TKIDDKFVIKSVLDEDYEDVLLKEKTFEYDGKNYTADDIIASPDLSKLLVRSSTVKNWR
FT                   HSNFGTYFLYDAKKAEFDQLAENVALAVWSPNSVDVAYVQNNDIYVYSTKTDETIIVTD
FT                   DGNENVFNGIPDWVYEEEVFSNDRALWWSPNGDYLAFLKTDETNVGEFSIPYYAQKEDD
FT                   VYPEVKTIKYPKSGTPNPVVDLWVHRFNDDSTYPLNISSHHESDSTLITEVTWISESSL
FT                   VTKFSDRSSDVRLVLHFNADTKHAKVARKEPADDGWWEITHNTLRIAKDENMGIIEDGY
FT                   VDVANIDGYNHLVYFSPADSKYPQVLTSGEWEVIDGTLAFNSKTGNLFFIGTREGKSTE
FT                   RHLLYVNINKPKEVHQVTDDSKRGVYTASFSSKTRFALLSYDGPDVPYQKIIELDTDKR
FT                   DEHIHGNSIGKTLYYLEENKKIRDNLKDYARPRKTYQELNLGKDKDGNNIIVNSYEILP
FT                   VNFDSKLKNEYPVFFFAYGGPNSQQCIERFSIGLDEVIATELNAIVVVVDGRGTGLKGR
FT                   PFRAVVRDNLGNYEAEDQIRAAKLYKSKPFVNSDKISLWGWSYGGYLTLKTLEKDAGEN
FT                   FKFGISVAPVTDWKLYDSVYIERYMHTPQENPEGYEKSKVSDVEALGKARRFLIMHGTG
FT                   DDNVHFQHTLKLLDRLNLKAIENYDVHVFPDSDHAIKYHNANDMIYNRIVSWTRKAFNG
FT                   EFDPK"
FT   CDS_pept        53432..56383
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000176022" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17437795"
FT                   /gene_name="RPN1"
FT                   /locus_tag="CAGL0J00605g"
FT                   /product="26S proteasome regulatory subunit RPN1 "
FT                   /function="binding"
FT                   /function="enzyme regulator activity"
FT                   /biological_process="regulation of protein catabolic
FT                   process"
FT                   /cellular_component="proteasome complex"
FT                   /protein_id="CAG60685.1"
FT                   /db_xref="GO:0000502"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0030234"
FT                   /db_xref="GO:0042176"
FT                   /db_xref="HOGENOM:HBG020916"
FT                   /db_xref="HOGENOM:HBG314403"
FT                   /db_xref="InterPro:IPR002015"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR016643"
FT                   /db_xref="UniParc:UPI00003B69AC"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FPV6"
FT                   /transl_table=1
FT                   /translation="MSTDKKKEEVPKPETEDLTVKDETKNKDKKKANEEEELSEEDQKL
FT                   KGDLEMLVQTLLEDDSKLYETTLTQLKEFIKNSTSSMTAVPKPLKFLRPFYPDLCKAYD
FT                   KWSDKDQKSSLADMLSVLAMTYSDTHQHDSLRFRLLSDTSNIASWGHEYVRHLALEIGE
FT                   VYNEQVEKEAEDNSTSTESSPQPPHMNFEFSKDVILQLSLEIVPYFMKHNGEEDAVDLL
FT                   LEIEAIEKLPQFVDENTYKRVCQYMIACVQLLPPPEDISFLQTAYSIYLSELQLPEALS
FT                   LAIRLGNEDMIRSVFDATSDPIVHQQLAYILAAQRVPFEHPELQEIIGNTKLSEHFLYL
FT                   AKELNLLTPKIPEDIYKSHLDSSKSVFSSAGLDSAQQNLAASFVNAFLNLGYCNDKMIT
FT                   DNDNWVYKTKGDGMTSAVASIGSIYQWNIDGLQQLDKYLYVDEPEVKAGGLLGIGIASA
FT                   GVHHDVEPALLLLQEYINHSDTKISTAAILGIGIAFAGSKNDEVLGLLLPVVSNTENSL
FT                   ELAAIAALALSHVFVGTCNGDITTAVMDNFLERTPLELKSEWARFLALSLGLLYLGQGE
FT                   HVDDVLETINAIEHPMTSAIEVLISSCAYTATGDVLLVQDLLHRLTPKAVKSSDEDEDE
FT                   DNEELSQEDMNGISAFLGKKENEIAEEPQGNEGADNEMEVDSHQDETTTGENNVKKEEN
FT                   EEEKTEKSEKTENDEEEEDEEESKDEGANDELAYAVIGIALITMGEEIGKEMSLRHFGH
FT                   LMHYGNEHIRRMVPLAMGLVSVADPQMKVFDTLTRFSHDPDLDVSMNSIFAMGLCGVGT
FT                   NNARLAQLLRQLASYYSREQDALFITRLAQGLVHLGKGTMTMDIFNDAHVLNKVTLASL
FT                   LTVLVGLISPSFILKHHQLFYMLNSGVRPKFIITLNEEGEQIKVNVRIGQAVETVGQAG
FT                   KPKTITGWITQSTPVLLGHGERAELENDEYISYTNNIEGVVILKKNPNFQEEE"
FT   CDS_pept        complement(56779..57414)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000056522" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20195755"
FT                   /locus_tag="CAGL0J00627g"
FT                   /product="Similar to uniprot|P23968 Saccharomyces
FT                   cerevisiae YHR026w PPA1"
FT                   /function="hydrogen ion transmembrane transporter activity "
FT                   /biological_process="ATP synthesis coupled proton transport"
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="proton-transporting V-type ATPase, V0
FT                   domain"
FT                   /protein_id="CAG60686.1"
FT                   /db_xref="GO:0015078"
FT                   /db_xref="GO:0015986"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0033179"
FT                   /db_xref="HOGENOM:HBG211385"
FT                   /db_xref="HOGENOM:HBG325773"
FT                   /db_xref="InterPro:IPR000245"
FT                   /db_xref="InterPro:IPR002379"
FT                   /db_xref="UniParc:UPI00003B69AD"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPV5"
FT                   /transl_table=1
FT                   /translation="MAVVADKPLVGKINYSRYFYYLVLFVVVVYALRKMLTGHGSDIDI
FT                   GRFLSKTSPYMWANLGIASCIGLSVVGAAWGIFITGSSMIGAGVRAPRITTKNLISIIF
FT                   CEVVAIYGLIMAIVFSSKLTVSSKDSLYSKSNLYTGYSLFWAGLTVGVSNLICGVSVGI
FT                   TGATAAVADAADSSLFVKILVIEIFGSILGLLGLIVGLLMAGKAADFQ"
FT   CDS_pept        complement(58040..59113)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000247199" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20195756"
FT                   /locus_tag="CAGL0J00649g"
FT                   /product="Similar to uniprot|P17423 Saccharomyces
FT                   cerevisiae YHR025w THR1 homoserine kinase "
FT                   /function="ATP binding"
FT                   /function="homoserine kinase activity"
FT                   /biological_process="threonine metabolic process "
FT                   /protein_id="CAG60687.1"
FT                   /db_xref="GO:0004413"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006566"
FT                   /db_xref="HOGENOM:HBG123215"
FT                   /db_xref="HOGENOM:HBG646290"
FT                   /db_xref="InterPro:IPR000870"
FT                   /db_xref="InterPro:IPR006203"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniParc:UPI00003B69AE"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPV4"
FT                   /transl_table=1
FT                   /translation="MVRHFKIKVPASSANIGPGYDVLGVGLNLFLELDVEIDALNAQET
FT                   NDDKNNCKLSYTEDSEGYDSVPLESDANLITRTALYVLRCNDIRKFPSGTKINVHNPIP
FT                   LGRGLGSSGAAVVAGVVLGNEVGQLGFSKQRMLDYCLMIERHPDNITAAMMGGFCGSFL
FT                   RDLTTQEMERREIPLSEVLPEPSGGEDTGLVPPLPPSDIGRHVKYQWNPAIKCIAIIPQ
FT                   FELSTADSRGVLPKAYTTQDLVFNLQRLAVLTTALTLDPPDAKLIYPAMQDRVHQPYRK
FT                   TLIPGLTEILNSVTPTAYPGLLGICLSGAGPTILALATENFEDIAAEIINGFHKKNVKC
FT                   TWKLLEPAYEGVTVEQL"
FT   CDS_pept        59501..60946
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000206848" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21044605"
FT                   /locus_tag="CAGL0J00671g"
FT                   /product="Similar to uniprot|P11914 Saccharomyces
FT                   cerevisiae YHR024c MAS2 processing peptidase "
FT                   /function="metalloendopeptidase activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="proteolysis"
FT                   /protein_id="CAG60688.1"
FT                   /db_xref="GO:0004222"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG333374"
FT                   /db_xref="HOGENOM:HBG407991"
FT                   /db_xref="InterPro:IPR001431"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011237"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="UniParc:UPI00003B69AF"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPV3"
FT                   /transl_table=1
FT                   /translation="MLRNSLRVAQRRGYFQVSRLKNGLRVATSDTPGHFSALGMYVSSG
FT                   SRYETGSLKGCTHIVDRLAFKSTKNIDARSMMETLELLGGNYQCTSSRESMMYQASVFN
FT                   RDVEKMLNLLAETIRFPKITEEELQEQKFTAQYEIDNIWTKPDLILPELLHNTAYSGET
FT                   LGSPLICPREILPSITKKSLLNYREKFYNPENTVAAFVGQPHEKSIELAEKYLGDWTTT
FT                   GEPLDKTAAHYTGGETCIPSAPVFGTMPELMHIQIGFEGLPIDHPDIYALATLQTLLGG
FT                   GGSFSAGGPGKGMYSRLYTHVLNQYYFVENCVSFNHAYSDSGIFGISLSCIPQAAPQAA
FT                   EVIAQQFYNCFANGALRLTDAEVSRAKNQLKSSLLMNLESKLVELEDMGRQVLMHGKKI
FT                   PVSEMVSKIESLTTKDISRVAEMVFTGKAHNKGNGTGRATIVMQGDRAAFGDVQEVLGH
FT                   YGLGSSSFSTDQSKSSTTKLKWF"
FT   CDS_pept        complement(61246..66900)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248744" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20195757"
FT                   /locus_tag="CAGL0J00693g"
FT                   /product="Similar to uniprot|P08964 Saccharomyces
FT                   cerevisiae YHR023w MYO1"
FT                   /function="ATP binding"
FT                   /function="motor activity"
FT                   /cellular_component="myosin complex"
FT                   /protein_id="CAG60689.1"
FT                   /db_xref="GO:0003774"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0016459"
FT                   /db_xref="HOGENOM:HBG397279"
FT                   /db_xref="HOGENOM:HBG501769"
FT                   /db_xref="InterPro:IPR001609"
FT                   /db_xref="UniParc:UPI00003B69B0"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPV2"
FT                   /transl_table=1
FT                   /translation="MNQDMRVWVPDPVEIFVRGDLLNTDIVKDKFTGVEQQVGLVKKDN
FT                   DGETATFKISEIFPVNPANFDRVDNMSELTHLNEPSVLNNLENRYKDNLIYTYSGLFLV
FT                   AINPYKEISNLYSNSTIKSYHSSNEETSQKPHIFEVAESAYRDLKSKKQDQSILVTGES
FT                   GAGKTENTKKILQYLASITSDSFEVSNNFEMKILQSNPVLESFGNAQTVRNNNSSRFGK
FT                   FIKIEFDQSGKINGAFIEWYLLEKSRITNENRNERNYHIFYQLLKGTSQKDLESIYKLS
FT                   SNDFAHYQILANSNHVIPGVDDAAEFQKLLVALETVGFGKDQINSIFKIVAVILHCGNI
FT                   EFVSEKSEQASFKSDISAIATLLGVSESDFKTAILKPRSKAGREWVSQAKNANQARFII
FT                   NSLCRTLYEHLFGYIVDTINMSLNHGSMTANYIGLLDIAGFEIFEHNSFEQLCINYTNE
FT                   KLQQFFNHHMFVLEQSEYLKENIQWDYVDYGKDLQSTINLLEAKGPPTGILPLLDEETI
FT                   LPKSEDSSFYSKLISTWQQNSTKFKRSKLDMCFVLKHYAGDVEYHVNGWLAKNKDPLNE
FT                   NLVNILSVSSNRLISEFFSGFESISSPSSSPTRLTHSSSSASINSLGKGRTNLKTALSR
FT                   HREQQSSLLSQLALTNPHFVRCIIPNNKKMSETFDRRLILDQLRCNGVLEGIRIAREGY
FT                   PNRILFKEFYERYRILSEHLDKSSDAINYKQSSQILISELHLDPTTYKVGTSKLFFKAG
FT                   TLAELESKKESILFEITVRFNSIIRGWSQRKRTKGEIQKMRASEMIGNVFRKYNEKMQD
FT                   PWFNMYMKIKPLLASSQNIVDSRKYTEKIKVLEQKLTAVETEKKIHTAKHNDLLNELND
FT                   VKNLLDVEKEKLKRNEQLLSKSNEQQREIETMIKEIREDKSTLLSEKEAAISKIQELEL
FT                   VRQKLEEKNNEKDASIAELTRKLSSLESEKGDITRQISMDTEVLKKLENEKMEKERVIE
FT                   KLSHDIKERDHIIDELKQKEHISNKDLDIKLQTLEKNCNVALTKLKSLLNENAELREEV
FT                   GKNKKLHANTIQQVSSKEKEIERLKARFASNQGEINEILKQRDSLMAENDKLSKELSEM
FT                   KMALRKANENYAQMKNQIEEMAKQEHINRENSPMESRSDISLLKKQLEDEKSLNKYLNQ
FT                   KLLGDRVVQRSLHLDDLSNADKDVLLKKYYEIKTALHEQSTSLEEAIEENKNLISRLRF
FT                   TETRLASSSFESQTVKAQLKKLKHFLENKGMQADIDQLLSDIKPSDVNVEQILLEVQHL
FT                   KMQLNAEQKAHKEAEAAITALHSKFELIQKVDSTSDIYKIKYEASEEHVRALENKLRSL
FT                   PFKDRTNLPSGEIFTNKDSISKYEEELRFYKIENFKLQDKLSEFENICGSLKHEIKQGS
FT                   VKEVLLEEQVERLQKDLESTERQKEMLTSNLRQQRQQYEDCLSDLNANETQLREYNHAL
FT                   KQAEDDIKGMATVIEKLKSSNKQKDKTIWDRETEKNDLDMQLQETLLELKRVQDMNQLL
FT                   QTDVHHFKERLNTSSDVSRYTNEIERLKEALDESSKYSGEFKKEISTLKYKLETLKNDS
FT                   EAKIEHLLKQSEHYETIVGQLGEERDENQEIIKDLNQKLIDMESNLKKLNDDYEALSQQ
FT                   RDTLLQESDRLRSELGNSTEQFNATVKHNVDVNDKLRNLEETLRLQTEQNERNEQLVKS
FT                   IQMDLESYKMKYDEEKQKNIDLVEEAETLKSVTVRLEETIKDLDQRLSDTSEKEAWLRK
FT                   IHEVETLLNDERDMKIEEMKKSKALERTINELEARNASQVEVIETANGDRTKFEETVMK
FT                   YNEQMHQLEKYISQQEIDMKKVVRENMEYQEKMNEMERELMLWKQRYHVASGGTNNFSQ
FT                   RNEEEVMVQT"
FT   CDS_pept        70057..70941
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18501135"
FT                   /locus_tag="CAGL0J00715g"
FT                   /product="Similarities with uniprot|P01119 Saccharomyces
FT                   cerevisiae YOR101w RAS1"
FT                   /function="GTP binding"
FT                   /function="GTPase activity"
FT                   /biological_process="signal transduction"
FT                   /cellular_component="membrane"
FT                   /protein_id="CAG60690.1"
FT                   /db_xref="GO:0003924"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0007165"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG123636"
FT                   /db_xref="InterPro:IPR013753"
FT                   /db_xref="InterPro:IPR020849"
FT                   /db_xref="UniParc:UPI00003B69B1"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPV1"
FT                   /transl_table=1
FT                   /translation="MEILLYDVSDNPTPRCLDNTARITVMGEHGSGKTTLITRWLRNMF
FT                   IQVDQGDYDIYTTHVARQNIHQYDHEINAALSKTKSEMLAKNPSDENITPAMTRASSYK
FT                   NRHPLKVQILDAEPVEIGEYSDLRNMQIEQSDAFILCFDCADSNAVDELRGYKRKIDSI
FT                   RGNALIMLCCTKVDLSAERVFGIEETQDILEKLNISPSDYYEVSSKHAIGTERLLYRTL
FT                   AHIEDCKTSERIDMVKNSIATSEEEKSSTDSVSTETLKEDEKKTRGRLLHPRAIRKLSH
FT                   NDSPAQQQCCCIM"
FT   CDS_pept        join(72900..72902,73586..73831)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000224977" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18501136"
FT                   /locus_tag="CAGL0J00737g"
FT                   /product="Strain CBS138 chromosome J complete sequence "
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="CAG60691.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG034279"
FT                   /db_xref="HOGENOM:HBG392194"
FT                   /db_xref="InterPro:IPR000592"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="UniParc:UPI00003B69B2"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPV0"
FT                   /transl_table=1
FT                   /translation="MVLVQDLLHPTAASEARKHKLKTLVQAPRSYFLDVKCPGCLNITT
FT                   VFSHAQTAVTCESCSTVLCTPTGGKAKLSEGTSFRRK"
FT   CDS_pept        74694..79826
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000809" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21044606"
FT                   /locus_tag="CAGL0J00759g"
FT                   /product="Similar to uniprot|P47054 Saccharomyces
FT                   cerevisiae YJL039c NUP192"
FT                   /protein_id="CAG60692.1"
FT                   /db_xref="HOGENOM:HBG058397"
FT                   /db_xref="HOGENOM:HBG202210"
FT                   /db_xref="InterPro:IPR021827"
FT                   /db_xref="UniParc:UPI00003B69B3"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPU9"
FT                   /transl_table=1
FT                   /translation="MKWSVSQFSDLYASIDAKAISSELFTQLLPDLKELLKYPPKNTES
FT                   RNKLEKLQDYKTDDGSIFKLNQDFIISIISLSDELNLDELEAVNLVLENSPGSQIYASE
FT                   VVNNGKISFFLRRQYILQIVSYICNAEDVMSPYYKKFFNAETNTTILSKVLENFDIISK
FT                   HLSDIKQEVNRNQILDNMNPLITQGIHFKRDFFSKEYDLLSQVLYGLSKRSLINTQISS
FT                   VDLIIEHSLKMETNDFFVVYFLPTLLNLFSNLNTFSDVDIFGLHKKYTNELITKQEQVY
FT                   KKPMKVLIMFIFLTFLIGWCKEDPQNRVTKLNFKSDIDDPMTIAVELGAIEQLLIVIAD
FT                   LSRIDESTAVQYYDFRALLERHLPRFIPLQLVDENVIQKYNQMSSLTERSDSTKINGPH
FT                   ESFSRNTYRPPSMISPNNYSKDNRFTNGLGSTSISMDRLNEGRVFFSTSDMNKEISKFR
FT                   ENISEMFEMFLEENIHHFIQTFISDCAFLLTKLKDAEEDSLLSGEDLDLDDIATKADLE
FT                   RFFVSVFYFYSKRPHYVAAFWEDKESAAYGFVEWASKCNDNLMKSCFYLMLGGLSSGKE
FT                   NALNVYYYLGDSNPTSWKRIADTIGSYSSKILNLGKAIQAKEQENEGELNTTLLALEEG
FT                   LNEETIVFLSSLLTLISSVADQMEPDEKLMFSHLFVDVIFELTKCETPLVGACFNTIST
FT                   LVPILESDRASIWHKLDSTLFKGVALSDTSQYISAFSSILTTYSDVLGFLALIRNLLQI
FT                   ESFDCNKEFLVFGHLQYPNQLGRPYRKSGIWPYLEFVMNEVFVNSDKITDSFKRHELQE
FT                   RVLEIILTCLNSFDYSVLLNSISVGANLDNLVHGENFASYVQDNAAPAMFNFLFQENVY
FT                   TKLYSIASVGIDNSSLLKPHSQLQTLLRLSLSVIERTLDYEKTYTEELLTIIKKYQSGE
FT                   FYRPKYYGLHGLVSFTQTVFFNLDFVTCLGLYIGLDNDSIPIISINILRKLALLFNSTE
FT                   PDPILGNKLFTLFDSIDESARIKDAFIDQLDCPIENSDNLMLKVEILEFLKDSLDIESS
FT                   KPSVAHLLLGFQYDNTLTFGPNLSTFIQSGHSLFHSVIRLLISALNELSSYKIDFAPMR
FT                   LAALSLQLLELMCKSQLTSDLVIEHITNNEIIKKIMDVDPQTSNHTLWNGLNLESTTQS
FT                   TKARFIQGSSAGAYLMFLRYRTSMIQFLNVVIHTISLKGTISRVAPYTSYLISNSIYSA
FT                   RIFSLLRPLHQNIILKEKIVPENLQLLKDLPVDLDKVQLRKSCTGNIYDFDEISSVLEL
FT                   HSKTYSVSQLNSKEFMDKILSEFEEVKQLITLFLVRKESFSQQLAILHNWVQLVQIIVS
FT                   DGNLGERKRSTFILEVFDMVTPKISVYVDIDVKFAEELVSLMVFLFHIYNQSNASSSGK
FT                   YFLDSKLHNLFQVCIRGISSPLSSLKLRSDFYVIANNYLLRVLKNSGMAYAIVKDLRLN
FT                   NERLVEVICNDAIYGEGAIKITGLLLLDSLVQLGNHHQENFIVMTLMRSTKLFHIIRSL
FT                   KATDSLLNASTENVNVENFLYELTAFKATAYFLIRIAETREGAVALIESKVFDILAELN
FT                   FLKIDPDLGLELVFDETSNNTSSLLRVNITFDEPLILGKEATSVSIFELIIPIFQLMLA
FT                   IVISSGRFNDAVRLATTSLLKQYQKLIIGTFKRDTLYKSGKKQASDELKYKHHQEFIKL
FT                   VVLICTITKYEDK"
FT   CDS_pept        complement(79993..82593)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000808" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17437796"
FT                   /locus_tag="CAGL0J00781g"
FT                   /product="Similar to uniprot|P14907 Saccharomyces
FT                   cerevisiae YJL041w NSP1"
FT                   /function="structural constituent of nuclear pore "
FT                   /cellular_component="nuclear pore"
FT                   /protein_id="CAG60693.1"
FT                   /db_xref="GO:0005643"
FT                   /db_xref="GO:0017056"
FT                   /db_xref="HOGENOM:HBG205267"
FT                   /db_xref="HOGENOM:HBG591578"
FT                   /db_xref="InterPro:IPR007758"
FT                   /db_xref="UniParc:UPI00003B69B4"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPU8"
FT                   /transl_table=1
FT                   /translation="MSAFGNSGGGSFSFGNNSSSAFGAAANAGSNNTGGSSAFSFGANQ
FT                   NASTPFGGAATNNSANNGGANNTASPFGMNANQNKPLFGGATAGQSSSPFGAASNNTGA
FT                   TPGQTNNTSASQGLFGSNSNNVSQKPAFGFGASNTQATPSFGGFGSAQNGSSNNTTGAS
FT                   AFGAATSNTQNTTPAATNTGSAIGSTPAFGFNSANNNNNNAQNNKPAFSFGSTQPQSNN
FT                   TLGTAAGTNSNPGSSGKPAFSFGASNTTSTTGTAGAVGNTSNTPVPPSGSTPKPAFGTS
FT                   ASTTPAPGAGSFSFGSSIGTDANKTDAAKPSLFGGLNKPADAASKPTLSFGSTAPSSNT
FT                   TNDKPASDAKPAFSFGNSSTTNNGPSLFSQAKPADEEKKTTPALNFGSASQSGEKTEEK
FT                   KPAFSFGAAATGSTTQSKPSLSFGSTTKEENKSSSTPAFSFGSKPANDDKKDTPETSNK
FT                   PEASKPSFSLNLSAGTSEKKDENSTKPFSFGTKTAEKDETKTDKPAFSFGKTTTDTNES
FT                   KPALSFGGKNENSDKKSTLTFGSQSEKKEDSGAKPAFSFGSKSDKKDEPPKPAFSLGTK
FT                   TDKTEISESKPGFSFGAKTDKPSTTTDVNKTETPKAGFSLKSDSKADDKSKNFSFGTSK
FT                   DGKNTSETDKTESAKSNLGTEASSQQKLESKPVEVKPVSLDNKTLDDLVTKWTNQLSSA
FT                   SKHFDQYSKRITDWDRILVDGGKQISQLYTEAVNAEQAQNKIDQSLQYIERQQEELETF
FT                   LDNYESRTEALLSDILPSNSGVPGNNNDQKRLQAYKTAESLDENLNALSANLSSLIDEV
FT                   NDVSNTFNNVTSINLNNKDESAQLIKLLNVHLDALKSLDNNALLLENKIDSIQK"
FT   CDS_pept        complement(83483..87427)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000113582" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21044607"
FT                   /locus_tag="CAGL0J00803g"
FT                   /product="Similar to uniprot|P43638 Saccharomyces
FT                   cerevisiae YJL042w MHP1"
FT                   /protein_id="CAG60694.1"
FT                   /db_xref="HOGENOM:HBG058396"
FT                   /db_xref="HOGENOM:HBG202209"
FT                   /db_xref="UniParc:UPI00003B69B5"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPU7"
FT                   /transl_table=1
FT                   /translation="MGGLHSAWSRMQVRKTMDRRKSATDVDVAWLIRNSSHRKGVVYSE
FT                   GDEASEVCKLPMREVKEEGVPLRRTKSASSAPAPTFSESAANASNASVEGGRRGSVSKG
FT                   KIGFFKSLFSHHRHEVPKPVESAPQSPELSPMQSVQSNGSSPTRRLSQPRTISNESSYA
FT                   VSAENSKRLDDFIAHCKETLSERQRGIDERQRHASIGRPQSFMTPAQSAPRRLDSRGRP
FT                   IPPHPSKSAFPPILKRGNCDERKLNVESTVSLSSVDGPAPETPSSATHKFGAFLKKVTS
FT                   YGSQPSLNPNGTFDSIDRTVSNISDSSHRTTQDRYGTVPGLENCKQLKHVAFATTTYFN
FT                   DPPQQICSKNPRKGEVEVKPNGSVIIHRLTPEERKKIMETSSAGIVVGGSGQLKVLNPI
FT                   EQQSSDDEDSQKRNIAIAAEEAAAEARGNNKKEEDIEVSKLASHLTIDKPMVSRRPREN
FT                   PIRTSSSSSLLSILSDEENKNGTDQSPKGSESDSGTDEEEIYPPPNLKIPHDVVYTRCC
FT                   HLREILPIPATLKQIKKGSTDPIPLLQLRNPRPSLLEIWSFSDFLSISPVLCVSLDGVS
FT                   LTEEMLRIILSSLVSNPHLEKLTMRNTPLNEDGWKILSYFITKQKKNFVALDLTMVPTI
FT                   KTNVQKPSKSSLAKNANNPNLLKRMECNTHNRSDMNWDLLTAAVATKEGGIEEFVLAGA
FT                   CMSYTQFKNFIELACTNTDRLGLAYNKLTMEQCKVLAEWIVTSNIRGLDLGFNDLKGKT
FT                   SVFTDAVANKVQNVGEKNEMKYISLNSTNLSVEADTTPENNEVLRLLSVLCYSENLKFL
FT                   DLSNNPKIFPHCIKTLTTSLPVYVNLIRLHLDYNDLDCASIVVLAESLPLCSKLHHLSL
FT                   LGSKLNLASAKALTEAVNKSNTLMTLDLEYNTVPESIKERMSLYTMRNIQNELDNVQKT
FT                   KRKAGLSLPSVPQEEMAANEKQISTLQEELSSLLTDKFEDSLEYDKLVVEFIEKITKVR
FT                   TKIEKVVSDLFDLRVKNELSCEGKETLINLCLIDSSFEQGIHLLKQRHNKLQKHTVAAP
FT                   TSIHDEKTNLTSNKAMNKLLNNPMFSDPFANDSMSKLSNNDSDQSLERTQRDRTILSSS
FT                   AFGNTGHSALLPFGTATVEESNKAADDTVEFRESENSYKTIVRGPSTDPIGTKYDILNK
FT                   ELEHLQKNKANKPAEKLYTLDSGVSINSDELTRAAESLESEKIKDFLLKNDVATIVNVI
FT                   DELHEKGYHLHDIFRKQEVDDHKKEEILKTLQEDQSHNKSNNPFLESTGNGASAEAKKA
FT                   IPKYMEEKAIDEAYDQVLDNIARIRSKTHE"
FT   CDS_pept        87530..88843
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21044608"
FT                   /locus_tag="CAGL0J00825g"
FT                   /product="Similar to uniprot|P32806 Saccharomyces
FT                   cerevisiae YJL044c GYP6"
FT                   /function="Rab GTPase activator activity"
FT                   /biological_process="regulation of Rab GTPase activity "
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAG60695.1"
FT                   /db_xref="GO:0005097"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0032313"
FT                   /db_xref="HOGENOM:HBG123648"
FT                   /db_xref="InterPro:IPR000195"
FT                   /db_xref="UniParc:UPI00003B69B6"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPU6"
FT                   /transl_table=1
FT                   /translation="MGKSYWYKQRSRMDWFSQRAVDLGYDHGGVVARGVWLGEFYEGMS
FT                   RSDERCAGRGSRSWLWTHLAGEELPELEMPGAEYRHEESRSVSGSGSGSGSGGRAGHTH
FT                   ATYGGHGGLGKGNVRVLTPVRATAHPLAGAEKGDLSERLNTSMEIVDLDLKRLLIHPMF
FT                   SEPQHVKNMKLLLYNYLLDSIEYKQGFHEIMGMIYMQIYDNDENSETKLRTVLKLFTTL
FT                   MAPLNKVFYEEDNLLNWEQKIFRPMLMGLSPKVFSIIYSGHGKHHNNNLIWIIRWTRLL
FT                   FIREIASKVDILELWDHLLTVPAAQFPLFMAAFISVMLLSIYDQVVEFSRDKTLDHDDL
FT                   IEILLLRYKEMNPHIDVVKYCQVAMEATEQFNAGELDKLFGTATKFLEWKYRDSPQILA
FT                   MHQQSRDMKLGRPDIPPDPNRLRMEEKLKQRVLQRLHR"
FT   CDS_pept        complement(89492..91624)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000160475" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18501137"
FT                   /locus_tag="CAGL0J00847g"
FT                   /product="Strain CBS138 chromosome J complete sequence "
FT                   /function="electron carrier activity"
FT                   /function="flavin adenine dinucleotide binding "
FT                   /function="oxidoreductase activity, acting on the CH-CH
FT                   group of donors"
FT                   /biological_process="electron transport chain"
FT                   /biological_process="tricarboxylic acid cycle"
FT                   /protein_id="CAG60696.1"
FT                   /db_xref="GO:0006099"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0016627"
FT                   /db_xref="GO:0022900"
FT                   /db_xref="GO:0050660"
FT                   /db_xref="HOGENOM:HBG293998"
FT                   /db_xref="HOGENOM:HBG302926"
FT                   /db_xref="InterPro:IPR003952"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR004112"
FT                   /db_xref="InterPro:IPR011281"
FT                   /db_xref="InterPro:IPR014006"
FT                   /db_xref="InterPro:IPR015939"
FT                   /db_xref="UniParc:UPI00003B69B7"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPU5"
FT                   /transl_table=1
FT                   /translation="METDFSENQSETTKCEAAQCCPLYAALVPYPSLPAGSRARARARV
FT                   LCGSETYIRDMLRYVVGLGGETIHRSGEQEISKNPNTSTHKKMLRTGLRLRQLSTSCVR
FT                   RHAAPAGLGAGKYNVIDHEYDCLVVGAGGAGLRAAFGLAEAGFKTACISKLFPTRSHTV
FT                   AAQGGINAALGNMHKDNWKWHMYDTVKGSDWLGDQDAIHYMTREAPKSIIELEHYGMPF
FT                   SRTEEGRIYQRAFGGQSKEFGKGGQAYRTCAVADRTGHAMLHTLYGQALNHDCHFFIEF
FT                   FAMDLLTHNGEVVGIIAYNQEDGTIHRFRAHKTVLATGGYGRAYFSCTSAHTCTGDGNA
FT                   MVSRAGFPLQDLEFVQFHPSGIYGSGCLITEGARGEGGFLLNSEGERFMERYAPTAKDL
FT                   ASRDVVSRAMTMEIREGRGVGKHKDHIFLQLSHLPPAVLKERLPGISETAAIFAGVDVT
FT                   KQPIPVLPTVHYNMGGIPTKWTGECLTIDENGEDKVIPGLMACGEAACVSVHGANRLGA
FT                   NSLLDLVVFGRAVANTVADTLQPGTPHKPLPADLGKESLASLDAIRNASGDKTTAQIRL
FT                   NMQKTMQKDVSVFRMQETLDEGVKNITAVDKTFKDVHVTDKSMIWNSDLVETMELRNLL
FT                   TCATQTAVSAAERKESRGAHAREDYPSRDDENWRKHTLSWQQHTGDPVSIKYRKVIATT
FT                   LDEAECPPVPPAVRSY"
FT   CDS_pept        complement(92049..92699)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000157370" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19348976"
FT                   /locus_tag="CAGL0J00869g"
FT                   /product="Strain CBS138 chromosome J complete sequence "
FT                   /function="DNA binding"
FT                   /function="DNA-directed RNA polymerase activity "
FT                   /protein_id="CAG60697.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003899"
FT                   /db_xref="HOGENOM:HBG347513"
FT                   /db_xref="HOGENOM:HBG627112"
FT                   /db_xref="InterPro:IPR004519"
FT                   /db_xref="InterPro:IPR005576"
FT                   /db_xref="InterPro:IPR013238"
FT                   /db_xref="InterPro:IPR016027"
FT                   /db_xref="UniParc:UPI00003B69B8"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPU4"
FT                   /transl_table=1
FT                   /translation="MFILTKLKDLVRIPPDQFHRDAVSAITHELNVKYSNKVVPHVGLS
FT                   VSVYDLLEVDEGQLRPGDGASYINVTFRCVVFKPFAGEILTGWIKRCDGEGIQVSMMGL
FT                   FDDIFIPKKMLFEGSYYSPEDGAWVWPMDEETKLYLDVNEMIRFRVEEEVFVDVKPPSP
FT                   KELELERERELQLQEQQEHQQHQQQESKLEKPPAYALLGSCQTDGMGLVSWWD"
FT   CDS_pept        92958..94358
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000172553" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17437797"
FT                   /locus_tag="CAGL0J00891g"
FT                   /product="Similar to uniprot|P34078 Saccharomyces
FT                   cerevisiae YKL143w LTV1"
FT                   /protein_id="CAG60698.1"
FT                   /db_xref="HOGENOM:HBG058393"
FT                   /db_xref="HOGENOM:HBG398293"
FT                   /db_xref="InterPro:IPR007307"
FT                   /db_xref="UniParc:UPI00003B69B9"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPU3"
FT                   /transl_table=1
FT                   /translation="MSKKFTSKNSQKFAVVHRPHDDPNYYDADATEHVLVPVDPKGKQA
FT                   VKQRPQRQRKPVNEHVGEARIYGIGFDDSKYDYTQHLKPIGQDPNAVFIAKTPAQAPAK
FT                   KKNIEDLFVEDTYKGEAPTRPDSVFKFGMAKPEYLKHQQDVPDDIRGFKPDMNPALREV
FT                   LEALEDEAYVVNEDIVVEDPKKKKGKKKVEVADDLEEEDDDIFAELLQGGEVGSDGEFQ
FT                   DEFDEWDMDNLDEYEETHYQDEMKQFDNIDNLEDLQGIDYQADVMRFQKQQKKKFEEFE
FT                   SDNEFDSDAEGDDLSRGGNVSEDEEEEEDGDVLGDLPTINKKTTGKKKRKERKKKGAMS
FT                   DISGFSMSSSAIARTETMTILDDKYDNIIASYENYEEEQLDDEYENAKPFNMEEERADF
FT                   ESMLDDFLDNYELDAGGRKIVKKDAERDRIKQAADEVSKGKLSLRRNRERQKKEVEKVT
FT                   SSLNSLRF"
FT   CDS_pept        94620..95756
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20195758"
FT                   /locus_tag="CAGL0J00913g"
FT                   /product="Similarities with uniprot|Q07913 Saccharomyces
FT                   cerevisiae YLR007w"
FT                   /protein_id="CAG60699.1"
FT                   /db_xref="HOGENOM:HBG123655"
FT                   /db_xref="InterPro:IPR011513"
FT                   /db_xref="InterPro:IPR014857"
FT                   /db_xref="UniParc:UPI00003B69BA"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPU2"
FT                   /transl_table=1
FT                   /translation="MSFKLIKSHLLHLKAIARSKKSNGVEVATQMSEGTPNNDVGDDLA
FT                   GEVRIGLSESEKEKHLLQYLLNCRGVCHENVLLKVMLLMENEQGDLEQGLSVFEWQAKL
FT                   QERVARINLKLQPLKYQVKKAIYGSGRAIVSEKVRSQLELNSANSFGKVNFPNSSQYYV
FT                   YIDTSPFGEMKHATTFTDKELEYIKAFIKVLADRGSVIHEVDDVSGVDSKIVEQIDEIR
FT                   QKAYGNKRRHDSDVESGPENAENNEPVQSSSVSRWTHYASYTADIAALTDTTDLQPLET
FT                   QELLDKLCRLRWLYKTGKGKYGLDLRLLVEMNDYLSDNYSMSSCERCKDIVAQGVQCST
FT                   RDCNSVWHVDCYEHDILHENRICRSCGESILDRGVYVT"
FT   CDS_pept        complement(95878..96339)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000115841" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21044609"
FT                   /gene_name="PAM18"
FT                   /gene_synonym="TIM14"
FT                   /locus_tag="CAGL0J00935g"
FT                   /product="Mitochondrial import inner membrane translocase
FT                   subunit TIM14"
FT                   /function="heat shock protein binding"
FT                   /biological_process="protein transport"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="mitochondrial inner membrane "
FT                   /protein_id="CAG60700.1"
FT                   /db_xref="GO:0005743"
FT                   /db_xref="GO:0015031"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0031072"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG435009"
FT                   /db_xref="HOGENOM:HBG526913"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="UniParc:UPI00003B69BB"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FPU1"
FT                   /transl_table=1
FT                   /translation="MDGTGISDGSSVTGDAAAGFPAGATQAPGSKQGMDLYFDNALQYM
FT                   GEHPVLAGVGGFLALYVGAGVYKGVQTRLNGGKAATQFLKGGFDPKMNAKEALQILNLK
FT                   ENNLTTKKLKEVHRKIMLANHPDKGGSPYLATKINEAKDFLEKKGIVRK"
FT   CDS_pept        96608..97201
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000184344" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17437798"
FT                   /gene_name="RLP24"
FT                   /locus_tag="CAGL0J00957g"
FT                   /product="Ribosome biogenesis protein RLP24 "
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="ribosome biogenesis"
FT                   /biological_process="translation"
FT                   /cellular_component="nucleolus"
FT                   /cellular_component="ribosome"
FT                   /protein_id="CAG60701.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005730"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="GO:0042254"
FT                   /db_xref="HOGENOM:HBG232163"
FT                   /db_xref="HOGENOM:HBG600564"
FT                   /db_xref="InterPro:IPR000988"
FT                   /db_xref="InterPro:IPR011017"
FT                   /db_xref="UniParc:UPI00003B69BC"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FPU0"
FT                   /transl_table=1
FT                   /translation="MRIYQCHFCSSPVYPGHGIMFVRNDAKEFRFCRSKCHKNFKQRRN
FT                   PRKLKWTKAFRKAAGKELAVDSTLTFAQRRNVPVRYNRELVATTLKAMSRIEEIRQKRE
FT                   RAFYKNRMKGNSERDFLRDKKLVETNPELLRLREVEIANRLAKEQAAAEEVSEEESEEE
FT                   EDMEVDSEEEEEEKLQKQKILLKNKKRNAKKLAF"
FT   tRNA            complement(97960..98041)
FT                   /gene_name="tRNA-Ser (AGA)"
FT   CDS_pept        98637..99929
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000192515" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17437799"
FT                   /gene_name="SNX4"
FT                   /gene_synonym="ATG24"
FT                   /locus_tag="CAGL0J01001g"
FT                   /product="Sorting nexin-4"
FT                   /function="phosphatidylinositol binding"
FT                   /biological_process="autophagy"
FT                   /biological_process="cell communication"
FT                   /biological_process="protein transport"
FT                   /cellular_component="endosome membrane"
FT                   /protein_id="CAG60702.1"
FT                   /db_xref="GO:0006914"
FT                   /db_xref="GO:0007154"
FT                   /db_xref="GO:0010008"
FT                   /db_xref="GO:0015031"
FT                   /db_xref="GO:0035091"
FT                   /db_xref="HOGENOM:HBG058403"
FT                   /db_xref="HOGENOM:HBG202212"
FT                   /db_xref="InterPro:IPR001683"
FT                   /db_xref="InterPro:IPR015404"
FT                   /db_xref="UniParc:UPI00003B69BD"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FPT9"
FT                   /transl_table=1
FT                   /translation="MDSASADASVTGSGNAKGSSAERVNGGGKFYKLEILVSDPQKRAG
FT                   EAGLGPYVSYQISTRTDNPSYHGNQKASFDDIIVVHRRYNDVVLLHDILQNDHPTCIIP
FT                   PLPDKKVLQYIAGDRFGRRFTQRRCHSLQNFLRRVSQHPILSTSKVLEIFLVGNEWDTY
FT                   RKNIAGTLQNAQKEDVTDAVMNAFKKVHNQNEEFTEIRDRSDKLDNSVNRINKVFHRVV
FT                   KKNEAIIEDYSKLGLTLQELQELVSSDNDKLADSLKVFIEGVTQFSYGLQDLNMFIDYE
FT                   YLIDLKDLSHYIGSMKQTMRLKDQKQIDYEELSDYLTKSIKEKNNLISGYGGGNFLTSK
FT                   LEELAGYNQEASRRDKINKLESTISSLTTELETAKKVADTFEQETLKEVKKFEEIKNDE
FT                   LKISLNNLADENIKFYERMLETWEKVDQSLR"
FT   CDS_pept        complement(100059..100838)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000085051" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17437800"
FT                   /locus_tag="CAGL0J01023g"
FT                   /product="Similar to uniprot|P47058 Saccharomyces
FT                   cerevisiae YJL035c TAD2"
FT                   /function="hydrolase activity"
FT                   /function="zinc ion binding"
FT                   /protein_id="CAG60703.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG220403"
FT                   /db_xref="HOGENOM:HBG741046"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="UniParc:UPI00003B69BE"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPT8"
FT                   /transl_table=1
FT                   /translation="MDKYLKHIDSALKLARYALDHGETPVACVFVHEKSDSVVAYGLND
FT                   TNDSLSGTAHAEFVAMRMLRDAVQAQGYASVQLKQLFKEIVCYVTVEPCIMCASALKQM
FT                   GIHKIVFGCGNDRFGGNGTVLSIHSDKSTTVAGSTEYDRTILVPGIRRREAIMLLRYFY
FT                   VRENDRAPKPRTKAERNLDKNTFPPMQWCNYLTRDDFTTIFGEPLISKYDNNEDLAGET
FT                   INWDMIDNSHDSIINELQQESQNFELFLQNKKHKHST"
FT   CDS_pept        101282..103579
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000268801" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20195759"
FT                   /gene_name="DBP4"
FT                   /locus_tag="CAGL0J01045g"
FT                   /product="ATP-dependent RNA helicase DBP4 "
FT                   /EC_number="3.6.4.13"
FT                   /function="ATP binding"
FT                   /function="ATP-dependent helicase activity"
FT                   /function="RNA binding"
FT                   /biological_process="rRNA processing"
FT                   /cellular_component="nucleolus"
FT                   /protein_id="CAG60704.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005730"
FT                   /db_xref="GO:0006364"
FT                   /db_xref="GO:0008026"
FT                   /db_xref="HOGENOM:HBG517301"
FT                   /db_xref="HOGENOM:HBG737336"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="UniParc:UPI00003B69BF"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FPT7"
FT                   /transl_table=1
FT                   /translation="MAKKHRYTTVQRKQERQKEEEYIKELEQRIQDYDVKNNKAVFFKD
FT                   LPISKSTLKGLNEASFIKMTDIQRDSIVTSLQGHDVFGTAKTGSGKTLAFLVPVLEKLY
FT                   RERWTEFDGLGALIISPTRELAMQIYEVLVKIGSHTQFSAGLVIGGKDVNFELERIAKI
FT                   NILIGTPGRILQHMDQAVGLNTSNLQMLVLDEADRCLDMGFQKTLDAIVGNLPPDRQTL
FT                   LFSATQSQSISDLARLSLTDYKKIGTIDSSEDGPATPKTLQQSYIIADLADKLDVLYSF
FT                   IKSHLKTKMIVFFSSSKQVHFVYETFRKMQPGISLLHLHGRQKQRARTETLDKFFRAQQ
FT                   VCLFATDVVARGIDFPAVDWVIQVDCPEDVDTYIHRVGRAARYGKKGRSLIILTPQEEA
FT                   FLTRMAAKKIEPGKLTIKQSKKKSIKPQLQSLLFKDPELKYLGQKAFISYVKSIYIQKD
FT                   KEVFKFDELPTEEFANSLGLPGAPRIKIKGMKAIEQAKKLKNTSRSLLSLSKANDDGEI
FT                   NDKKDKQVRTKYDKMFERKNQTILSEHYLNITKSQAQEDEDEDFITVKRKDHELKEEDL
FT                   PQLTVPTSRRAQKKALSKKASLSTKGNATKMVFDDEGQAHPVYELEGEEEFHKKGDAEE
FT                   QKKEFLSKEAEIMADRDVSDKIIQKEKKQEKKRKRLEAMRREMEAAYADEYSDEDEEGG
FT                   NVAYLGTGNLSDDMEEYSSDEESRKTKKSKTVDYRFDKKNKTISEDTDIMEIQEPETIE
FT                   DLESLTARLIEG"
FT   CDS_pept        join(complement(104902..104904),complement(103764..104714))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000190796" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17437801"
FT                   /locus_tag="CAGL0J01067g"
FT                   /product="Similar to uniprot|Q00618 Saccharomyces
FT                   cerevisiae YJL031c BET4"
FT                   /function="protein prenyltransferase activity"
FT                   /protein_id="CAG60705.2"
FT                   /db_xref="GO:0008318"
FT                   /db_xref="HOGENOM:HBG162930"
FT                   /db_xref="HOGENOM:HBG464445"
FT                   /db_xref="InterPro:IPR002088"
FT                   /db_xref="InterPro:IPR008940"
FT                   /db_xref="UniParc:UPI00017BD8EF"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPT6"
FT                   /transl_table=1
FT                   /translation="MELLKQKRVQDQLKIEKYRQLTDTVLGLKDKREFTIESLKLTTNL
FT                   LELNPEFNAVWNYRRDIIVDLGEKLEPKFWEDELMFVMAQLKRFPKVYWIWNHRLWTLQ
FT                   NYPGASVKIWGRELVIVNKLLDADARNYHGWHYRRIVVSHMQKMTGNDMNKEELEYATT
FT                   MIKSNISNFSAWHQRVQLIQKMLEKNEIEDKTLFIEKEIDFVTNAMFTDAEDQAVWFYI
FT                   KWFIRSDLVLKVLTKERYLEMLKTFWENITMINEDELEFSGKENTWCLKLLLVIQQIQK
FT                   SEGIDIEDHTKIYLEKLLTVDPLRKNRYKHLLKLEC"
FT   CDS_pept        105079..105666
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000199586" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17437802"
FT                   /locus_tag="CAGL0J01089g"
FT                   /product="Similar to uniprot|P40958 Saccharomyces
FT                   cerevisiae YJL030w MAD2"
FT                   /biological_process="mitosis"
FT                   /protein_id="CAG60706.1"
FT                   /db_xref="GO:0007067"
FT                   /db_xref="HOGENOM:HBG028452"
FT                   /db_xref="HOGENOM:HBG314247"
FT                   /db_xref="InterPro:IPR003511"
FT                   /db_xref="UniParc:UPI00003B69C1"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPT5"
FT                   /transl_table=1
FT                   /translation="MDRNLSLKGSTRSITEFFEYCINSILFQRGVYPPEDFSTVRKYEL
FT                   SLLRTHDDELKDYLRKILSQVHRWLLGGKCNKLVLCIVDKDDGEVVERWQFDVTHFSKE
FT                   QETAAEVTDEETRNQMRTLIKQITASVTFLPELVKEGGYTFTVLAYTDADAKVPLEWGD
FT                   SDSKEVKDGEIVQFRSFETNDHRVGAQVSYKI"
FT   CDS_pept        complement(105760..108195)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000812" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17437803"
FT                   /locus_tag="CAGL0J01111g"
FT                   /product="Similar to uniprot|P47061 Saccharomyces
FT                   cerevisiae YJL029c VPS53"
FT                   /protein_id="CAG60707.1"
FT                   /db_xref="HOGENOM:HBG058390"
FT                   /db_xref="HOGENOM:HBG202214"
FT                   /db_xref="InterPro:IPR007234"
FT                   /db_xref="UniParc:UPI00003B69C2"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPT4"
FT                   /transl_table=1
FT                   /translation="MLGDSLDYDPTEDITGMLMSRDSLESLDELISVTRSYKLELSKEI
FT                   KQLELEDSGEAATESDALALLQTLIEEYEVTKETSMRTQQSIMDVTQGISRLDNAKQNL
FT                   SQTMSFFQNLKILTDCYIQCKQLLDSGSFRDMVSPYRIMYSLAGTTFAPYKSVQEINKL
FT                   LTSVNRLKSEVFDRIKQKFQQLLSQQEIPPQEDTQQHNELRDGACELLDSDQSAKSTLI
FT                   DWFISKLLYEMNEIFQVDDEAGSLENLARRYIYFKRVLNNFHSNLEQFFLPSWDLPMHL
FT                   TETFMETTRKDLNILLKREFQDKSPTIDLFMNALQETLEFENYINVRFSKKLNDKPKLS
FT                   TCFQPYLSVWVSHQDKLMDKKLLSYMSDPKFPENSTDSFIVPSSADLFRNYRAILTQSL
FT                   ELVQESENTAVLTALATFFTKWLGLYANKILEPLILPDNVEVEDKRECAKYTVLVINTA
FT                   GYCSTTIEQLEERLLEFTSASEQINGIFMQTKSKYDDLAAKGINFLLNRLITVEISFVW
FT                   REFKNVDWSNVMVEDYSRYMQTLKTLLKVTRSQPNTEGNVTILEYILKTFNRDIYKWNF
FT                   LDKVINLVFSEFLGCILKLLQPTPPYASATTKPRLNPRAVVNIGEQLMLDLDLLSNILN
FT                   SIPENMSGDGESTNNSSMKRTKKRIESDMDKLMKLVKLLIAPVDSPETYAETYNEITGG
FT                   NDNSVVWAFILSLKAVPWDLEQWRALRAAYKTKLDERKEEGKPIDHSMLIMEWDSRPMM
FT                   HFQANICRIQDPEWSKLVRNELRIHPPARTIQRPVTPQPQEPRRGIRELVSNSKLFER"
FT   tRNA            complement(108526..108598)
FT                   /gene_name="tRNA-Met (CAT)"
FT   CDS_pept        109127..109924
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248512" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17437804"
FT                   /locus_tag="CAGL0J01155g"
FT                   /product="Similar to uniprot|Q07897 Saccharomyces
FT                   cerevisiae YLR003c"
FT                   /protein_id="CAG60708.1"
FT                   /db_xref="HOGENOM:HBG191743"
FT                   /db_xref="HOGENOM:HBG202614"
FT                   /db_xref="UniParc:UPI00003B69C3"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPT3"
FT                   /transl_table=1
FT                   /translation="MSFKKQDAEGTGVLMGWDGSSVEMGEKRSNEEELSKRQKKLKHGK
FT                   LAQKRREQAAYEEEKLRKLPMQGAEAISEHFATVIRAQNPDLSAIELDEMYLKKSEFLG
FT                   TEAFDGVRNLHEFPGFMARFSRAPRAIVLSMSNIRVADVYRSLGGSSQCVKLFAKNKLH
FT                   EDVATVESVLGADKDKKDKKDKKDKDSKKKIKYFVATPTRLEKLLESTELFFEGKDKLD
FT                   IILDASYLDSKKNSLLDSENTKVLCKVLRTMLDKKSSVKVLLY"
FT   CDS_pept        111185..112624
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000142340" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19348977"
FT                   /locus_tag="CAGL0J01177g"
FT                   /product="Similarities with uniprot|P14164 Saccharomyces
FT                   cerevisiae YKL112w ABF1"
FT                   /function="DNA binding"
FT                   /biological_process="chromatin remodeling"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG60709.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006338"
FT                   /db_xref="HOGENOM:HBG049001"
FT                   /db_xref="HOGENOM:HBG058133"
FT                   /db_xref="InterPro:IPR006774"
FT                   /db_xref="UniParc:UPI00003B69C4"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPT2"
FT                   /transl_table=1
FT                   /translation="MDDGMISEGVKDVYEYSHPIINNALAVSASEQQGKEVRRFATLAD
FT                   WYDVINDYEFQSRCPIILKNSHRNKHFTFACHLKNCPFKILLSYSSAGMHHGHAQDDMY
FT                   RSKDEDVDALNDGAHDHKLEYHDVDDPQVTAAIAAAVAAVGKDSSDPHNAATAAATAAA
FT                   AATNGGEDHKNLVQDTQPSAHSQAQAQASVRPNSNAPETIRGPFVVTKIIPYHDHPVQD
FT                   NLSLDKFVLTKIPRILQNELNFDDVLETLVAEGASDGDVAKFRVSEYVEHSGLLDIIKA
FT                   RYDLMDSDITKKFLSQIARRVTTYKARFVLRKKKYGIIKSDRHHPRANPAPAASGNRPP
FT                   RISRTRRKRSLEDDETEIAQEALKNSMMDDVDHQRHIDDDDEEHARKLARLGEDTDLHS
FT                   GIHDDGDHSSTQNAAMHEINPLASIDEVTDDKLPREVAEQLRLLSSHFKDVENQNLQDE
FT                   EGKKNSAEISDENIQPELRGQ"
FT   CDS_pept        113385..115256
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17437805"
FT                   /gene_name="ATP25"
FT                   /locus_tag="CAGL0J01199g"
FT                   /product="ATPase synthesis protein 25, mitochondrial "
FT                   /cellular_component="mitochondrial inner membrane "
FT                   /protein_id="CAG60710.1"
FT                   /db_xref="GO:0005743"
FT                   /db_xref="HOGENOM:HBG123682"
FT                   /db_xref="InterPro:IPR004394"
FT                   /db_xref="UniParc:UPI00003B69C5"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FPT1"
FT                   /transl_table=1
FT                   /translation="MQSLLQLKHYPLLTSYLEVLSTQKLHYMLRIRSIARPIVRRPWAN
FT                   AARVTGISGTRIQVPFPSSVRWYSDREPQTEPVVKDEESEHVPWYMRLEDDSLKSLNED
FT                   ISKQHEVRLPDDCPDSLHILVKHLQKQLALRDILVFDLKNQRLADPENYRLKMCDYVII
FT                   CTAMSTKHCERSYVEINKLLKNEYGVSGYVEGQVNPNDEKKRLKRLARKNNLGRTNIRR
FT                   NALNSTEESSWYMIDCHVDSIFLNILTENRRYEMNLEELYAPLNEKHLYEKSEHSMHIN
FT                   TNNRSQAFDSLEEEDNVLLALRKLAQQKRQYSTESPARSLRNELVKENFDSSKKLLADN
FT                   PELREQLVKVAISTIEQIRDSTGASINTEKWYKFVSHNVPLVIQDTTFWDSYLKFLLLL
FT                   NDCNSQTYSYKRLIPDYLVTKRSMGEELTADDITTFLSVISERVNPQNYWDLVKANTQV
FT                   VEALRLFDEEVIFTDAILSKVIKTLTTNSNEHKLHSFYEVIKFLVWKYEKEIPINTLET
FT                   ILKTLINFGEYDYLLRLWTTKIGYNVGSKDTRPWKVFLKAITETQDVELIRLIIEKGCL
FT                   LDISRGKVDVDPQLAVLLKTAFKTVDPENLIYNDQQRLLIPSSATRQ"
FT   transit_peptide 113385..113588
FT                   /gene_name="ATP25"
FT                   /locus_tag="CAGL0J01199g"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FPT1 "
FT   mat_peptide     113589..115253
FT                   /gene_name="ATP25"
FT                   /locus_tag="CAGL0J01199g"
FT                   /product="ATPase synthesis protein 25, mitochondrial "
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FPT1 "
FT   CDS_pept        115478..116533
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000173971" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17437806"
FT                   /locus_tag="CAGL0J01221g"
FT                   /product="Similar to uniprot|Q03151 Saccharomyces
FT                   cerevisiae YMR097c"
FT                   /function="GTP binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAG60711.1"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="HOGENOM:HBG058135"
FT                   /db_xref="HOGENOM:HBG397932"
FT                   /db_xref="InterPro:IPR002917"
FT                   /db_xref="InterPro:IPR023179"
FT                   /db_xref="UniParc:UPI00003B69C6"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPT0"
FT                   /transl_table=1
FT                   /translation="MSYRCYSSLSFVPRHVLPRFNIPKSDFKGHQVKAIKKFKKLSPGL
FT                   NMLIELRDIRAPLSTRNVIFDNILRSNRSLERLVVYTKKDMTSGNANGKQYFKKLSQWH
FT                   AQLNEKFIILDGRDTSDAKQLLKILQWENHKVESRGMRLPLGYRAFIAGMPNVGKSTLV
FT                   NTLRRVTNPSSSGTKFKKVARTGSEAGVTRSTSEVIRLMPTTNNSSPIYLIDSPGVGLP
FT                   GRLTNQNRMLTLSMCGAVKTSLIEPVIQADYLLYLMNLQNPLPGAEWYPKYKSEPTNDI
FT                   YEVLRRLAKNKESFDENVVATNWVNKWRLDSKNLLFDVETLLPADAFSYRDYVDKQLEE
FT                   LGELTFLRERQ"
FT   CDS_pept        complement(116608..118011)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000111346" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20195760"
FT                   /locus_tag="CAGL0J01243g"
FT                   /product="Similar to uniprot|P35203 Saccharomyces
FT                   cerevisiae YMR094w CTF13"
FT                   /protein_id="CAG60712.1"
FT                   /db_xref="HOGENOM:HBG058137"
FT                   /db_xref="HOGENOM:HBG203422"
FT                   /db_xref="UniParc:UPI00003B69C7"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPS9"
FT                   /transl_table=1
FT                   /translation="MVEERFNTLRFLDQPYEVRKLVYYHLDGQYTNANPPALDALYHGA
FT                   IEIPNVRDYGGSKKVKKYYRQLVKKLYPLFEQYLQNFQYSPAMIESWLEYSLWLRYDAI
FT                   VLDSLRLNHLYDGELVGPLDWIEIDGDLRLAVINKLYMLQVWYSYGEYKRWVIRNNITD
FT                   YGDMELGYLRLNLEMQRDGQIPNIIQKLRKKEQLNLISEINFTTNIDTVTNGNANGNVK
FT                   RGTNLKRARSDSPDVYLEDPMVKERYQIPNDPALTETIVNLEEMKQVSSLSVRGKNLYE
FT                   SLINVHGARDNPGRTISYISRRRVMRIAMNQVLNPSETGLADLTKWVNLRVISINDCGF
FT                   IDLNKLILPSKAISLSLSNIRELRWWEFEMDSAIQAQFQQNKLLPYRPLFDLCEAGIHY
FT                   TLDKKSISLVELKKFQTTIWKKLQALNWIKINNVAMISNKFIVIPKTLYESKRTVIFST
FT                   TVHSNIVVI"
FT   CDS_pept        complement(118375..119928)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000185028" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20195761"
FT                   /locus_tag="CAGL0J01265g"
FT                   /product="Similar to uniprot|Q04305 Saccharomyces
FT                   cerevisiae YMR093w"
FT                   /biological_process="rRNA processing"
FT                   /cellular_component="nucleolus"
FT                   /protein_id="CAG60713.1"
FT                   /db_xref="GO:0005730"
FT                   /db_xref="GO:0006364"
FT                   /db_xref="HOGENOM:HBG012349"
FT                   /db_xref="HOGENOM:HBG396404"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR018983"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="UniParc:UPI00003B69C8"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPS8"
FT                   /transl_table=1
FT                   /translation="MSSSHPRIVTSRAAVLPQQTTAEQRYWRQYAATQLVKEHNSVTHV
FT                   AFNPQKPHDFAVTSSTRVQVFSSRTRQAIKTFSRFKDVVYSASYRKDGKLLCAGDATGL
FT                   VSVYDSYNPRTLLVSVAASQHPTHVTKFHDHDLKTLVSASDDRVTRVWDISHAYEPQLE
FT                   LTGAADYVRTLCFVPAAPHLVVTGSYDGALRLYDTRAGSKPQHTLVHDQPVENVVAISP
FT                   TQLVSCGGPNFKVWDLTSNKKIFERANFNKTVTCLDYVNLPSDSGLASNSALLASSLDG
FT                   HVKVFDPLDNFQVKFGWKFSSAVLSCAVSPSDAQGSRHLVAGLTSGLLAIRTKKKEKRN
FT                   SHLAVDDYTAGSTGPKKSNNFQRMMRGSQYQGDLEHIIHDDKVKQQRRLRTFERYINQF
FT                   KWAEALDCAFVPGMAKELTLTILQELRKRGKIRVALQNRDESSLEPLLNWCLKGIEDVR
FT                   SVNVVVDWVTVVLEMYGQVAQESPVLNEMVVALRNKVREEVHKAEEAQRIEGMLQLLTN
FT                   "
FT   CDS_pept        120215..122047
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000162559" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17437807"
FT                   /locus_tag="CAGL0J01287g"
FT                   /product="Similar to uniprot|P46680 Saccharomyces
FT                   cerevisiae YMR092c AIP1"
FT                   /protein_id="CAG60714.1"
FT                   /db_xref="HOGENOM:HBG035072"
FT                   /db_xref="HOGENOM:HBG330599"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="UniParc:UPI00003B69C9"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPS7"
FT                   /transl_table=1
FT                   /translation="MLVLEGSIVPVPQGTRNFSARLAYDERSDSVAYGSGKSAYVTGVG
FT                   AGAGGSEGGAGGNDVVQFTGHGANVSVVRFAPVGAYMCSGDESGKVIVWSWNRDGDGGV
FT                   ECVVKAEFQVLAGPVTDISWDFEGKRLCVVGEGRDKFGVFISWDTGNSLGEVTAHSSRV
FT                   NAVHIKQSRPMRCITVGDDGTVVFYQGPPFKFVSSDRTHHDKGKFVRDVEFSKGAGEFA
FT                   VTVGSDRKIACFDGKSGEFVKYIEDADEPITGGLFAVSWLDETRFVTASADQKVRVWDV
FT                   RESKCLHSWTIGEPNTLQQQQIGVVAAKDDQIISLSLDGTLNFLKIGEDKPVRTMHGHN
FT                   KSITALAVNPLVTGSYDGRIMQWVPEKICDSKMQTGHTNLVVSIGSKESGYSSVAWDDT
FT                   LRVNNEVKYKFESQPKCASMDPAGKIAVVTTEDKLLVLDSSTGEKLVETALDVPASAVH
FT                   LSGDLVAIGSEQTNTVSVYNSGDLSLLYKLPDPLRATPSCISIAPSHKLLAVGDVMGKI
FT                   ILYDLETKTVKTSRWAFHTSKINAISWRPEEEDLVATGSLDTHIIVYSVSKPMRTVKVL
FT                   NAHKDGVNAVQWKDRDHIVSAGADACIHTWKFTQ"
FT   CDS_pept        122339..123667
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000141761" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17437808"
FT                   /locus_tag="CAGL0J01309g"
FT                   /product="Similar to uniprot|P32832 Saccharomyces
FT                   cerevisiae YMR091c NPL6"
FT                   /protein_id="CAG60715.1"
FT                   /db_xref="HOGENOM:HBG123702"
FT                   /db_xref="HOGENOM:HBG203421"
FT                   /db_xref="InterPro:IPR013933"
FT                   /db_xref="UniParc:UPI00003B69CA"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPS6"
FT                   /transl_table=1
FT                   /translation="MSDSETKLRSRSGSQKPDYKIDTEGLEIRDDDDNDVDYHEHDAEH
FT                   DGEDGSGRKKRSREDDDEDEDVSLEDDDEDEDEDDEDDGGKSEAREGPHKRARAKRARS
FT                   ATPMGGAGSTRKSEISYPIDEEGHLLPVYKYEYETLEDPEGEKKITADGDLLDGREFTI
FT                   RSFAIAENNAQKFMLSTEVARTMGYRDSYMFFQYHPSVYKFVLGQNQKNHLIDQNIIPY
FT                   SYRSRKITIVAAKSIYKEFGAKVIKSGKSPHDDYYVTVFPVRGQKPKPTASDLKRQEKQ
FT                   KSATATPTELPKKQSPLLSNPTFLEYRNSVANTFTGNSKLNSTNWLYQHAAACSRFNSD
FT                   LYYDRVRVLLIEQQGLRDPYTNTLHIPQNVQSTKVLDWYKEVDEEQEPNEDAITCETII
FT                   KSSNIARPKTNLCDVAPEIYEGVVDEETKKAILAQQEYERQLY"
FT   CDS_pept        complement(123787..124473)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000262434" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18501138"
FT                   /locus_tag="CAGL0J01331g"
FT                   /product="Similar to uniprot|Q04304 Saccharomyces
FT                   cerevisiae YMR090w"
FT                   /function="binding"
FT                   /function="catalytic activity"
FT                   /protein_id="CAG60716.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG220874"
FT                   /db_xref="HOGENOM:HBG734645"
FT                   /db_xref="InterPro:IPR008030"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI00003B69CB"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPS5"
FT                   /transl_table=1
FT                   /translation="MGPLRVAIVGANGKIGHLLTAKLKNSKASFATPVAIVRNEEQVKH
FT                   FQDEMGVDASLASIESATVPELQKAFTGCDAVVFTAGAGGKGVERIFTVDLEGCAKVVE
FT                   ACEKSGISRFVIVSAIKAEDRDFWWGLEGLRNYYIAKKAADQYVRNSKLDWTILQPGFL
FT                   DTNSGTGKLVPQDQLESKKDDNYRIQREDVAEFIVQSLLHPAETKLKTISLANGDVPIA
FT                   DFIKSL"
FT   CDS_pept        124994..127477
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000217277" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19348978"
FT                   /locus_tag="CAGL0J01353g"
FT                   /product="Strain CBS138 chromosome J complete sequence "
FT                   /function="ATP binding"
FT                   /function="metalloendopeptidase activity"
FT                   /function="nucleoside-triphosphatase activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="protein catabolic process "
FT                   /biological_process="proteolysis"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAG60717.1"
FT                   /db_xref="GO:0004222"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0017111"
FT                   /db_xref="GO:0030163"
FT                   /db_xref="HOGENOM:HBG460402"
FT                   /db_xref="HOGENOM:HBG724153"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005936"
FT                   /db_xref="InterPro:IPR011546"
FT                   /db_xref="UniParc:UPI00003B69CC"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPS4"
FT                   /transl_table=1
FT                   /translation="MLEWGGCFLLGYLNVNRVVTAMIRTRIGAVARVRVPVFRARFHCG
FT                   PVWRNSADDDLKRVQERINEYMRKNQRAGAGADAGTNAGTDAGAGAGAGMDMERFRKEI
FT                   DRELKRMEQTIQKQTPEAPREEYKDTKDAKESSQESKEPQEAKEKAKGTKQEAREGSSN
FT                   GGNPPPPPLNDPSGNANNIGLFQLGLLFFLLSFLLDLVNDTEGQKEITWQDFRERYLAK
FT                   GYVQRLEVVNKSYVKVILNDMGKNQPENYGQEVVYFNLGSVENFEHKLEKAQNEMDIDQ
FT                   DFRVPVQYVQQGNWARAVFQMLPTVLMLVGIIWLTRKSMQSAGNTRGGIFGISRSKAKK
FT                   FNTETDVKVKFKDVAGCDEAKEEIMEFVSFLRNPQRYEKMGAKIPRGAILSGPPGTGKT
FT                   LLAKATAGEAGVPFYFVSGSEFVEMFVGVGAARVRDLFKTARENAPSIVFIDEIDAIGK
FT                   ARQKGNFSGANDERENTLNQMLVEMDGFTSADHVVVLAGTNRPDILDNALLRPGRFDRR
FT                   IHIDRPELEGRKAIFEVHLQKLKLAGSIFDLKNRLAALTPGFSGADIANVCNEAALIAA
FT                   RHDENAVKLSHFEQAIERVIGGVERKTRLLSPEEKQVVAYHEAGHAVCGWYLKYADPLL
FT                   KVSIIPRGQGALGYAQYLPGDVFLLSKQQLLDRMTMALGGRVSEELHFQWVTSGASDDF
FT                   KKVTNMATAMVTELGMSEKIGWINYKKNDDNDLTKAFSEETGVIIDSEVYRIVQECHKR
FT                   CTDLLKEKAEDVEKIAQLLLKKEVLTREDMINLLGKRPFPERNDAFDKYLNEAETEKIR
FT                   KSEEQNPDDPSPSAA"
FT   CDS_pept        127843..129537
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000141762" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19348979"
FT                   /locus_tag="CAGL0J01375g"
FT                   /product="Similar to uniprot|Q04301 Saccharomyces
FT                   cerevisiae YMR088c"
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="CAG60718.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG058139"
FT                   /db_xref="HOGENOM:HBG203420"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI00003B69CD"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPS3"
FT                   /transl_table=1
FT                   /translation="MENLDETTGLLEQTPDTTEQDALEQEYHEHNLSLPKLPIVLSLWL
FT                   GSFLSSLDGTIVANIMNRVAEEFQESDKKQWIATSYLLTNTAFQPLYGKLSDLTGRKFA
FT                   VLTAHFFFGLGCLLTCFANSVTQFAIARAICGVGGGGINAMSSITVSDICTQRERGIYQ
FT                   GYANIVFGLGQILGAPIGGLFIDTLGWRILFGLQVPTILLCSSLVHKNVNIKLSHLLPV
FT                   EERFKWSNLSRIDILGSSTLVFTISGVLFLCSTELNKALLSIFTVISFIAFILIELYYS
FT                   KERIMPFELLKGSFGLASAATVISSFIIFGDIFRSPIYLQLIQGVSVTKTGFFMLFPSI
FT                   SVAVGSLATGWILRHTKMKLSHCAYWIVTIGMSIQLLGLVVAYYLIQNLEPSLSGSAIF
FT                   GAFVQIGQNISSQSYTWVVIYALALILVSFGYACLLVATLVNIVFTIPKSQQGTVTGIF
FT                   YLWRSIGNVLGASLTLVFYEKGVSSFLWNYMFNKQHDDYNFSKKEYRKLLSDTSYLRSG
FT                   HFPDGILFELLKVYRNSFLLSYLPNFILAIAGVAICGGLLVVSYAQD"
FT   CDS_pept        complement(129649..130476)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000754" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17437809"
FT                   /locus_tag="CAGL0J01397g"
FT                   /product="Similar to uniprot|Q04299 Saccharomyces
FT                   cerevisiae YMR087w"
FT                   /protein_id="CAG60719.1"
FT                   /db_xref="HOGENOM:HBG123710"
FT                   /db_xref="HOGENOM:HBG203419"
FT                   /db_xref="InterPro:IPR002589"
FT                   /db_xref="UniParc:UPI00003B69CE"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPS2"
FT                   /transl_table=1
FT                   /translation="MTRNNTKRKSMNQIRIVICDTNEVVARKLHQYVPKKLTLSQQAVC
FT                   THHGPLESLINSMRTDKKKHPGNKYAIVSPGNSFGYLGGGFDLALFNYFGGKPFESWFR
FT                   KELGNRYHTVGSATVIDLTRCPLNDINELRDGIQYIIHVPTVVAPTKPIYQESQKLKTG
FT                   YEPVFNAMWNSVMHAPHDVDGLIIPGLCTGYAGVPPDISCKSMAFALSLYMLQDKISVE
FT                   LRNALIMYFLGYPFKPFILESCLEECQALGLNIHSLESFNVEEDDIQQLLPKF"
FT   CDS_pept        complement(130812..133832)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17437810"
FT                   /locus_tag="CAGL0J01419g"
FT                   /product="Similar to uniprot|Q04279 Saccharomyces
FT                   cerevisiae YMR086w"
FT                   /protein_id="CAG60720.1"
FT                   /db_xref="HOGENOM:HBG123711"
FT                   /db_xref="UniParc:UPI00003B69CF"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPS1"
FT                   /transl_table=1
FT                   /translation="MFRSRNYNDQMRYANPNAVAAASALGNIMMPKQPQSQAQPQGAKR
FT                   APVRSSSMMNMRRGSLLRKPEEKKSTPSRTGSLVQRKPSITNQKRHSISSTPQSSAPNR
FT                   TSSLPTKRNSLVSRSGSFTRRMKNAQSTFNEFGPQASGVANVRNSGEQVVKMVTKYIPG
FT                   KNGLIAVQVPATTEQPRKTSSLTRRPGSMTSISNKNGPKRKISQQSLHSHSVQQSNPQK
FT                   PSKKKEVIDSSNPEDSFNRAVDKVDESVPLIETSMREETEQELLEQTVAIDESVIKADE
FT                   NPAGLQNLLEDNIVLEETMEEQKKDGKAPLENDATSNEKVNIEPLPEVAVDSTDIPAPL
FT                   EESERQETNIAPKEDSMKEEIEPEALDNTAKNITEFDSEQMKDNKTVTDSINELENIPG
FT                   TMDNEMQELKESIANDINSQLTTEEMIDEMEGSKTDMMTTDLNEKFSKAELSEQNLPDN
FT                   NDSPLLKQQKFEENKLKESIEAFGKGANEGNENNVLQDNVVGNDITLQHDIVTNIRSNE
FT                   TVSSPTDSEFVDSSSVMENDEQKENVENLASKNKSPNKQKPQNMAQYLRSANPYLTTGG
FT                   SATSAKKSPATSPKKQGSSGPIKSAMKKSSRPLSTTSSVYSDINSPADGAYLSLTTAEN
FT                   TRINAKLAVEEPIDWHPNADKSKRASMPVRSSSKLYKKTSNSQSQEKVGYNRSSRQYQG
FT                   PIQTPPNTTKTPGGVTKMGVVSAAALSSNNNAAAAEDKSNRQSLLKNRALEMAKQVNIT
FT                   PKKAKPVTPSVPSSTVTPPAVNPVLNAALYPKEPLQKKSSFEKLRNTDKNLGFKKLSLR
FT                   DSAFMDGADEQALVNAGSRNSMMNESPGQAPPKLATASTNSGWKSRFQDSDSDVEPVQA
FT                   NAAPVAPPRSEERVNGFSLFKKKSNTGGNTFLKPPQPDFSAGSEMGEKVSRTSSYNSSP
FT                   NKTLNNQYSKGSLRSSSMQTAGPGSTAKPNIFANIEETEKRIYSNPEVMRKDEHNDEGV
FT                   NHGFGKKLKKLFGRKKH"
FT   CDS_pept        complement(134383..135501)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000294685" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20195762"
FT                   /locus_tag="CAGL0J01441g"
FT                   /product="Strain CBS138 chromosome J complete sequence "
FT                   /function="oxidoreductase activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAG60721.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG454398"
FT                   /db_xref="HOGENOM:HBG753318"
FT                   /db_xref="InterPro:IPR002085"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI00003B69D0"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPS0"
FT                   /transl_table=1
FT                   /translation="MFTRVAAAARIQSRRPLRLRLQSTLSIPQSQKGVIFYEHGGKLEY
FT                   KDLPVPKPKPNEILINVRYSGVCHTDLHAWHGDWPLGAKLPLVGGHEGAGVVVAKGSSV
FT                   TNFEIGDYAGIKWLNGSCMSCEFCEQGNESNCAKADLSGYTHDGSFQQYATADAIQAAQ
FT                   IPKGTDLAQVAPILCAGVTVYKALKDSDVKPGQWVAISGAAGGLGSLAVQYAKAMGMRV
FT                   LGIDAGDEKRKLFESLGGNHFVDFTKTKDLVSEIQEITEGGPHGVINVSVSEKAIGQSV
FT                   EYVRPCGTVVLVGLPAGATVKSDVFNHVIKSINIKGSYVGNRADTREAIDFFAKGQVKS
FT                   PIKVVGLSELPEVYKLMEANKIIGRYVVDTSR"
FT   CDS_pept        136518..137273
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000001082" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17437811"
FT                   /locus_tag="CAGL0J01463g"
FT                   /product="Strain CBS138 chromosome J complete sequence "
FT                   /protein_id="CAG60722.1"
FT                   /db_xref="HOGENOM:HBG058172"
FT                   /db_xref="HOGENOM:HBG202312"
FT                   /db_xref="InterPro:IPR000420"
FT                   /db_xref="UniParc:UPI00003B69D1"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPR9"
FT                   /transl_table=1
FT                   /translation="MKFTHQFVLSLIALAKLVMADSQQFGIISIASGSDLQYASAFFDS
FT                   NNLVVGHQPNNQFALVVTDDGKLKSTSGNQFIAVDANSGNLKEVSDSNSASVGFSIKNG
FT                   HLLYLNSESFYAVPGASSGATWSLSTKNTNSAQGAAASPVVLRTQSTTGTDVVADFTPA
FT                   AMSSVSSVVPSSISSVHPSSLVSSGSTLVLSKASGSAVPISQIGDGQIQATATSHVPPV
FT                   QSHNGAIGQHGPYLGMHAGVAAAAIAYLL"
FT   CDS_pept        138326..139228
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000192906" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17437812"
FT                   /locus_tag="CAGL0J01485g"
FT                   /product="Similar to uniprot|P38747 Saccharomyces
FT                   cerevisiae YHL013c"
FT                   /protein_id="CAG60723.1"
FT                   /db_xref="HOGENOM:HBG069079"
FT                   /db_xref="HOGENOM:HBG397518"
FT                   /db_xref="InterPro:IPR003323"
FT                   /db_xref="UniParc:UPI00003B69D2"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPR8"
FT                   /transl_table=1
FT                   /translation="MDAREELLAKHRKEKRDLVNRITGMKKQATKAKRKEVNSKCEQLE
FT                   QELREKHEQELKELDGEGGDVEEVTPEQLLAQLQVEDDGAKEANEANEAKADKEAKVGP
FT                   SQQPKKKRNRQKEKLARREAEIARMKEEAKKEAAEQPDLKKIEQDAIWQLCQMKGLVPY
FT                   DIQPDGHCLFASILDQVKTRHGDPQTEMDVHTLRCLACDYILEHRDEFIPYLFDEATMS
FT                   LKDIDEYTEEMKSTAKWGGEVEILALSKALDCPISVLMSGQATHTVNETGSKPELKLVY
FT                   YKHTYALGEHYNSLRDSKI"
FT   CDS_pept        139697..143500
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248675" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20195763"
FT                   /locus_tag="CAGL0J01507g"
FT                   /product="Similar to uniprot|Q04264 Saccharomyces
FT                   cerevisiae YMR076c PDS5"
FT                   /function="binding"
FT                   /protein_id="CAG60724.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG059846"
FT                   /db_xref="HOGENOM:HBG203413"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI00003B69D3"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPR7"
FT                   /transl_table=1
FT                   /translation="MAMPGAVRKLQFSKPIISTLENTIAASELVGRLCNLHEELAQFVQ
FT                   DQVDLSSLDAVKGDLINHKLLKHKDLGVRAFTACCLSDILRLYAPEAPYTDGQLTDIFK
FT                   LVLSQFEYLGDPDNGYYVQQTYLITRLLEYRSIVLITDLPTSDKLLFRLFEIFYDDNHS
FT                   YQNKLFNVIGGLLGEVLSEFENMPLNVLKLIFNKFLTYNPEKAPKGLGVASNCGYEVSL
FT                   ILCENYTARMSRYLTKYYSEILYNITNEKNIDDSYEMRTKLIIATEKLHKLVYRLWETV
FT                   PDLILSVIGFVYHELSSENEIIRKLATRLVGKMISKNTMANFVQAHEDTFKAWMTKIAD
FT                   IDADVRVEWISCIPNILEVRSDISDDIGHGLAKTLIDSDARVRKLSVTVFDEVPVKAIW
FT                   ENVKNISVYKSLLQLTREKNREIRELCIHSVGRFYAESRRNIEKESYDTEIWSIVESIP
FT                   STLFNLYYINDAHINQWVDEIVFDYLLPFEDDDTKRVRELLSIVSKLDKKAFSSFIAFN
FT                   KRQVPSAVAMAKFVEFCEVLKQSEYEDDLDTIQKYNKTIDWLSSSMADPIKTADVLEAI
FT                   KELNMGRVFFLIKNCVRADVTYSTFRNSYNELLDKLGDDNLFKKNRVKNSTSVSPQDIA
FT                   HEIKALLLRSSPIIFNISNIGILLDNSVFENEAETSLKRKLVNEVSKISPTLFRDQLKN
FT                   LKDTIIYLEDFNSRQEQALATEALKTIYKISKSVEDNNTFDDKLFSSKLIEFALNGSPQ
FT                   LAKYATKMIALSPDSERELRGLVLKILPLDIDKDQNFTSHLAILMEVFRFTPHLLDDES
FT                   TNIVSYLIKNVLLSNYKIEEDKVEEGESLFEEHIAESNEHACLANKLFTLKLFTNKLRA
FT                   LSLHDDDDDLSKAFIEKTLKLYIYLIASGGELVSETSSSKPTPEAYQTILRLSAALQIL
FT                   KVARISSLNTFIKSTEICKLVNIVEDESLEVRRRFLDQLKDSLSCELISIKFLPLIFFT
FT                   AYEPDKELKASTKIWINYTCAKPSFKKGTLFERVLPRLIHAIAHHPDVIEGFQGTEEEV
FT                   IIALTTAVDYLVFYFDSVASQENFSLLYYLSERVKNYQDILDEDEESSANEDDSISRWK
FT                   PFQYIYVVGELSQIILLTIKERRSWQHIAYPGKLNLPSDLFKPFDSAESAQATFKNYLS
FT                   EKYAEKIKGNIVAKVGKLIHASQTQRQRSQKRLLDQEYREDTSPKKQRTKGSKTQRKDR
FT                   QNDGSDIESDEEIYRGGNVEANASGVRKSNRARKQVDYNEDD"
FT   CDS_pept        complement(143666..145681)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000066043" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17437813"
FT                   /locus_tag="CAGL0J01529g"
FT                   /product="Similar to uniprot|Q04779 Saccharomyces
FT                   cerevisiae YMR075w"
FT                   /function="zinc ion binding"
FT                   /protein_id="CAG60725.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG059847"
FT                   /db_xref="HOGENOM:HBG203412"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR001965"
FT                   /db_xref="InterPro:IPR011011"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR019786"
FT                   /db_xref="InterPro:IPR019787"
FT                   /db_xref="UniParc:UPI00003B69D4"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPR6"
FT                   /transl_table=1
FT                   /translation="MSGQSSNTSSKGSSVTPASDGKTINGLEKVKVKLEKVNERGRSRP
FT                   KRSSSQNVDYDLKKRKIITEDLNLGKKNGDQSEAGSTGNGTPTGSTNGPEFKAEDIIEY
FT                   NRKGEIVKVNEPPTIETVNGANGIPLSQFPPDKVKKEYLWNFKKSNSGQYLLSAAVAAK
FT                   SSKDNEEKPNFTERFEQLLLQAKATTEKERELTKPSHIRHQVKSSSKTEHVLVPKGINL
FT                   HNPHIKTKLKDTHAFDSKTKLISQNPVGQMNDIAMAKKKSSDGTTQEIENDDYCSACFQ
FT                   TGSFLCCDTCPKSFHFLCLNPPLDPDHLPEGDWSCPQCMVKLRYANNTQYLKAQKAYTA
FT                   QMPKGKRLFGKLLFSLQGTNPRQFNLPNFIKETFQSVKTGPRGQYSDDTIKEPLSDKPI
FT                   FNSPYGQSITKLDSYNLDSHIDQTTGKILTCYRCGVSRLGSWSHPEEARLLIKCDYCNT
FT                   RWHLDCVPEVPRASLKNLGSKWQCPLHSEPPNTTKFDDQSKIKKSRKLIKNQRYMEPLQ
FT                   SCGYRNEGNIEVALDEISALPPKNARNINVAYKPIPLLNESNFILDFEEKLRQVKENEF
FT                   RKSVSAQSKILEQLMCTLKKDEKEDIMTLLQFRFKKSKELKQLWDFSELTSKLNAKIQP
FT                   QNETKNEDIQALLALKKIIESKPKEEILRFLDLSDD"
FT   tRNA            complement(146404..146477)
FT                   /gene_name="tRNA-Val (AAC)"
FT   CDS_pept        151584..152618
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17437814"
FT                   /locus_tag="CAGL0J01595g"
FT                   /product="Strain CBS138 chromosome J complete sequence "
FT                   /function="nucleic acid binding"
FT                   /function="zinc ion binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAG60727.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG123714"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="UniParc:UPI00003B69D6"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPR4"
FT                   /transl_table=1
FT                   /translation="MLSICRIFCKLILTPCDFEVSIKPQKTLPIMIAMDDRYYNLENKF
FT                   VPVGLPAVSPSAQYYPADASRPQSNVQSPVYYVPQNQINYIQRPSVSYVPTMEDQQYTY
FT                   TTMAHPQQQMILPVRNASPIEVQQQQLQQQQLQQQQQQQQQQQQQQQQQQQQQQQQQQQ
FT                   QHPLVKLPPISAIIPPGNSSPVNTTGQVQTSDQARNYNPGFRQDVQIALNPKSLSAPTS
FT                   GRNSISINPLMYNPHQQQQLLALAGVSIPPTLMEHQLTDAMTKQEIKLTKRQLKKATTR
FT                   LRKQCPVCGKICSRPSTLKTHILIHTGDTPFKCTWKDCRKAFNVKSNLLRHLKSHEKNS
FT                   LNKK"
FT   tRNA            join(154247..154285,154311..154355)
FT                   /gene_name="tRNA-Leu (TAG)"
FT   CDS_pept        154646..155629
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000165726" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17437815"
FT                   /locus_tag="CAGL0J01661g"
FT                   /product="Similar to uniprot|Q12251 Saccharomyces
FT                   cerevisiae YPR011c"
FT                   /function="binding"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="mitochondrial inner membrane "
FT                   /protein_id="CAG60728.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0005743"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG541806"
FT                   /db_xref="HOGENOM:HBG735918"
FT                   /db_xref="InterPro:IPR001993"
FT                   /db_xref="InterPro:IPR002067"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="UniParc:UPI00003B69D7"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPR3"
FT                   /transl_table=1
FT                   /translation="MSEVILPAIEEENQLKNFLKQDTNVAFLAGGIAGAISRTVVSPFE
FT                   RVKILLQVQSSTTAYNKGLFDAIGQVYKEENIKGLFRGNGLNCIRVFPYSAVQFVVFEG
FT                   CKKHIFHVDTKGKGEQLNNWQRLFSGALCGGCSVVATYPLDLVRTRLSVQTANLSKLSK
FT                   SRASDIAKPPGVWKLLSKAYAEEGGIMGLYRGVWPTSLGIVPYVALNFAVYEQLKEFMP
FT                   SDENGNSSMRDSLYKLSMGAISGGVAQTITYPFDLLRRRFQVLAMGGNELGFHYNSVWD
FT                   ALVTIGKTEGFKGYYKGLTANLFKVVPSTAVSWLVYELTWDYMKRW"
FT   CDS_pept        156341..156556
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000072575" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19348980"
FT                   /locus_tag="CAGL0J01699g"
FT                   /product="Similarity"
FT                   /protein_id="CAR58039.1"
FT                   /db_xref="HOGENOM:HBG398740"
FT                   /db_xref="UniParc:UPI00017BD8A6"
FT                   /db_xref="UniProtKB/TrEMBL:B4UN23"
FT                   /transl_table=1
FT                   /translation="MRPAQLLMNAAKKSSGTKVPIELAPLFAAIGVALCSGTFFTYKKL
FT                   TYDDSLRLKSNPDMSGLDDVLKEAKE"
FT   tRNA            complement(157157..157229)
FT                   /gene_name="tRNA-Lys (CTT)"
FT   CDS_pept        complement(157842..160781)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17437816"
FT                   /locus_tag="CAGL0J01727g"
FT                   /product="Similarities with uniprot|P08640 Saccharomyces
FT                   cerevisiae YIR019c STA1"
FT                   /protein_id="CAG60730.1"
FT                   /db_xref="HOGENOM:HBG123716"
FT                   /db_xref="UniParc:UPI00003B69D9"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPR1"
FT                   /transl_table=1
FT                   /translation="MKALILAQLLALSFANAQNVYNTPTVLTGNQKFSDEVVINDGSAL
FT                   TLNDGSEYIFDGGFRGAQQCFMDINADKDSPFTLTFGSNAKEFDSSCAVTINNPNTGPD
FT                   TVQTINISPPVFKNSNKFILNLAHTSSDANSKIIIGSPDITNTGEINYISTGGEIHDPN
FT                   ELGNVLQIGTPSGSIQNVGTISLNAANSYYLFGKVSGKGGKINVEKGVLQIDSASFTDN
FT                   VIHLSPGGAISLRRPPAEEVNVSGLGTATAISSIGKDGKFEYDSKTGLLSITTSEGVYK
FT                   YNIGCGYNPELASAQEIKIYFQDTLYDTFSFEIQQAPPTDSKCEDIPPIEPSSVKPSSM
FT                   NPSSVNPSSMNPSSMNPSSMNPSSMNPSSMNPSSMNPSSPSSINPSSMNPSSPSSMNPP
FT                   FANSSSMNPSSMNPSSMNPSSPSSMNPSSINPSSMNPSSINPSSMNPSSMNPSSVNPSS
FT                   MNPSSVNPSSVNPSSMNPSSMNPSSMNPSSMNPSSVNPSSMNPSSPSSMNPSSMNPSSP
FT                   SSMNPSSPSSMNPSSPSSMNPSSPSSMNPSSPSSMNPSSPSSMNPSSPSSMNPPFANSS
FT                   SMNPSSVNPSSMNPSSMNPSSMNPSSMNPSSMNPSSMNPSSMNPSSMNPSSMNPSSMNP
FT                   SSMNPSSPSSMNPSSINPSSMNPSSMNPSSVNPSSVNPSVEPSILKPSNVNPSSFDSSS
FT                   MNPSSVNPSSVNPSSMSPSSVNPSSVKPSSVKPSSDKPSNANPSSVKPSSINPSVEPSI
FT                   LKPSNVNPSSFNSSGINPSSVNPSSVKPSVHPSVKPSSEKPSNVNPTSVKPSSASPSSA
FT                   HPSNISSKPTVSVSVSSVSNKPASDVLSSNKYVSSGSVVVSASRVISSRSPSSIVLGNG
FT                   GGLVVSSQRPGSVQNSVRPSASPSSVRQGSAQPAANASTKTVSGTQASRAPSGVNSVSQ
FT                   VRVSSNSASGVVNSRAPTVVSSTFRGSAVMLHVYGIELVLPVLAALLFI"
FT   tRNA            complement(163678..163750)
FT                   /gene_name="tRNA-Lys (CTT)"
FT   CDS_pept        complement(164808..172073)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17437817"
FT                   /locus_tag="CAGL0J01774g"
FT                   /product="Similarity"
FT                   /protein_id="CAR58040.1"
FT                   /db_xref="UniParc:UPI00017BD8A7"
FT                   /db_xref="UniProtKB/TrEMBL:B4UN24"
FT                   /transl_table=1
FT                   /translation="MLCYTPLFLSSFLYIQGVFAQAKNYEGNQDLKNELVIQNGDTISY
FT                   VDGSEYNFGGGIVSSQEGCTFRAVANDKSDFDFNVGKEFVNYCNFELINKNLDGFKQTI
FT                   NFSPAVFKNYYQVDIQLAHTRSDAVSKLILGSPEIINAGKLTVRPYSAVEQNDPSREGN
FT                   ILQISTPGGRLVNTGTIELSLGVKYYLYGDVSGTGNINIARGILHMETTSFVGNTINLG
FT                   GISGISVKSTSSNIIKVRGLISGNLISSIGDNGSFTYNNQTGIVTVNTDSGRYVYDIGC
FT                   GYDETTLGSTTGYIVYHGESLKTFVIATSLETAPDYQKCYIPGQHENHDSGSGSTPGEG
FT                   SGSGSGSGSGSGSTPGEGSGSGSGTGSGSGSGSGSGSEGGSGSGSGSGSGSTPGEGSGS
FT                   GSGTGSGSGSGTEGGSGSGSGSGSGSTPGEGSGSGSGSGTGSGSGSGSGSGSEGGSGSG
FT                   SGSRSGSTPGEGSGSGSGSGSGSGSTPGEGSGSGSGSGSGSGSGSTPGEGSGSGSGTGS
FT                   GSGSGSGSGSEGGSGSGSGSGSGSTPGEGSGSGSGSGSGTGSGSGSGSGSGSEGGSGSG
FT                   SGSGSGSTPGEGSGSGSGSGSGSTPGEGSGSGSGTGSGSGSGSGSGSEGGSGSGSGSGS
FT                   GSTPGEGSGSGSGSGSGSTPGEGSGSGSGSGTGSGSGSTPGEGSGSGSGSGSGSGSTPG
FT                   EGSGSGSGTGSGSGSGSGSGSEGGSGSGSGSGSGSTPGEGSGSGSGSGTGSGSGSTPGE
FT                   GSGSGSGSGSGSTPGEGSGSGSGSGSGSTPGEGSGSGSGSGTGSGSGSGSGSGSEGGSG
FT                   SGSGSGSGSTPGEGSGSGSGTGSGSGSGSGSTPGEGSGSGSGSGSGSTPGEGSGSGSGS
FT                   GSGSGSTPGEGSGSGSGTGSGSGSGSGSGSEGGSGSGSGSGSGSTPGEGSGSGSGSGTG
FT                   SGSGSTPGEGSGSGSGTGSGSGSGSGCGSEGGSGSGSGSGSGSTPGEGSGSGSGTGSGS
FT                   GSGSGSGSEGGSGSGSGSGSGSTPGEGSGSGSGSGTGSGSGSTPGEGSGSGSGTGSGSG
FT                   SGSGSGSEGGSGSGSGSGSGSTPGEGSGSGSGSGSGSGSTPGEGSGSGSGSGSGSGSGS
FT                   TPGEGSGSGSGSGTGSGSGSTPGEGSGSGSGSGSGSGSTPGEGSGSGSGTGSGSGSGSG
FT                   SGSEGGSGSGSGSGSGSTPGEGSGSGSGSGTGSGSGSTPGEGSGSGSGSGTGSGSGSGS
FT                   GSGSEGGSGSGSGSGSGSTPGEGSGSGSGSGSGSGSASGEGSGSGSGTGSGSGSGSGSA
FT                   SGEGSGSGSGSGSGSTSGEGSGSGSGSGSGSAPGEGSGSGSGSGSGSGSTPGEGSGSGS
FT                   GSGSGSTPGEGSGSGSGTGSGSGSGSGSGSEGGSGSGSGSGSGSTPGEGSGSGSGSGSG
FT                   SGSGSTPGEGSGSGSGSGTGSGSGSTPGEGSGSGSGSGSGTGSGSGSGSGSTPGEGSGS
FT                   GSGSGSGSTPGEGSGSGSGTGSGSGSTPGEGSGSGSGTGSGSGSGSGSGSEGGSGSGSG
FT                   SGSGSTPGEGSGSGSGSGTGSGSGSTPGEGSGSGSGTGSGSGSGSGSTPGEGSGSGSGS
FT                   GSGSTPGEGSGSGSGTGSGSGSGSGSGSEGGSGSGSGSGSGSTPGEGSGSGSGSGSGST
FT                   PGEGSGSGSGSGSGSGSGSTPGEGSGSGSGSGSGTGSGSGSGSGSGSEGGSGSGSGSGS
FT                   GSGSGSGSGSGSEGGSGSNPGTGEGGSGSEGGSGEGGSGSEGGSGEGGSGGSNPVDDGK
FT                   DKTTVVTDKDGHVHTDIISHITTTDKDGKPTVILTQYQSPTPSPGEGGSGSNPGAGEGG
FT                   SGSEGGSGEGGSGSEGGSGEGGSGGSNPVDDGKDKTTVVTDKDGHVHTDIISHITTTDK
FT                   DGKPTVILTQYQSPTPSPGEGGSGSNPGAGEGGSGSEGGSGEGGSGGSNPVDDGKDKTT
FT                   VVTDKDGHVHTDIISHITTTDKDGKPTVILTQYQSPTAAQDGTSKTITVDGEEIIEVVH
FT                   ITTYTDSDGHTITSTYTEMFKTLIDAEPQYVSETTQTITTTDAEGHTTTITTTYNIDNN
FT                   GNAVPIVPSSSSMSSSSSSSMSSSSSSSMSSSSSSSMSSSSSSSMSSSSSSSMPSSSSI
FT                   ISSSIFSSVSTPSGQDYTITTTGSDGKIETNVVSHITTTVNGKPTTITTTVPCDVSAEK
FT                   DRTTTVTHSNGVIETNVVSHITTTVNGKPTTIITTGSFDVGAGKDRITTITHSNGVIET
FT                   NVVSHITTVDTKGNPTTIVTTTTKFNNAHTTTFSNKNGSVDTKTVVGVTTTNQFGQQII
FT                   TSLTFTGSEAHSNNNVHTSAGPNDAAGTSPAGTNNPQTKPTGNAGSTARLSDTTPAPNA
FT                   GSNGSSPAAADAESAVAPKAPASNSAAVPQQSGASSTSHGSAAPTIPQINKNAASSFKQ
FT                   NNFGVIILFALLFTML"
FT   CDS_pept        complement(173901..177152)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17437818"
FT                   /locus_tag="CAGL0J01800g"
FT                   /product="Similarity"
FT                   /protein_id="CAR58041.1"
FT                   /db_xref="UniParc:UPI00017BD8AD"
FT                   /db_xref="UniProtKB/TrEMBL:B4UN25"
FT                   /transl_table=1
FT                   /translation="MKLILLIQLWWLTLVNTKSIYPGPTVLTGNQIFEDEVIIDNGGGL
FT                   VLNDGSEYIFNGGYHGGKQCSIDINAAKGLPFTLTTSSDAKLFENGCVFKIRNANTGAK
FT                   TIQSINFSPIEFKNTNKFILELGHTNSDASSRLILGSPEIVNSGEISYISTGVEIGDSN
FT                   NEGNLLKIGRPTGSINNTGKISFDAASKYYLFGKVFGLGGSISVHRGTLYVDSLSFSNI
FT                   IYLGSNTAVAFKNSISAPITVRGLETSSAISSAGSDGKFNYNDKTGLLVVTTSEGSFIY
FT                   NIGCGYKSELILTSQTKTWYQGKLYDYFSVTFHQVPPTNTICVESSKEFRRVKSTLLDK
FT                   YGDIKGWDIMNLFKRDGENVSPANAPANAPANPPANAQPDVNALANAPANPPANAPANP
FT                   PANAPANAPANPPANAPVNAPANPPANAQPDVNAPANAPANAPANPPANAPANPPENPP
FT                   ANAPANPPANAPANAPANAPANAQPDVNAPANPPANPPANAPANPPANAQPDVDTPVNA
FT                   APNGPAKNGTYVGPQPKPNKPSQEEPNANSPAAGPANPQPQGNTPPVVQPANNDTSSNP
FT                   QPKPDVNSNANSNANSNANSNANSPAAGPANPQPQGNTPPVVQPANNDTSSNPQPKPDV
FT                   NSNANSNANSPAAGPANPQPQGNTPPVVQPANNDTSSNPQPKPDVNSNANSNANSPAAG
FT                   PANPQPQGNTPPVVQPANNDTSNNPQPKPNSPLGKPPHVDTSTPSVNFQQPSVYSPTAK
FT                   PSVINRFANSSSVVHPGIQPSNINSIGSQDIAGSSNGLSSKNSIAIGSPLAVLSPTEEP
FT                   SISQRVVINPALSSSVKLSSSPQAYMNSSSTVSSSSKSSVETSNNRNSDNGYAKPSKVN
FT                   SGIHLNPSSHNIDDSSKSASASPKSSKPSSASSNVSKPNPSGDNRVSTINSKKGNGLSS
FT                   KATPSPKPNVNSSQGGKAGPGNGHSSNNVSKENEKPSTVKSNSGKSNTVKPTSGKSNTG
FT                   KSEAQKPSTKTLSGSASQPKANQGPGGTQPTKGPSPGSNPAQQVNGGSLSGSNIIPINS
FT                   RIPTILSSTFRGNAAMLSIQGIELVLPALVALLFL"
FT   tRNA            complement(179238..179310)
FT                   /gene_name="tRNA-Lys (CTT)"
FT   CDS_pept        179922..183530
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000222963" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17437819"
FT                   /locus_tag="CAGL0J01848g"
FT                   /product="Similar to uniprot|P22138 Saccharomyces
FT                   cerevisiae YPR010c RPA135"
FT                   /function="DNA binding"
FT                   /function="DNA-directed RNA polymerase activity "
FT                   /function="ribonucleoside binding"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG60734.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003899"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0032549"
FT                   /db_xref="HOGENOM:HBG049456"
FT                   /db_xref="HOGENOM:HBG631122"
FT                   /db_xref="InterPro:IPR007120"
FT                   /db_xref="InterPro:IPR007121"
FT                   /db_xref="InterPro:IPR007641"
FT                   /db_xref="InterPro:IPR007642"
FT                   /db_xref="InterPro:IPR007644"
FT                   /db_xref="InterPro:IPR007645"
FT                   /db_xref="InterPro:IPR007647"
FT                   /db_xref="InterPro:IPR009674"
FT                   /db_xref="InterPro:IPR015712"
FT                   /db_xref="UniParc:UPI00003B69DB"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPQ9"
FT                   /transl_table=1
FT                   /translation="MSKVIKPPSNARTAHFRTLERENRFKNPPKDKSAYPLLQEAVQPH
FT                   VGSFNALTEGPDGGLLQRAVEDIGEKVIFDGKSDGSDEISDYLGNKLSISVEQVSIAKP
FT                   TANDGVMGAAERPVYPSEARQRLTSYRGKILLKLKWSVNDGENVFSEVRDCGGLPIMLQ
FT                   SNRCHLNKMSPHELVQHKEESDELGGYFIINGIEKLIRMLIVQRRNHPMAIIRPSFANR
FT                   GASYSQYGIQIRSVRPDQTSQTNVLHYLNDGQVTFRFSWRKNEYLIPVVMIMKALVDTS
FT                   DREIFDGIIGSNTNNSFLTDRLELLLRGFKKRYPQLKNRTQVLQYLGDKFRLVFQASPD
FT                   KSDYEVGQEVLNRIVLVHLGSNGNMDKFRMLLFMVRKLYSLVAGECCPDNPDATQHQEV
FT                   LLGGFLYGMILKEKIDEYLQGIVAQVRTDINRGVAINFNEKKYMSRVLMRVNDNIGSKM
FT                   QYFLSTGNLVSQSGLDLQQVSGYTVVAEKINFYRFISHFRMVHRGSFFAQLKTTTVRKL
FT                   LPESWGFLCPVHTPDGSPCGLLNHFAHKCRISTTQSDVSKVPELLYSLGVTPASHTFAA
FT                   GPSLCCVQLDGKIIGWTSHEQGRVIADTLRFWKVEGETPGLPKDLEIGYVPPSSKGQYP
FT                   GLYIFGGHSRMMRPVRYLPLDKEDIVGPFEQVYMNIAVTPQEIQNNIHTHVEFSPTNIL
FT                   SILANLTPFSDFNQSPRNMYQCQMGKQTMGTPGVALCHRSDNKLYRLQTGQTPIVKANL
FT                   YDDYGMDNFPNGTNAVVAVISYTGYDMDDAMIINKSADERGFGYGTMYKVEKVDLSLNR
FT                   SRGDPVTQHFGFGTDEWPKEWLDKLDEDGLPYIGTYVEEGDPICAYFDDTIGKTKIKTY
FT                   HSSEPAYIEEVNLIGDESNKFQELQTVSIKYRIRRTPQIGDKFSSRHGQKGVCSRKWPT
FT                   IDMPFSETGIQPDVIINPHAFPSRMTIGMFVESLAGKAGALHGIAQDSTPWIFNEQDTP
FT                   ADYFGEQLLKAGYNYHGNEPMYSGATGEELRCDIYIGVVYYQRLRHMVNDKFQVRSTGP
FT                   VNSLTMQPVKGRKRHGGIRVGEMERDALIGHGTSFLLQDRLLNSSDYTQAAICRECGSI
FT                   LTTQQTVPRIGAVSSVCCRRCAVKFEDAKKTLFEHEEKTEEKIFIDDSQIWEDGQGQKF
FT                   VGGNDTTTVAIPFVLKYLDSELSAMGIRLRYNVDPK"
FT   CDS_pept        184269..187109
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000265621" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19348981"
FT                   /locus_tag="CAGL0J01870g"
FT                   /product="Strain CBS138 chromosome J complete sequence "
FT                   /function="ATP binding"
FT                   /function="calcium-transporting ATPase activity "
FT                   /biological_process="ATP biosynthetic process"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAG60735.1"
FT                   /db_xref="GO:0005388"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006754"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG456486"
FT                   /db_xref="HOGENOM:HBG491941"
FT                   /db_xref="InterPro:IPR000695"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR004014"
FT                   /db_xref="InterPro:IPR005834"
FT                   /db_xref="InterPro:IPR006068"
FT                   /db_xref="InterPro:IPR006408"
FT                   /db_xref="InterPro:IPR006413"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniParc:UPI00003B69DC"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPQ8"
FT                   /transl_table=1
FT                   /translation="MVESYVMKAVEESVDDSVEETHEMLPSAPVLDEEAYELLNRPNPS
FT                   LKFCTLSVGETVENLETDVDNGLSSEEEVVKRREIHGRNDFEEDDDESMIKKFLMSFVE
FT                   DRLILLLIGSAVLSFAIGQIDDAVSISLAILIVVTVGFIQEYRSEKSLEALNKLVPTKC
FT                   HLIRYGRESNTLASELVPGDLVRFKIGDRIPADVRIIEAVDLSIDESNLTGETEPLHKD
FT                   AQTIDPEEYDNRNVPVSERSCIAYMGTLVKEGHGKGIVIGTGTNTSYGAIFEMVNSIEK
FT                   PKTPLQETMDRLGTELSYISFFIIAIISIVGIIRGNSLLMMFQVSVSLAVAAIPEGLPI
FT                   IVTVTLALGVLRMTKQNAIVRRLPSVETLGSVNVICTDKTGTLTTNHMTVSKLFCLDSS
FT                   GTYENAISPEEDSEFDVHDNDVKETLTIANICNNAKYSEEHNLYIGNPTDVALIEVLTK
FT                   FGIPDQRDSHEKMEELSFNSKRKYMAIKSSKESGEHVLYIKGAFERILDKSSYYLDKAG
FT                   EVREFDEHSKVMVLEAAHSCASDGLRTIACAFKPTDSDNVISEDDINGLTFTGLFGLAD
FT                   PPRPNVKASIEKLHRGGVHIIMITGDSVNTAVSIAEKIGLSVQDRESSVMTGDKVSELT
FT                   EDELSKVIDKVNIFARATPENKLNIVKALRKRGDIVAMTGDGVNDAPALKLADIGIAMG
FT                   ISGTDVAKEVSDMILTDDDFSSILTAIEEGKGIFNNIRNFLTFQLSISVATLSLIAITT
FT                   IAKLPAPLNPMQILWINIIMDGPPAQSLGVEPVDSDVMDKPPRSREERILNMNILLRLL
FT                   YLAICILVGTFYIFLKGMDENQQTTSKDITMTFTGFVFFAIFNAVACRHTTKSIFQIGL
FT                   FSNRIFNIAILLSVCGQMCAVYIPFFQHIFKTENLGFYDLLTLVLVSSSVLIVDEIRKA
FT                   IYALARVNEPVYSSEV"
FT   CDS_pept        187614..191738
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000115437" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17437820"
FT                   /gene_name="PAN1"
FT                   /locus_tag="CAGL0J01892g"
FT                   /product="Actin cytoskeleton-regulatory complex protein
FT                   PAN1"
FT                   /function="actin binding"
FT                   /function="calcium ion binding"
FT                   /biological_process="endocytosis"
FT                   /cellular_component="actin cortical patch"
FT                   /cellular_component="endosome membrane"
FT                   /cellular_component="plasma membrane"
FT                   /protein_id="CAG60736.1"
FT                   /db_xref="GO:0003779"
FT                   /db_xref="GO:0005509"
FT                   /db_xref="GO:0005886"
FT                   /db_xref="GO:0006897"
FT                   /db_xref="GO:0010008"
FT                   /db_xref="GO:0030479"
FT                   /db_xref="HOGENOM:HBG103920"
FT                   /db_xref="HOGENOM:HBG123720"
FT                   /db_xref="HSSP:1FI6"
FT                   /db_xref="InterPro:IPR000261"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR013182"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="InterPro:IPR018249"
FT                   /db_xref="UniParc:UPI00003B69DD"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FPQ7"
FT                   /transl_table=1
FT                   /translation="MYQYSNQTGNGVYGNPPMQPLQNYGSSGYQQTAPMQQPLQTGYQQ
FT                   PMQQTMNQNQGMQLPQQQYQQQQPLQQQPMQQQPMQQQSFQQPQLQQPLQQQPTQTGMQ
FT                   QQPLQQQLTQSGMLQQPLQPQMQQSSQTIQPNQLNVQNTVQSQQSVQPLLPQQTGFYRQ
FT                   GNQPVLEPLKPTATGFVNSFANNGLDNNLKIPAIRLSFITAQDQAKFETLFRSIVTKGS
FT                   NTVSGENCRAILMKSGLQPSQLARIWQLSDTNRAGELLFPEFALAMHLINNVLQGDSIP
FT                   YELDSKTKNEVSSFIDAINLSVVSTESDFKTPFDDLFKPQQSLQPQGTGFLPQTSFGLP
FT                   AQPTGGFGQPQPTTFGQLQAQVTGGFGQPQPTTFGLQPQTTGGFVQAQQVTGGIAQQPS
FT                   MNPLTQQGTGFAQNQQGTGGFLQQQGTGSFNNAGFVQPQNTGSFVPQQQQQPVVQSQPI
FT                   APQSTGGFGPPMPTTFGIQPQSTGGFVQPQVTGGLQPALTGNIPQTSFGAQPFNQQLQP
FT                   QATGYLPPSQFSATMPLTAQKTGFGNNEIYAQSNFNGPSFSTQESDIITSEEKSLFYKI
FT                   FETFSQNRGVLDSATAVEIFRKSGLNRSDLEKIWNLCDINNTGQLNKQEFALGMHLVYG
FT                   RLNGRSIPDRLPPSLIPSSTKILDNVKNQLISSSSDGNRKSFTRMDALSYKNDDNDKLP
FT                   NFRNRRKNYPTDNDADKERQRRQEREREEAAKKKEQERKTKMDIERARKQGSFTNSEPE
FT                   FTDVSVSEIEDIKRRITEAQQKLAVRNQSIPNDLKKRFNEVVARLPTLFVEIYKVDTEI
FT                   MQARIELCKRRTPSSIIGTGPGGSITEDDRRKAKSKALLRSRMNALTGKGDNSDEPDIE
FT                   SESFTKEIEKIQSESAQNKKIIKDIRISISELSAPIRSIMTGSLPTCSSTDFEKWEIGV
FT                   GLENDVREFVLTLKKGLLYVSEPSHMNSNQTLSHPPAAALKKEATGEDRAAQLKEQAQK
FT                   RMKERLAKFGISRRETRDLESSKQQESGSTPDAVPAAQTANASQTPFEEVISSPQKMEV
FT                   TSTAGEDNEEEDEEERKLKEQLELLKQKKNAEKEKRLADLRRQIEEAEKEEEHPSVAQS
FT                   NSGNVQSSSNQPASVPVANSQPQNLQNTHITTKPLSLNQTGSSYDMASNTYFKPTQTSQ
FT                   SAFDREKAEQQRKIQRGLESDDDGWSDDDDDLYSKPNTAPQTAPVLDSSNTPQPGMNAS
FT                   VPAPIAPPIPTPQASSPAVPVAPPIPAVTPSESSIPMTSNADVAGADHLDQDTDISGAA
FT                   ASADKQNTSHVSHIPPVPVAPPLPQVSSIAPPPPLPNLSVPQPHETVDNDDGSDVLSIP
FT                   DSVESDKEDLAPAGHTPAAMGIPPPPPLPNF"
FT   CDS_pept        complement(191912..192421)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000174091" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17437821"
FT                   /locus_tag="CAGL0J01914g"
FT                   /product="Similar to uniprot|P40565 Saccharomyces
FT                   cerevisiae YIR005w IST3"
FT                   /function="nucleic acid binding"
FT                   /function="nucleotide binding"
FT                   /protein_id="CAG60737.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="HOGENOM:HBG245628"
FT                   /db_xref="HOGENOM:HBG398346"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniParc:UPI00003B69DE"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPQ6"
FT                   /transl_table=1
FT                   /translation="MNQIKAIQRINEKELEAGILKPEHSWHQEYKDQAYIFIGGLNRQL
FT                   TEGDLLTIFSQYGVPVDVLLVRDKETHESKGFAFLKYEDQRSTILAVDNLNGITVAGRQ
FT                   IKVDHIFFTPRDDIPEYTEAVREFLSKDKIDIHKDHLSTDNIQKETKYTNNEEDELNDP
FT                   MASYSR"
FT   CDS_pept        complement(192784..194061)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000186929" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17437822"
FT                   /locus_tag="CAGL0J01936g"
FT                   /product="Similar to uniprot|P40564 Saccharomyces
FT                   cerevisiae YIR004w DJP1"
FT                   /function="heat shock protein binding"
FT                   /function="unfolded protein binding"
FT                   /biological_process="protein folding"
FT                   /protein_id="CAG60738.1"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="GO:0031072"
FT                   /db_xref="GO:0051082"
FT                   /db_xref="HOGENOM:HBG336641"
FT                   /db_xref="HOGENOM:HBG447731"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR003095"
FT                   /db_xref="InterPro:IPR015609"
FT                   /db_xref="UniParc:UPI00003B69DF"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPQ5"
FT                   /transl_table=1
FT                   /translation="MVVDSTYYDLLGIGPTATAVEIKKAYRKKSIQEHPDKNPNDPTAT
FT                   ERFQAISEAYQVLSSEELRAKYDKFGKQEAIPKGGFEDAAEQFSAIFGGEAFASYIGEL
FT                   TLLKNLQKTEELNAEDEAQKQKEAEEAQKRKEKEEEMKKNGHVQGSGQDITVHPDPEGT
FT                   KPKDDAVNQKKKTKLEEFEEQQKIEREKRIEELSKTLIERLSILTESVYDDACKNSFQK
FT                   KFEEEANMLKMESFGVDILHTIGDIYCEKAKIFLASQNLFGFGGIFHSVKAKGGVLMDT
FT                   LRTVSAAIDAQNTMKELEKMKEASTEDTEENSKNQQKTETETTTAPKPKPTAEELAQQE
FT                   QLLMGKVLSAAWHGTKFEMTSTLRSVCDKVLDDQKIDLNTRIKRAEALRLLGKVFQKTY
FT                   RTKSEQEEAQIFEELVAEATKKHRNT"
FT   CDS_pept        complement(194396..196501)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21044610"
FT                   /gene_name="AIM21"
FT                   /locus_tag="CAGL0J01958g"
FT                   /product="Altered inheritance of mitochondria protein 21 "
FT                   /cellular_component="actin cortical patch"
FT                   /protein_id="CAG60739.1"
FT                   /db_xref="GO:0030479"
FT                   /db_xref="HOGENOM:HBG123721"
FT                   /db_xref="InterPro:IPR021582"
FT                   /db_xref="UniParc:UPI00003B69E0"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FPQ4"
FT                   /transl_table=1
FT                   /translation="MIPAIPARPQRKKGDSAEDSPVPEVPQRPMRHSTTEEIADLVSNT
FT                   TKELEEMEQLISHGHKGEEPVVPQRRPKVVKAKEHENKQVVDTPEMPSIPQRPRRKQTS
FT                   ESLESVSVADGQGSKATEEMTATDSPMEDKDTNMVENTADVSKAKESTELNVPGGTEET
FT                   FTTEDPLPATTGSHPEAIKEISDELNEVVAGTEKPIEHTISNDKEETTLMKTSEQRDEE
FT                   MKETKSNRASEKLSDNTSENETVKTSDFVAKTAEKTAEMVSPQESRDEIEKSVAKTDEE
FT                   TDDKQIEEQKIESIEESIPESIEVPMKKSTEEPEKEPVEDSSEILVKGQTEEPSEKSVS
FT                   SSPDQSNDAPKTSTESANEIQRKSQEPTTETTSETSEKSTKDSTEPSEKVSQDRSDQNE
FT                   TADGEETKPHVPESRPKKRGPPPVPKKPSSRIAAFQEMLQKQQEAQFEKSQKKGEQNDG
FT                   AMNSDARTKFANNLNGLFALPGMVPGGPPPPALAKVLKDPQDTANDKTSTSNDQDTGSG
FT                   TNLKDVRHGRARGPRGRKLPTKVATTEKVKVSETGNTIEIFSAWKLSIKGQVVHDADDD
FT                   IDCRDQDNYVETEEQNMEEQEEREMEKELMASESTVEEEETVEQEKTVEEEKPVKEELT
FT                   VKEEQTKSAEPVLVNVPTGTSSDILDNEPTKTTLDVQEPSPEQKLDTEAREESGTLPTE
FT                   AEPLDNE"
FT   CDS_pept        196812..199970
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000066122" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17437823"
FT                   /gene_name="MPH1"
FT                   /locus_tag="CAGL0J01980g"
FT                   /product="ATP-dependent DNA helicase MPH1 "
FT                   /EC_number="3.6.4.12"
FT                   /function="ATP binding"
FT                   /function="ATP-dependent helicase activity"
FT                   /function="DNA binding"
FT                   /biological_process="DNA repair"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG60740.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006281"
FT                   /db_xref="GO:0008026"
FT                   /db_xref="HOGENOM:HBG058697"
FT                   /db_xref="HOGENOM:HBG448053"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="UniParc:UPI00003B69E1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FPQ3"
FT                   /transl_table=1
FT                   /translation="MEDSDFDDAELDELYEKAINRRVNETLIRRSLPVQRDLQNGVVPG
FT                   QDTYYEEIRTEVTFGPTHHQLNEELLHSYIYPTNFEVRDYQFDIVRKGLLQNILCAIPT
FT                   GMGKTFIASTVMLNFFRWTKTAKIIFTAPTRPLVAQQIKACLGITGIPHDQTAILLDKT
FT                   RKNREEIWANKRVFFTTPQVVENDLKRGVLNPKDIVCLVIDEAHRATGSYAYANLVKFI
FT                   NRFNSSYRLLALTATPATDIEGVQEVVNNLNISKIEIRTEESMDIVKYMKKKIKDRVNI
FT                   QTTVEIENIVEQLGIAILPVLNQAVELGIYESCPPSAINAFKAMQKSQAIIMNPSIPEG
FT                   IKWRNYFILQLLNHVGQMLKRIKIYGIRTFFSYFQNKVKEFTTKYDLGKSTNKIAAGFY
FT                   YHPMIQAITKECEEKIKDPNFLGHGKLEHLRDELTQFFYENPFESRVIIFTELRESALE
FT                   IVKCIDSMENSEIRPHIFIGQAKGKEGFDEVKFVRKHGPKGRKKSDREKRLEEERRMDE
FT                   EKKQAALQEKLERTSRRTGSSEEAQLSGMNQKQQKEVIKKFKSGLYNVLVCTSIGEEGL
FT                   DIGEVDLIICYDTTSSPIKNIQRMGRTGRKRDGRIVLMFSSNEASKFDQSMNDYYNLQK
FT                   LISQHLVQYRKSDRILPPENQEPECEKKFIEVSEEDQELNNMEDTDDVIRFATQCMLGK
FT                   IPKTKKGRDKGKAKKGKTFFMPDNVITGIITANNLVRKRKSAQNGSGAALLDSIVNDDI
FT                   DLEDEDGQVEILDVDQEVNRRLASNAVQKTNDMALQIRNEETPEIGDTRNKAKASSSMK
FT                   VKKEPTMAVDHSDDEEDLPLSRHVERASRETAKEVPNATNVAEKPFPPLEFGVQRPSKR
FT                   QRLQPEVQPEVQPEVQPEVQPEVQPEVQPEVTVKPEVKIKTEEGSKLYKNIFFSDEGFL
FT                   QPHEKELFLSKYNPEDATVTIEPVPRFVRAHGRVKHSKRTEQLITLFEDMNHNRVARTI
FT                   EMNKLRGIARRLHTVSQSQGQSNSQSQAHSTSQKSQQASQKDRSSQDKDLTNSELEDLL
FT                   DSDF"
FT   ncRNA           200163..200405
FT                   /ncRNA_class="snRNA"
FT                   /gene_name="SNR14"
FT                   /locus_tag="CAGL0J01994r"
FT                   /product="U4 RNA"
FT   CDS_pept        200829..201914
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000188210" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18501139"
FT                   /locus_tag="CAGL0J02002g"
FT                   /product="Strain CBS138 chromosome J complete sequence "
FT                   /function="binding"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="mitochondrial inner membrane "
FT                   /protein_id="CAG60741.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0005743"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG541806"
FT                   /db_xref="HOGENOM:HBG735918"
FT                   /db_xref="InterPro:IPR001993"
FT                   /db_xref="InterPro:IPR002067"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="UniParc:UPI00003B69E2"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPQ2"
FT                   /transl_table=1
FT                   /translation="MGQDEFYREKSHPEEICFPDSASPLTSTDVIEPFRGDTIDNKMEA
FT                   YKGLVQEVPRVRNTLFGFTLNDNRINAISGALAGLLSGIVVCPLDVAKTRLQAQGLQTR
FT                   TTENLYYRGSIGTMTTIVRDEGVRGLYKGLVPIIMGYFPTWMIYFSVYEFCKDNLRTNS
FT                   SNWSFVSHSFSAITAGAVSTVVTNPIWVVKTRLMLQTHIGSNTTHYQGTYDAFKKIINQ
FT                   EGVKALYAGLVPSLLGLLHVAIHFPVYERLKVSFKCYQRDESSNESKINLKRLILASSV
FT                   SKMVASVLSYPHEILRTRLQLKSDLPSHQRRLIPLIKITYIQEGIFGFYSGFGTNLFRT
FT                   LPASAITLVSFEYVRNFLNKI"
FT   CDS_pept        complement(203412..204836)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18501140"
FT                   /locus_tag="CAGL0J02024g"
FT                   /product="Similarity"
FT                   /protein_id="CAG60742.1"
FT                   /db_xref="HOGENOM:HBG123722"
FT                   /db_xref="UniParc:UPI00003B69E3"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPQ1"
FT                   /transl_table=1
FT                   /translation="MINNFNFSAGSRWTSFTKKFRNVKESLTSFSVFKWKRSDKLNKFK
FT                   HWFHNGAFSSKSIDVTRNIYEKPVDYSEVIEIVYGPNATLEDYEFDMEVVSNSFCSMNN
FT                   IASRIPSWEDGSGSSAETVLEPQAVYKDARERGQRSLFEAYKQMYPILPYMPDGNESGE
FT                   LSDETNDNSVSQVCETSSIYDGSSCWEGSIAYGHDRTQQEAIDCESINSSTVSMVTIIR
FT                   TKLPKECFSSVMLSDISTYATKNLDLNSDSNSSVSDFNESVPNNPSLFPSGSMKRMKKL
FT                   ARKHGFKNLKEAFSKDIQGRITEIHDDIREEKPEHKVEHKVELKVEHKVEHKNEESDAG
FT                   RESAEETNNSCCSKAKGKLRRGWHVINKKKKKGKKSKSKKNKNKKPLGMKMPVEEFEAK
FT                   VAMSSPTSVAAVINGRNHLEFLPEDNTDDKANESLDQSSPIMSEAAKYRKMIFDQIDAY
FT                   FQDEEYKDGESAWTVQ"
FT   CDS_pept        205632..205871
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17437824"
FT                   /locus_tag="CAGL0J02046g"
FT                   /product="Similarity"
FT                   /protein_id="CAG60743.1"
FT                   /db_xref="HOGENOM:HBG123723"
FT                   /db_xref="UniParc:UPI00003B69E4"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPQ0"
FT                   /transl_table=1
FT                   /translation="MLYSRRRNCTGSKDLCFHAQLQDLSDIGALLFTLEFTGKRYTYYI
FT                   FLRQTLQTVWPLWTGSVLPHWIYSIASVGGPSSL"
FT   CDS_pept        207414..209540
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000066123" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17437825"
FT                   /locus_tag="CAGL0J02068g"
FT                   /product="Similar to uniprot|P40557 Saccharomyces
FT                   cerevisiae YIL005w"
FT                   /biological_process="cell redox homeostasis"
FT                   /protein_id="CAG60744.1"
FT                   /db_xref="GO:0045454"
FT                   /db_xref="HOGENOM:HBG123879"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017936"
FT                   /db_xref="UniParc:UPI00003B69E5"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPP9"
FT                   /transl_table=1
FT                   /translation="MLYSYLWSFMWLLAIACARPPPKVDERNDKPPRGFPLPLNKKNFE
FT                   VELSNGFHLVEFYSPYCSHCKNLAPIWEDTWVSFREEGKKLNMKLSQVNCVESGDICHK
FT                   EDIRAYPTIRLYGPDGFLEEYHGKRTKEEFLKFARKSIMEYGDTDDLILPSLSKLLSGK
FT                   DFSQLISGKSTKPMLVSFWPTSDMQEDSSVETKFNNCPKCEIYQRKWNLINNAVDGLGV
FT                   DSGHLNCGSEQNLCERLGFADLASSAKSGGNVKPRLALIIPKKVTNNLFIYPEGQDVSN
FT                   QADVLDFIKRISVNSEAAEISESEIIDYSRNSMPLFSEFVHTNAKKVHSGQNIYIIFCY
FT                   NHKTVVPEDFTILEHLVEPLASRPNTYLRKFNGTIPELTKKVYDPFYQVVNYNDSEPRK
FT                   ELNEEFQTMAAVTEYPTFLIIKEGELQTHVFNGFSTTEMRNLDTILDWIDDTIVPSLPK
FT                   LTWDNFEEMLNVNPSKYRTMAILLMSTKWEYDDKVNAAQKFFTSFLDYEHVRMQKMFEI
FT                   VQQERLKKANAIEKMREKQENTKNILAKMRQEISHPNDRKVQYMYLDLAKDERLLKRLG
FT                   VHNANIAPNQVLLIDKARKTLYAENHFEERLTGKDTYGIREALLSINIPEKCQLSTILR
FT                   AQHLKIKLQKKIKIPHVKVSNGSNSNILYFFAILLLLVLLRKSPVYRMVSRKWHSHRAS
FT                   YQANTSYSKLEAQD"
FT   CDS_pept        complement(209869..210288)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000209281" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17437826"
FT                   /locus_tag="CAGL0J02090g"
FT                   /product="Similar to uniprot|P22804 Saccharomyces
FT                   cerevisiae YIL004c BET1"
FT                   /protein_id="CAG60745.1"
FT                   /db_xref="HOGENOM:HBG333022"
FT                   /db_xref="HOGENOM:HBG498724"
FT                   /db_xref="InterPro:IPR000727"
FT                   /db_xref="UniParc:UPI00003B69E6"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPP8"
FT                   /transl_table=1
FT                   /translation="MSSEYAESTLYQRDPSRTQLFGAADPTLIDDRTSPYDKGKLDYSQ
FT                   STLAHLESQSEEQMGVMTEKIRALKSLSMRMGDEIRGSNKTLDQLDDTFQRTTVKLKQT
FT                   FNNMMDMAKRSRISIKTWLLLFFFIFLLFFYVWIT"
FT   CDS_pept        210632..211489
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000079916" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18501141"
FT                   /gene_name="CFD1"
FT                   /locus_tag="CAGL0J02112g"
FT                   /product="Cytosolic Fe-S cluster assembly factor CFD1 "
FT                   /function="4 iron, 4 sulfur cluster binding"
FT                   /function="ATP binding"
FT                   /function="metal ion binding"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAG60746.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="GO:0051539"
FT                   /db_xref="HOGENOM:HBG411641"
FT                   /db_xref="HOGENOM:HBG586485"
FT                   /db_xref="InterPro:IPR000808"
FT                   /db_xref="InterPro:IPR015223"
FT                   /db_xref="InterPro:IPR019591"
FT                   /db_xref="UniParc:UPI00003B69E7"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FPP7"
FT                   /transl_table=1
FT                   /translation="MDPEEQLESTEGVPAKSLSLIKHILLVLSGKGGVGKSSVTTQTAL
FT                   TLCGMGYNVGVLDIDLTGPSLPRMFGIEDSSIYQSADGWMPIPVETNGKGKLCVVSLGF
FT                   LLGSRGTSVVWRGPKKTSMIRQFIKDVTWGELDYLLIDTPPGTSDEHISIAEELRFTNP
FT                   DGAIVVTTPQGVATADVKKEINFCRKVNLRILGVIENMSGFVCPYCTECTNIFSKGGGE
FT                   SLAKQFDVPYLGNIPIDPKFVDLIENQKKMEGTLVELYEKSSLYPIYLEIMKKVQEESS
FT                   KPQE"
FT   CDS_pept        211750..212034
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17437827"
FT                   /locus_tag="CAGL0J02128g"
FT                   /product="Similar to uniprot|Q3E7Z5 Saccharomyces
FT                   cerevisiae YIL002wa"
FT                   /protein_id="CAR58042.1"
FT                   /db_xref="UniParc:UPI00017BD8B3"
FT                   /db_xref="UniProtKB/TrEMBL:B4UN26"
FT                   /transl_table=1
FT                   /translation="MKWPRKLFDKITSIDRPVKITLNIMTIEDHNLTNSEAKNLQDALK
FT                   DILQGEKQASEMEQKLDQVEKNLDMLLKQLESFEDARLQNGKSEKDEQK"
FT   CDS_pept        complement(212192..215047)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000179717" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17437828"
FT                   /locus_tag="CAGL0J02134g"
FT                   /product="Similar to uniprot|P40559 Saccharomyces
FT                   cerevisiae YIL002c INP51"
FT                   /function="inositol or phosphatidylinositol phosphatase
FT                   activity"
FT                   /protein_id="CAG60747.1"
FT                   /db_xref="GO:0004437"
FT                   /db_xref="HOGENOM:HBG058693"
FT                   /db_xref="HOGENOM:HBG396456"
FT                   /db_xref="InterPro:IPR000300"
FT                   /db_xref="InterPro:IPR002013"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="UniParc:UPI00003B69E8"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPP6"
FT                   /transl_table=1
FT                   /translation="MRIFVGRNPRSVVLSSESYSLKFERLYDRSNQTQGNVQAQQGQPN
FT                   QIKAPTVSIKNVSASELVKDGYRELRALRLNGLLGLLTINGDVYVVVVGGVQSIGYPRW
FT                   HLDDSSKITPEQSINKILEVDFISLDTEIYDHLFFDRSEQNFDKLLHEHPCGVYKRLFA
FT                   DGSFYYTKDYDLTNAVKSPGLTHNLDYAIDNFDTSFIWNANLIGEIINWRGRLSMKEKQ
FT                   AFDNAPFLMFVIRGFCKTSIVNDPDLTATVTVLSRVSTEGHKSISDSEGMHEDSRVSTI
FT                   IETETIVTTDSFILSYTQIAGNIPLFYEIIDGQLLSGKKLKLLKQPGEGQNEFNKHFDT
FT                   LESKFGIVSVVNLVKSRSDSQETLASIYKQYSDTRGIKISNIPCGSQTLNKSPHKVLYS
FT                   LKQDIYECGAFAYNIKKGIYFGKQTGVIRISAADPIEKPILLEKLISKEVLELATKELD
FT                   GFSITSPLLEVHDKLWSENHFWLERVYAKNQKNYNKSAKIYLKLFSSHVKLFDPVHFYI
FT                   SQYLRQFRSSFTHMKDIKVFAGTFNVSGKLSKDDISQWIFPNGVTTEEDFADVYVFGLE
FT                   EVVELTPGHMLAIDPYIKQFWEKKLLDTINYYDKDSSYTKVWSSQLGGVLLILLMKSSE
FT                   SLKVKHVEGDVKKTGFGGITSNKGAVAVSFNYSATRFCVLVSHLAAGLENVEQRHNDYK
FT                   MISKNIRFSRGLRIKDHDAIIWMGDFNYRILMSNEEVRKLIALKDYKSLFEKDQLNQQM
FT                   IAGESFPYFHEMPIEFPPTYKFDPGTRQYDTSEKLRIPAWTDRILGRGDVLRQLTYTYA
FT                   PDVLFSDHRPVSAVFSANVTVVDEKKKAELSSVIHTKLMERLEGCDEDERIEILNDGNF
FT                   KLNELDDEISNITNMNAKPEQKRARKLPPPSSEIRKWWVGNGKQVKVFLDTDPEEFMLN
FT                   PEHTPNPFDSNDTSPLFVPRS"
FT   CDS_pept        215693..217195
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000202106" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17437829"
FT                   /locus_tag="CAGL0J02156g"
FT                   /product="Similar to uniprot|P40560 Saccharomyces
FT                   cerevisiae YIL001w"
FT                   /protein_id="CAG60748.1"
FT                   /db_xref="EMBL:BAD02473.1"
FT                   /db_xref="HOGENOM:HBG191648"
FT                   /db_xref="HOGENOM:HBG397648"
FT                   /db_xref="InterPro:IPR000210"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR011333"
FT                   /db_xref="InterPro:IPR013069"
FT                   /db_xref="InterPro:IPR013089"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniParc:UPI0000225EDA"
FT                   /db_xref="UniProtKB/TrEMBL:Q76IP9"
FT                   /transl_table=1
FT                   /translation="MVEGSATSIDPRFAELCMACRVGDIENADRLISTGININSVDEYD
FT                   NSPLFLASLCGHEEVVKLLLERGAACDRDKFEGARCIYGALTDSIRDILLSHDISKAVD
FT                   LNQPFATHISSLIRDFWFFMTFDLTIDFSKEDINFKAHKFLLNILCPEFFDSNWLCDND
FT                   SIDLSSVTDSATFEYFLGYAYLLPAVHKLSHRDYDELIKFSEVTKLHILTEFLHQSRTT
FT                   YDAAEKSTLVMDFQFKFREYLREALKVFVEDKIINNYEENLNNITNKCLAFHDIYLRVQ
FT                   NHDTQVRYYPCHLAILERAPLFQLVFNSNFREKSVYISKSEYNDSITVNFPNCDFNVVE
FT                   IILRYLYYDCPEIPIEYAAETVVMADILLEDRLKAIATANLVKSKSVFDYYSVFDILKL
FT                   GWEMRSEKLEHFAAKEIAENLFKYEEDQNLKQAILESSQRISARQETDTIELVDDIRYY
FT                   LVSSFVTNVNSDIVEEEDYENIEYQKRIAVVNKILRQLNIDA"
FT   CDS_pept        complement(217645..218079)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17437830"
FT                   /gene_name="SGN1"
FT                   /locus_tag="CAGL0J02200g"
FT                   /product="Putative uncharacterized protein SGN1 "
FT                   /function="nucleic acid binding"
FT                   /function="nucleotide binding"
FT                   /protein_id="CAG60749.1"
FT                   /db_xref="EMBL:BAD02472.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="HOGENOM:HBG349450"
FT                   /db_xref="HOGENOM:HBG756718"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniParc:UPI0000225ED9"
FT                   /db_xref="UniProtKB/TrEMBL:Q76IQ0"
FT                   /transl_table=1
FT                   /translation="MAISPQKISEIFENLNVSSNNVTTQSNSRLTREQKHALQLEADAC
FT                   SIYIGNISLDTTPEEIDEHFKSCGVIKRITMLYDKNTGPSIGYAYVEFDSIDSRDKALD
FT                   FNGTNLRQHVISVERKRTNIPNYKQNTSNNTDSGTENKNT"
FT   CDS_pept        219375..220091
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000048344" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20195764"
FT                   /gene_name="NOP16"
FT                   /locus_tag="CAGL0J02222g"
FT                   /product="Nucleolar protein 16 "
FT                   /biological_process="rRNA processing"
FT                   /cellular_component="nucleolus"
FT                   /cellular_component="ribonucleoprotein complex "
FT                   /protein_id="CAG60750.1"
FT                   /db_xref="EMBL:BAD02471.1"
FT                   /db_xref="GO:0005730"
FT                   /db_xref="GO:0006364"
FT                   /db_xref="GO:0030529"
FT                   /db_xref="HOGENOM:HBG175985"
FT                   /db_xref="HOGENOM:HBG396451"
FT                   /db_xref="InterPro:IPR019002"
FT                   /db_xref="UniParc:UPI0000225ED8"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q76IQ1"
FT                   /transl_table=1
FT                   /translation="MTSVRKRKMNRSSVKKVSRRNKDKQKKKLIACNPIIAKNWDYSLT
FT                   LAQNYEKLGLKAKLQTPAGGQEAKYDTVIKKEATIDPVTQFGEDSDSDSEEDSSNSQED
FT                   NEGQNVEDIDENEIPEGEARIIRDAEGNVVKVVYGKKKVFDIDDDIDTIKAKLADQQKE
FT                   ETEVVKQLEAFASRPIVKKERVQSPREVEWLEKLYKKHGDNYKAMFFDRKLNIYQQSEG
FT                   EIKRKMRKWKSENNIA"
FT   CDS_pept        complement(220448..221737)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000241277" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17437831"
FT                   /gene_name="PMI1"
FT                   /gene_synonym="PMI40"
FT                   /locus_tag="CAGL0J02244g"
FT                   /product="Mannose-6-phosphate isomerase "
FT                   /EC_number="5.3.1.8"
FT                   /function="mannose-6-phosphate isomerase activity "
FT                   /function="zinc ion binding"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAG60751.1"
FT                   /db_xref="EMBL:BAD02470.1"
FT                   /db_xref="GO:0004476"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG011907"
FT                   /db_xref="HOGENOM:HBG590632"
FT                   /db_xref="InterPro:IPR001250"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR016305"
FT                   /db_xref="InterPro:IPR018050"
FT                   /db_xref="UniParc:UPI0000225ED7"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q76IQ2"
FT                   /transl_table=1
FT                   /translation="MTSDRFFRLDAGYQQYDWGKIGSSSAVAKFAAHSDPSVKIDETKP
FT                   YAELWMGTHSKLPSVNHETKATLNDILAKNSQELIGEDVINKFKSTNELPFLFKVLSIE
FT                   KVLSIQAHPDKELGKKLHMEDPKNYPDDNHKPEMAVAITEFEGFCGFKPLEEIADELET
FT                   IPEFRDVVGDEVANEFIQNYKTGVENSSSACANNKKLLQKVFEKVMTAPCDILEKNADG
FT                   MAKRANENPSSFKSSDLPELVVRLNRQFPKDVGLFCGCLMLNHCKLQPGQALFLEAKDP
FT                   HAYICGDIIECMAASDNVVRAGFTPKFKDVKNLVEMLTYRYDPVEKQVMSAEEFPRAGG
FT                   DGATIMYNPPIAEFSVLETTFKNKTGKATVEGLKGPSIVITTAGEGYISADGQKLKAEP
FT                   GFVFFIGANVPVELETTDKDFTTYRAFVEA"
FT   CDS_pept        join(complement(223475..223485),complement(222727..223258))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000223988" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17438902"
FT                   /locus_tag="CAGL0J02266g"
FT                   /product="Similar to uniprot|P89886 Saccharomyces
FT                   cerevisiae YER007ca"
FT                   /function="RNA binding"
FT                   /protein_id="CAG60752.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="HOGENOM:HBG128790"
FT                   /db_xref="HOGENOM:HBG553443"
FT                   /db_xref="InterPro:IPR002478"
FT                   /db_xref="InterPro:IPR004521"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR016437"
FT                   /db_xref="UniParc:UPI00003B69E9"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPP1"
FT                   /transl_table=1
FT                   /translation="MFKKFSKEDVHSRSKVKSSVQRTLKTKLVSQYPKLEDVIDELIPK
FT                   KSQIELIKCEDKIQLYTVDEEVLFFQKFNDLIPSLKLVHKYPEAFPTVQVDRGAIKFVL
FT                   SGANIMCPGLTSAGASLPEAPGLEKGTIVVINAENKENALAIGELMMSTEEIKSINKGH
FT                   GVELIHHLGDPLWHFTL"
FT   CDS_pept        complement(223820..225445)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17438903"
FT                   /gene_name="BAR1"
FT                   /locus_tag="CAGL0J02288g"
FT                   /product="Similar to uniprot|P12630 Saccharomyces
FT                   cerevisiae YIL015w BAR1"
FT                   /function="aspartic-type endopeptidase activity "
FT                   /biological_process="proteolysis"
FT                   /protein_id="CAG60753.1"
FT                   /db_xref="EMBL:BAD02468.1"
FT                   /db_xref="GO:0004190"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="HOGENOM:HBG123724"
FT                   /db_xref="HSSP:1AVF"
FT                   /db_xref="InterPro:IPR001461"
FT                   /db_xref="InterPro:IPR001969"
FT                   /db_xref="InterPro:IPR009007"
FT                   /db_xref="InterPro:IPR021109"
FT                   /db_xref="UniParc:UPI0000225ED5"
FT                   /db_xref="UniProtKB/TrEMBL:Q76IP5"
FT                   /transl_table=1
FT                   /translation="MIQFINCYFIFNLVTVVNCLRLTIEKRIVSSHASLSKRSAVDLQF
FT                   RRFNNLYYESVLEFGTPPQSIPLVLDTGSSDLWVTLIGNPLCYNKGSGKPPKCLIDCSG
FT                   LVFYDMDKSQTFDYLKNVTFKIGYADTTYTSGIWIVDIITLPEGHLKDLQFGMAFATNA
FT                   TFSGVLGIGFPAMESVNGYEFAPGKFYPNFPLALKNAGFTNIAAYSIEYNDESKKGSIL
FT                   FGSIDTSRFIGPLYTFPMINEFPGIADEPSTLSLTLDGIGIDGSCEQWVISNTKLPALL
FT                   DTGSTLIELPHPITQSIASYLNATWSDDHGLFVLACPSDDFLTTTDLAFTFGELHMKIP
FT                   LRSFILLPDEESNGLCGLGITSSKGRVILGDSFLTHVYTVFDLDNYMISLAPMAKSSLP
FT                   GKVIEIPANGLIENAVISKSEKWTHFNDITVNEYGFRNYCDGELQDIHSYSSKLNSSSL
FT                   VYSSNFSSDEEQNSSESVSPSIFNTDSSIKEIYPSLSQKEHLSALLTTISTSEIHKPVT
FT                   ATITDSITTTIRVTKILTVLQCAT"
FT   CDS_pept        complement(226364..226825)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000972" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17438904"
FT                   /gene_name="SNL1"
FT                   /locus_tag="CAGL0J02310g"
FT                   /product="Similar to uniprot|P40548 Saccharomyces
FT                   cerevisiae YIL016w SNL1"
FT                   /biological_process="apoptosis"
FT                   /protein_id="CAG60754.1"
FT                   /db_xref="EMBL:BAD02467.1"
FT                   /db_xref="GO:0006915"
FT                   /db_xref="HOGENOM:HBG123725"
FT                   /db_xref="InterPro:IPR003103"
FT                   /db_xref="UniParc:UPI0000225ED4"
FT                   /db_xref="UniProtKB/TrEMBL:Q76IP6"
FT                   /transl_table=1
FT                   /translation="MDSLIEYVKQQNIDVQGICVATVSAAVFAVLLWKFTSGSGSSKKS
FT                   KSKSYKKKNKKEKVAALTHEMQIENIHLRYKNEFEDRVNNILGAYNPDDEKSVYEKKYC
FT                   NEMLLKLLIELDGVDLVSEEPEKKAILKAKRKAVIKEIQTQLKKLDTLV"
FT   CDS_pept        227226..229910
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000142339" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19349226"
FT                   /locus_tag="CAGL0J02332g"
FT                   /product="Similar to uniprot|P40547 Saccharomyces
FT                   cerevisiae YIL017c VID28"
FT                   /function="binding"
FT                   /protein_id="CAG60755.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG060016"
FT                   /db_xref="HOGENOM:HBG202993"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI00003B69EA"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPN8"
FT                   /transl_table=1
FT                   /translation="MVSFDSVSSSEHSLVALRNRIVGDATAKLDVYLGQNSTIFKELTS
FT                   ISASDDIDLQHLKLDILLILLNVDKNTIESLGESYNDVVVSVLQDIELPKTFLTNNTSI
FT                   NRKYIKLINMSKGYTECDEFPFLKETEQYLSHLIDKLLSDIANSSEIANTIELLTLQLQ
FT                   NGKNRSFLMTKSLKEQIESMLFKCYRKYAELINYKYMIRLRVQKDKKNNKYKPLSNKGL
FT                   NSCISLPNSITISNQQDEKLLYLCLVLYTWSHKINQTASLWESSEFQFFISSFLKGENI
FT                   QLKCAALEFLIAPYLNTENTWKKRKIIIKYLPYLVDLLNYQPLPKWFDIFETLTDLIEL
FT                   YNRHEPMNNPIIMFLSKSNMLYGILGVFFECMSLKTQNNASIKTLTKCVKFCAAFAAND
FT                   EKYRALLLEHKFLLNNLEFGLELHLSLLNEFIEFFNTFKNGNLISSTEPFPCLYDSELC
FT                   FEWLSLLKSFSRSVTALRTSLKRNKLPELLLRLLRKIHRITKECFEVGPEFLGAELKVM
FT                   GQTLGTICNFVVEFSNLQPYLVKNGIIEIIQDLLSDPLLNDSIEWNLQSRKNALQGCNT
FT                   EDVKTNSLWVLRHLMYNCQNEEKLELLAKIPMETILEFVNDPSWPVQAQAFQLIRNLTS
FT                   NSRKVVNILLENFKEVEYNLDPVTGKTKAIGNTYLFEFLVHKMTKLDPRDPPQKKTLEG
FT                   ILYIIVNLAAVNENKKQLVVEQDEILEILSEILAASAQNPTRYGNDSDLKLASLWVLNN
FT                   LLWNSESANHSQFGLDGYPPTSRDSSSAPIDYSEPPSGRVSRNEIHGITSNTDHNSAID
FT                   EDIDDSSALQDNEERNDEFVRHIPEGRSQNNNSTVLRCKKLVDLGIHELVKKNIFDDSL
FT                   SVREKARTLSFHMDLLLRDSNSS"
FT   CDS_pept        join(complement(231568..231571),complement(230262..231022))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000232983" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17438905"
FT                   /gene_name="RPL2"
FT                   /locus_tag="CAGL0J02354g"
FT                   /product="60S ribosomal protein L2 "
FT                   /function="rRNA binding"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="CAG60756.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="GO:0019843"
FT                   /db_xref="HOGENOM:HBG155458"
FT                   /db_xref="HOGENOM:HBG748739"
FT                   /db_xref="InterPro:IPR002171"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR014726"
FT                   /db_xref="InterPro:IPR016027"
FT                   /db_xref="InterPro:IPR022666"
FT                   /db_xref="InterPro:IPR022669"
FT                   /db_xref="InterPro:IPR022671"
FT                   /db_xref="UniParc:UPI00003B69EB"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FPN7"
FT                   /transl_table=1
FT                   /translation="MGRVIRNQRKGAGSIFTSHTRLRQGAAKLRTLDYAERHGYIRGVV
FT                   KQIVHDAGRGAPLAKVVFRDPYKYKLREEIFIANEGVHTGQFIYAGKKASLNVGNVLPL
FT                   GSVPEGTIVSNVEEKPGDRGALARASGNYVIIIGHNPDENKTRVRLPSGAKKIISSDAR
FT                   GVIGVIAGGGRTDKPLLKAGRAFHKYKLKRNSWPKTRGVAMNPVDHPHGGGNHQHIGKA
FT                   STISRGAVSGQKAGLIAARRTGLLRGSQKTQD"
FT   CDS_pept        complement(232589..233593)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000066124" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20196049"
FT                   /locus_tag="CAGL0J02376g"
FT                   /product="Similar to uniprot|P40546 Saccharomyces
FT                   cerevisiae YIL019w"
FT                   /protein_id="CAG60757.1"
FT                   /db_xref="HOGENOM:HBG058628"
FT                   /db_xref="HOGENOM:HBG396938"
FT                   /db_xref="UniParc:UPI00003B69EC"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPN6"
FT                   /transl_table=1
FT                   /translation="MGETDAEYLKMLELQRQAFEAQFGSLESMGYEDKTKEGDDSGSSD
FT                   VDSFSGDSDLSDKEGSDESEQDEEQFRGFDEEDDVEDKSVSKSADIRQPKVIKFSGAND
FT                   TYVPPSKKEQKLLRSGKTLNKNRKLLESEGTETKPGDDEGEDMEMENLQNDIELQRFLK
FT                   ESHLLSAFNSATSGASLTLDGLKDTTVSYQDDEVMGKARARTLEMRLQNISKVNGDGRK
FT                   ISKLEKVPMHVRKGMIDKHVKRIKKYEEEAADAGIVLSKVKSGNFRKIESTYVKDIERR
FT                   IGSSIKSKDLEKSKKRTRGLKVQSVGRSTRNGLVISSEDIARINGSGKSKRRR"
FT   CDS_pept        233987..234772
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000172261" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21044855"
FT                   /gene_name="HIS6"
FT                   /locus_tag="CAGL0J02398g"
FT                   /product="1-(5-phosphoribosyl)-5-[(5-
FT                   phosphoribosylamino)methylideneamino] imidazole-4-
FT                   carboxamide isomerase"
FT                   /EC_number="5.3.1.16"
FT                   /function="1-(5-phosphoribosyl)-5-[(5-
FT                   phosphoribosylamino)methylideneamino]imidazole-4-
FT                   carboxamide isomerase activity"
FT                   /biological_process="histidine biosynthetic process "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAG60758.1"
FT                   /db_xref="GO:0000105"
FT                   /db_xref="GO:0003949"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="HOGENOM:HBG110009"
FT                   /db_xref="HOGENOM:HBG302148"
FT                   /db_xref="InterPro:IPR006062"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR011858"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniParc:UPI00003B69ED"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FPN5"
FT                   /transl_table=1
FT                   /translation="MTKFVGCIDLHDGQVKQIVGGTLKDNDDSLETNFVSKYPPSYYAQ
FT                   LYLENRIEGCHVIKLGPNNDAAAMEALNAAPGFLQVGGGINDENCLQWLEKASKIIVTS
FT                   WLFTKEGTFLMDRLQLLSNKCGPDRIVVDLSCRRTPDSKWVVAMNKWQTLTTLELNKET
FT                   FTELSKYTDEFLIHAADVEGLCKGIETDLVTKLYEWTKDINKEVKIVYAGGAKSISDLE
FT                   LVDKLSNGTVDLTYGSSLDIFGGKLVRFQDCCEWNSKHN"
FT   CDS_pept        complement(234977..235915)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000230844" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17438906"
FT                   /locus_tag="CAGL0J02420g"
FT                   /product="Similar to uniprot|P16370 Saccharomyces
FT                   cerevisiae YIL021w RPB3"
FT                   /function="DNA binding"
FT                   /function="DNA-directed RNA polymerase activity "
FT                   /function="protein dimerization activity"
FT                   /protein_id="CAG60759.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003899"
FT                   /db_xref="GO:0046983"
FT                   /db_xref="HOGENOM:HBG285589"
FT                   /db_xref="HOGENOM:HBG539019"
FT                   /db_xref="InterPro:IPR001514"
FT                   /db_xref="InterPro:IPR009025"
FT                   /db_xref="InterPro:IPR011261"
FT                   /db_xref="InterPro:IPR011262"
FT                   /db_xref="InterPro:IPR011263"
FT                   /db_xref="UniParc:UPI00003B69EE"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPN4"
FT                   /transl_table=1
FT                   /translation="MSEEGPQVKIREATRDNVDFILSNVDLALANSLRRVMIAEIPTLA
FT                   IDSVEVETNTTVLADEFLAHRLGLIPLQSTDIEQLEYSRDCFCEDHCDKCSVVLTLQAV
FT                   GESESTTNVYAKDLLIVSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELKLTCIAKKGI
FT                   AKEHAKWGPAAAIEFEYDPWNKLQHTDYWYEEDIRKEWPQSKNCEYEDPPNDDEPFDYK
FT                   AKADTFYMNVEAVGSIAVDQVVLRGIDTLQKKVASIMLALNQMDQEKVNFATGDAKGNG
FT                   IEEDGDAMMMNGHDGPYGDNGRSSDTYGSAW"
FT   CDS_pept        complement(236641..237879)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000208172" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20196050"
FT                   /locus_tag="CAGL0J02442g"
FT                   /product="Similar to uniprot|Q01852 Saccharomyces
FT                   cerevisiae YIL022w TIM44"
FT                   /function="P-P-bond-hydrolysis-driven protein transmembrane
FT                   transporter activity"
FT                   /biological_process="intracellular protein transport "
FT                   /cellular_component="mitochondrial inner membrane
FT                   presequence translocase complex"
FT                   /protein_id="CAG60760.1"
FT                   /db_xref="GO:0005744"
FT                   /db_xref="GO:0006886"
FT                   /db_xref="GO:0015450"
FT                   /db_xref="HOGENOM:HBG051844"
FT                   /db_xref="HOGENOM:HBG396560"
FT                   /db_xref="InterPro:IPR007379"
FT                   /db_xref="InterPro:IPR017303"
FT                   /db_xref="UniParc:UPI00003B69EF"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPN3"
FT                   /transl_table=1
FT                   /translation="MISVRSTSGVLVARRCFGTRSVLLSNPRSPLQIFRETFKKEWEKS
FT                   QELQDNIKTLQDASGRLGESEAYKKAREAYLKASKGSQTIVGKTLQKTGETVEELATKA
FT                   WDSDIAKTTRVVASKTAKKLDESFEPVRQTKIYKDVSEVIDDGDSSSYGGFITKEQRRL
FT                   KREKDLASGKRVRAVKSNDEAGSALVATDIEAKESLGKKIEDFKEKTPVGRTLKSVKVS
FT                   LWDESENPLIVFLRKITGKIGGFFAETESARVYKQFKMVDPTFTNIGFTKHLRDYIVPE
FT                   VLEAYVKGDEKVLKKWFSEAPFNVYNAQQKIFKKQELFSDGKILDIRGVEVVSAKLLQP
FT                   QDIPVLVVGCRAQEIHLYRKAKTGEIAAGDESNILMSSYAMVFTRDPEQIDDDETEGWK
FT                   ILEFIRGSSRPFN"
FT   CDS_pept        238695..241445
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17438907"
FT                   /locus_tag="CAGL0J02464g"
FT                   /product="Similar to uniprot|P40537 Saccharomyces
FT                   cerevisiae YIL031w SMT4"
FT                   /function="cysteine-type peptidase activity"
FT                   /biological_process="proteolysis"
FT                   /protein_id="CAG60761.1"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="GO:0008234"
FT                   /db_xref="HOGENOM:HBG123726"
FT                   /db_xref="InterPro:IPR003653"
FT                   /db_xref="UniParc:UPI00003B69F0"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPN2"
FT                   /transl_table=1
FT                   /translation="MSRRRAFQGGIMPVDTLSSSPVAETQERRPVSPVRYRRKRDPKVI
FT                   AELNQKGHEIFSIGDEDGLPMRHKEKDVQRGEGEERSSNRPTSTSDGNYESLRYVVVGK
FT                   MKLITLDQKEVDVEEAVLEFSNKKGELNPSMKIRPTDSRSKVKDFKIKILRDCSKIWFT
FT                   ERVAKVGIFLKEKLDVPIVDGSNEVLPIICIVWVRSLQDSTIFLRLSRIQIVLHELAKS
FT                   RKTLHTTLTVLTNLTELELQRCIKSNMITELQKLSRAKRRLISSSSDGINDQDDVPNKG
FT                   VSNTNNVSRKNGIRSLISKASKAAYNTGNGKSIRIPFSVNGANNRKISSTSQSVDPIPS
FT                   SNFYSSSSPSGNTRSNSLNKRANEHKLSDHLLSNVKRTRKSMINGSNNSIKDPMSIDDE
FT                   EIAFDEDKSNAEDELFYETPKIFEPNLVYKFTDGSYYTITNQDFKCLYNKDWINDSILD
FT                   FFTKYFIESAITNNKVRKEDVHIMSSFFYTKLTSTEEEVYSNVKKWVNNTDLFKTKYVV
FT                   IPINNNFHWFGCIITNLDSFFIYYNENKMSKNSKNLANMDREEDDITVSPPIITILTFD
FT                   SLKQTHSREIDPIKEFLIGYAKDKYQLDIDKSLIKMKTCAVPQQANFSDCGVHVIFNIK
FT                   GFFENPHQTVELWYSKKMKNKHDMRYINEYFNKSGRNNSRKFLRDILLSLQKQQVLHNA
FT                   GIEANGQALSNVDEDEDIEIIEDLYDAKDSKLAPIDVKKNVNDIDIGRQSLSSRVGLQS
FT                   EPPSPTPEFQEDQSIPSSSIMNVNSKAEEQGHIISNLSRSSHILASYKDSESNQVYTSP
FT                   YFGKSILKDRVDNYTASTENAHSNSTYSNGHEKSNANNSGSPTMDIGVGENSEISADDF
FT                   SERYNESDVNLIPEGVAPKSEQDEDALDLIRDSLARELNENIDTH"
FT   CDS_pept        complement(241644..245351)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000142338" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20196051"
FT                   /locus_tag="CAGL0J02486g"
FT                   /product="Similar to uniprot|P40318 Saccharomyces
FT                   cerevisiae YIL030c SSM4"
FT                   /function="zinc ion binding"
FT                   /protein_id="CAG60762.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG123727"
FT                   /db_xref="HOGENOM:HBG202989"
FT                   /db_xref="InterPro:IPR011016"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR018957"
FT                   /db_xref="UniParc:UPI00003B69F1"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPN1"
FT                   /transl_table=1
FT                   /translation="MDIPQGATCRICRGEATEESPLFHPCRCRGSIKYIHESCLLEWIS
FT                   SKNIDISKTGAEVNCDICHHPFNFKTTYVEDMPEKIPFPILLKSTLKATFSKMRKSLEI
FT                   SLALVLFLFGWPLVWNTWARLYTFALDGTIPYEEDTIRSILFGFQENPEYYRNIVLTKS
FT                   TVLKQLLWNYKFTALQIALIVILHIALYFQYDMIVREEVFSKMILHKIGPKLSINDMKA
FT                   RLMERFPMMDEAMIDHLAVALRARENNRQGIQDEAQRPIVVDRVQEREPLHEVNADEEV
FT                   NPQNNINNMHLDSDDDENDPDFVVNDHDSDTDDEANHWGVGQQDEMNDPFRERFEEMMN
FT                   RRAQNQFDNLLAQQQERNAQNAMNRPNAPIFIPPVQEAQPDEAMQDNDGANAVLINVKL
FT                   KLSSILIYFVVGAVVCSLYLLLSYLIPTVVGYGLIRVYLKILEIAFRGFNLLMHYSKLS
FT                   VVYFGLVKYIPFISVVHQELVVATTHQYLEYYQGYFDNSMKHSMLLRALPCLTTYLTAI
FT                   AINTVVSEMISKGYGRHNGLSSNVKRQIFQITFAIRCTLKVFTLFFIELAGFPILAGVM
FT                   LDIALFCPILGSPNKLLSIPQLFRIWPKLSFFAYWIIGTLYMYWFAKYIGMIRKHIIRP
FT                   GVLFFIRSPEDPNIRILHDSLIHPMGIQLSRLCLSMFIYAVFIIAGFGLHTRVIFPMLW
FT                   KSGFSTFSDKCKPDSFFDKTSLTILLAFTVTRNILEKNSVLKRAVKDYWVYVFHVCARN
FT                   LRLSSFIIGKDVPTERGHILYRNWFFKLFASQKAQWSNTELFTSPKTYDEALELFRENK
FT                   SVHAYFIPDGVLMRVPSSDIVSRSYVQTMFVPVTTDDKILKPLDFKKINERNKSTAGEF
FT                   GYLDEQNTEFDHYFVVYVPPNFRMRYMILIGLIWFFSSLLFISICLMSHYTSKLLMLPI
FT                   EVFIMTNSNENKEEHINPYYVCIGLIILSQLLPKVYKLVEKRTLNKTHQVETEVEAENE
FT                   DDENDVEVPMEPEVAFLDIVKDFKESFVFKLILSTLIAMGEFWIALISNIALLVHLIIA
FT                   YNYCIALCGGSRFISFLPSSSGDLFTSTNDKIRTIFTIINSVLLLLKGKRTGSVFIKNK
FT                   NRRTSELLKRLLSAVLTNTLKFHGSNLLVLAVLCVIFNVINGTLYLDMTWSSTAKFIPL
FT                   VFNSVPSHSWSRTEHAYMMTLLLAYFSYFISNFMVTFSKYWNVLEQGVKDTIYTKGKKL
FT                   ENLPEEKDGQ"
FT   CDS_pept        complement(246210..248822)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18501405"
FT                   /locus_tag="CAGL0J02508g"
FT                   /product="Strain CBS138 chromosome J complete sequence "
FT                   /protein_id="CAG60763.1"
FT                   /db_xref="HOGENOM:HBG123595"
FT                   /db_xref="UniParc:UPI00003B69F2"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPN0"
FT                   /transl_table=1
FT                   /translation="MSLITIFAFFIKATLVLSLDILTPTTLTGDQTFNEDVSVVSSLTL
FT                   NDGSQYLFNNLLQIAPSSASVTANALAAVSVFTFSLPPSSSLSNSGTLIISNSNTGPST
FT                   EQHIVITPNVMANTGTITLSLAHTNTDSSSTLIIDPVTFYNTGTINYESIGSETNDPSL
FT                   TGNILSIGSSGRTLQNLGTINLNAANSYYLLGTITENSGSINVQKGFLYVNALDFIGNT
FT                   INLSTTTALAFISPVSQVVRVRGVFFGNIIASVGSSGTFSYNTQTGILTVTTNGVYSYD
FT                   IGCGYNPALMSGQQETLSFQGNLYDTFLVLVNQPIPSDLTCAAVSSSITPSSSVEPSSS
FT                   VEPSSSVEPSSSVEPSSSVEPSSSVEPSSSVEPSSSVEPSSSVEPSSSVEPSSSVEPSS
FT                   SVEPSSSVEPSSSVEPSSSVEPSSSVEPSSSVEPSSSVEPSSSVEPSSSVEPSSPAVPS
FT                   SSAEPSSSVVPPITPIPSSSVVSASVFDTSSTLPSSPTVPTSSVSPSSPTVPTSSVSPS
FT                   SPTVPTSSESPSTLSTPSSSAAPSSFCPTCVSSGTPPAPSSSAVVPTSSAGGGNGGDNG
FT                   QPGADGQPGAAGQPGAAGQPGAAGQPGAAGQPGAAGQPGAAGQPGAAGQPGAAGQPGAA
FT                   GQPGAAGQPGAGSGGGSEQPTPGAGAGSGSADGNQSGTSSGTGNGQAGSGQAGSGQVGS
FT                   GQAGAGQAGSGQAGAGQAGSGQAGAGQAGLDNTASGQSEGGQASAMDGDQSGRGGQSNS
FT                   GSLLQPNAQQGTGSGTGSDTGADQASGESPGQIGDAQPGSGTDQSSGRHSLAAEARTSQ
FT                   SHSLAADARTRSTTRQTSVIAPGTAPGTAVVTTFHGCGTVNHKGMINILLALALLVLL"
FT   CDS_pept        complement(250629..252893)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17438908"
FT                   /locus_tag="CAGL0J02530g"
FT                   /product="Strain CBS138 chromosome J complete sequence "
FT                   /protein_id="CAG60764.1"
FT                   /db_xref="HOGENOM:HBG123596"
FT                   /db_xref="UniParc:UPI00003B69F3"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPM9"
FT                   /transl_table=1
FT                   /translation="MLMFSRILLFFASYVLVKAQQTITTPTTLTGNQNFNEDIDVQSSL
FT                   TLNDGSEYIFNNLLDISLDTASVEANAQSGSVFTFSMPPSSSFSNLGTLTINNNAGVVS
FT                   EQHININPSTFSNSGTLTIRVVHYQSDSSSTMLIDSPSFANSGTINYERTGTEINDPGL
FT                   EGNILHIGSAGHALDNTGIINLAAGNNYYLQGNIQGEGGSINVNYGLLHIDSTSFAGNT
FT                   INLGPEGALAMIRPVPETVVVRGFAAPNFIASAGTNGAFAYNEQTGILTVTTDGNTYTY
FT                   DIGCGYDPALLIGTQSSIGYEGNLVDGYGVAYTGAAPADVTCAAASSSIVPSSSVEPSS
FT                   SVEPSSSVEPSSSVEPSSSVEPSSSVEPSSSVEPSSSVEPSSSVEPSSSVDTSSSVEPS
FT                   SSVEPSSSVEPSSSVEPSSSVEPSSSVEPSSSVEPSSSVEPSSSVEPSSSVEPSSSVEP
FT                   SSSVEPSSSVEPSSSVDTSSSVEPSSSVEPSSSSSSSSSSSSSSSSPSSSSSSSSSSSA
FT                   VVTTITTTIEDPGVPPVIITTTITIGAGTGQGEQGQAGQAGQAGQAGQAGQAGQAGQAG
FT                   QAGQAGQAGQAGQAGQAGQAGQAGQAGQAGQAGSGQAGQAGQAGQAGSGQAGQAGSGQA
FT                   GQAGSGQAGQAGSGQAGQAGSGQAGQAGSGQAGQAGSGQAGSGQAGQAGSGQAGSGSGN
FT                   QEHSHSLAALGRTGTTSGRAQPTTILTPSHLATTFHGGVEHVNVGLFNFMLPFIISVLL
FT                   L"
FT   CDS_pept        complement(254862..257549)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17438909"
FT                   /locus_tag="CAGL0J02552g"
FT                   /product="Strain CBS138 chromosome J complete sequence "
FT                   /protein_id="CAG60765.1"
FT                   /db_xref="HOGENOM:HBG123597"
FT                   /db_xref="UniParc:UPI00003B69F4"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPM8"
FT                   /transl_table=1
FT                   /translation="MTNMKVFIVLMLGFCLVSALDVNSILSLTGIQLFTEPVHIFSTGA
FT                   LSLTLGNSYAFNDLLTIDGGGSLSATALLDILLPFSFSIPSTSSVTNSGSMTISNGNLL
FT                   GLGGSQSINIIPSSLTNTGTITLDLARTVSDATSLLVIDAGVFVNSGTISYIGGGAGGT
FT                   DPNLLGNILQIGSVGNTIDNTGTIHLNAAPRYNLLGNIIGDGGVIDIEQGTLVISSQTF
FT                   TGNSIALHPNTAAAFVNAQANAIVVTGLLDAAAIISLGVDGSFVYDPTTGILTVTTSLG
FT                   VFLYDIGCGFDPALFLGAQITIQVGGVNVDAYSVVYLGVAPSDTTCAAASSSIIPSSSI
FT                   VPSSSVEPSSSIEPSSSIEPSSSIEPSSSVVPSSSVEPSSSVVPSSSVEPSSVLPSSSV
FT                   VPSSSVEPSSSVLPSSSVVPSSSVEPSTPPIPSSSVEPSSSVVPSSPAVPSSSVEPSSP
FT                   AVPSSSVEPSTPPIPSSSVVSASVFDTSSTLPSSPTVPTSSVSPSSPTVPTSSVSPSTI
FT                   STPSSSAAPSSFCPTCVSSGTPPAPSSSAVVPTSSAVGGNGGDNGQPGADGQPGAAGQP
FT                   GAAGQPGAAGQPGAAGQPGAAGQPGAAGQPGAAGQPGAAGQPGAAGQPGAGSGGGSEQP
FT                   TPGAGDGSGSASGNQSGTGSGTGSGQQGSGQAGSGQAGAGQQGSGQAGAGQAGAGAGQQ
FT                   GSGQAGAGQAGAGQAGAGQAGSGQAGAGQAGAGGSGAGSSGSGSGSGAGGAGTSGSGSG
FT                   AGGSGAGSAGSGSGGSGAGGSGAGGSGAGSAGSGSGGSGAGSAGSGSGGSGAGSSGSGA
FT                   GASGSGSGAGAGGAGSGGTGAGSGQASPQPHSVAAQARTTTGGSQPTVLAPSQLATTFH
FT                   GGVEKINVGLFQVLLPFVVSVLLL"
FT   tRNA            complement(261092..261164)
FT                   /gene_name="tRNA-Lys (CTT)"
FT   CDS_pept        261400..261843
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19349227"
FT                   /locus_tag="CAGL0J02618g"
FT                   /product="Similar to uniprot|P14724 Saccharomyces
FT                   cerevisiae YFR036w CDC26"
FT                   /protein_id="CAG60767.1"
FT                   /db_xref="HOGENOM:HBG123599"
FT                   /db_xref="UniParc:UPI00003B69F6"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPM6"
FT                   /transl_table=1
FT                   /translation="MIRREATTLTLSQTDINDLVDELEERKLQRIINKQRDRVLRTSTK
FT                   LESGSEDTRLASRDNNDDGIALQYNNGDESLEDAVPIDSFINASPLDNKTMHRTVNFDQ
FT                   GLNVSLGSFAQNTTSNSNWQGNSQSGTSETEAGSTQSNPFYRG"
FT   CDS_pept        complement(262001..263644)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000246692" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17438910"
FT                   /locus_tag="CAGL0J02640g"
FT                   /product="Similar to uniprot|P43609 Saccharomyces
FT                   cerevisiae YFR037c RSC8"
FT                   /function="DNA binding"
FT                   /biological_process="regulation of transcription "
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG60768.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0045449"
FT                   /db_xref="HOGENOM:HBG395642"
FT                   /db_xref="HOGENOM:HBG434010"
FT                   /db_xref="InterPro:IPR001005"
FT                   /db_xref="InterPro:IPR007526"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR012287"
FT                   /db_xref="InterPro:IPR014778"
FT                   /db_xref="InterPro:IPR017884"
FT                   /db_xref="UniParc:UPI00003B69F7"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPM5"
FT                   /transl_table=1
FT                   /translation="MSETVKNEMEIDSENVAKVEEVTDKSNGDDDTSSMEDKTLKFLIK
FT                   QTNEVTIPPFAKWFDMYSVHEIEKRSLPDFFDGSSRFKSEKAYKDTRNFIINTFRLSPT
FT                   EYLTITAVRRNIAMDVASIVRIHEFLEKWGLINYQVDPRSKPTLIGPSFTGHFQITLDT
FT                   PQGLKPFLPEKKIIANKKLKIEAQKKKLVHEDEERVEVLILNDATTKESNEDDQTINEE
FT                   ENSYPTNVSLRQNVYDASKNFNALKEKKLESKDMQKVFVCHICGNDKMTVKYFNLRNKH
FT                   SSLCHKCFSKEQFGEKFQSSDFIKLADENAFPQRKIWTDQEVVSLLEGLEMFGSDWKHI
FT                   AKHVGGNKLIADCVDKYMSLPLEDDDVSKLLDKYKSSANQTTSDTIIEVMENFINALIT
FT                   NGNEDILNSKLPTAAHNCQLKSQYQMRIIAQELITLSAKKLKIKMSKLDSLDKALTEET
FT                   AKYENEVSKISQQKNNLSKQVSEINQKLSDLNVTKKLVIASEQMDSNMDLVDKEEEEEK
FT                   NDNQQLAKEVAQHLDDPKLTEPKRFKIWSL"
FT   CDS_pept        264512..267046
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000172362" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17438911"
FT                   /locus_tag="CAGL0J02662g"
FT                   /product="Similar to uniprot|P43610 Saccharomyces
FT                   cerevisiae YFR038w"
FT                   /function="ATP binding"
FT                   /function="DNA binding"
FT                   /function="helicase activity"
FT                   /protein_id="CAG60769.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0004386"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="HOGENOM:HBG522470"
FT                   /db_xref="HOGENOM:HBG717285"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="UniParc:UPI00003B69F8"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPM4"
FT                   /transl_table=1
FT                   /translation="MNTRKRFLRSARKAAAVTVNYAEPDDNDLSANTFASDDENADVSV
FT                   DAEDTPPVWLRDDVRPNEDVQLDSDDENGGDKDDDRDLDDLLLKEKEKHRLEAQTKEED
FT                   SDDEVNELDKASVTSKLKKLDEFVKQSQVYSSIIADTLLKRTLERTEESDASNNDPVKE
FT                   PPAKKAKKSKSILDFFTRRQNTDDNRVEEMAVDVKKETEEERIAKEQPSYLKNCVLKPY
FT                   QMEGLNWLITLYENGLNGILADEMGLGKTIQSIALLSFIYEMDTKGPFLIAAPLSTVDN
FT                   WMNEFAKFAPEIPILKYYSQNGQDARQKLLKKFFKNNNREGVIVTSYEMIIRDANIIMG
FT                   EQWKFLIVDEGHRLKNINCRLIQELKRINTSNRLLLTGTPLQNNLSELWSLLNFILPDI
FT                   FADFEIFNKWFDFKDLDLQSNSAKLNKLINDELEKNLISNLHTILKPFLLRRLKSVVLK
FT                   DVLPPKREYIVNCPLSPIQTKFYRMALSGKLKVTVFKELVKAFFTLNQEYIGTVSNKSI
FT                   RDFIDYKLSEEPDEDKVTAVIKQMDDIYMEHLNTFTKNQRLQNMMMQLRQVVDSTLLFF
FT                   FPYMEPEDITLDYLLASSGKLQMLQKLAIPLIKKGHKILIFSQFVGMLDLLEDWSELNS
FT                   FNSLRIDGGVDNESRKEYIDEFNKKGDDHQIFLLSTRAAGLGINLVAADTVIIFDSDWN
FT                   PQVDLQAMDRCHRIGQTKPVIVYRFCCDNTIEHVILTRAVNKRKLERMVIQMGKFSNLK
FT                   KLALNERSFLQQSTGMNPNKTSNKELVQELSQLLMSKESSIGFETSKKPKQDDILTEAE
FT                   LKELSDRSLKFYSPDREVEFPHVRLFETTSGF"
FT   CDS_pept        complement(267249..267695)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000164093" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19349228"
FT                   /locus_tag="CAGL0J02684g"
FT                   /product="Similar to uniprot|P40030 Saccharomyces
FT                   cerevisiae YER044c"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAG60770.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG198322"
FT                   /db_xref="HOGENOM:HBG444695"
FT                   /db_xref="InterPro:IPR005352"
FT                   /db_xref="UniParc:UPI00003B69F9"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPM3"
FT                   /transl_table=1
FT                   /translation="MLSLQQLTGGVHSAVTNMAPGYLPKWLLFISIVSVFNSVQTYISG
FT                   LELTRRVYENKPSETTSLSARTFGTWTFVSCVIRFYGALYITEPHIYQLTFISYIIALF
FT                   HFGSELLIFRTCKLGKGFMGPLIVASTSLIWMYNQKEYYTGLPW"
FT   CDS_pept        complement(267965..269104)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21044856"
FT                   /locus_tag="CAGL0J02706g"
FT                   /product="Similar to uniprot|P29467 Saccharomyces
FT                   cerevisiae YER044ca MEI4"
FT                   /protein_id="CAG60771.1"
FT                   /db_xref="HOGENOM:HBG123600"
FT                   /db_xref="UniParc:UPI00003B69FA"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPM2"
FT                   /transl_table=1
FT                   /translation="MNLSEADWVICIALVKYKLRTISKQNRVYIPLLTDISSFNEDELQ
FT                   YCDLRRHLPSELSKNDKQEELINIFNLMWARRKNWENSLYCCDILLNNRTLLIHLLEDC
FT                   THQRLLLHYYGNYRFLLFYLNQQPCTRPTITTEAATISFRCYELIIISYFGLATNYHVT
FT                   NKGIPNPIKRHLIDGLIFKFIKQELTALITNCPGYLNKSLIIRVQNNMLFLNVCVTSLQ
FT                   KSFIQTVSTIINTMITTRTTVFITNTNVEALMINLVTLLESFVSLLKCHNTKSKTAYAR
FT                   ISSETRECKDKRIYAALYKKNFGKYNHSYKLFLKCVDKTVMFLLCLYKKLRFNKKTDQE
FT                   RMSQSTVAIMQQKRKQILAGLLAARKRELLIKYRKIRWL"
FT   CDS_pept        complement(269575..272382)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000216613" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17438912"
FT                   /locus_tag="CAGL0J02728g"
FT                   /product="Similar to uniprot|P39955 Saccharomyces
FT                   cerevisiae YER047c SAP1"
FT                   /function="ATP binding"
FT                   /function="nucleoside-triphosphatase activity"
FT                   /protein_id="CAG60772.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0017111"
FT                   /db_xref="HOGENOM:HBG191165"
FT                   /db_xref="HOGENOM:HBG203662"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR015415"
FT                   /db_xref="UniParc:UPI00003B69FB"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPM1"
FT                   /transl_table=1
FT                   /translation="MEGTTNKSLFGKLASLGRRPQQPLTDLSELYSKIANESILFLKLE
FT                   EKGRYKQAVQGWKAMTTNVMFQLTMIERQYPHADRYTPEEISLQTGINELYQKSMLHLD
FT                   RVKELNEQYGSQQDNMGNLSYSQVSKGTRINSPVKPLKTHNTSGSIISFSSDNKGRKMN
FT                   TTLRDNVHYTAPKKSNRTANRLAFSGGDNNSLKDAGYREPKVFFATSKPLGQPKLNDHK
FT                   STTADFFDDFDDTAYQDNEFDDPIEDLIDLNSDEDQKFTSPVAIQKSKKVVSENIADLN
FT                   RISKRFTSFNGDEDFEFDVDDYFADDYSDNTDDDSSVDSEQEKQARSQALDKLMGEQKI
FT                   ETNSSISTSSASCKSNASDEDISVPIVPPPLPPLPPLDIQDDKRFWSTKRAELSKINKS
FT                   APTLLGNETGKDLSDINLKKTATNPTEKKSRKTGSLTSLSKPVQKISSNNTKKEVPAKI
FT                   VIPATKPISAAAAAKMVYAKKGATGIPKPNRTKANFSSSVNDQKTMSRPSNLNPTKSVP
FT                   VIKKTSDTQLSTSSKAVKNVKPVLRKTVIKKPAQQKPTSVKINGSTRPTKGVVTSKKPI
FT                   KPTQAKKVVKKVDALEDKKGDPDTNIKQAPDGEADEAKLKEALEDEIINSLPGVDRTAA
FT                   KQIFSEIVVHGDEVHWEDIAGLENAKFSLKEAVVYPFLRPDLFLGLREPVRGMLLFGPP
FT                   GTGKTMLARAVATESHSTFFSISASSLTSKYLGESEKLVRALFAIAKKLSPSIIFVDEI
FT                   DSIMGSRNSDGENESSRRIKNEFLIQWSSLSSAAAGNNREDGDDGRVLVLAATNLPWSI
FT                   DEAARRRFVRRQYIPLPEPETRMVQLKKLLSHQKHNLDDAAFAELLNLTEGYSGSDITS
FT                   LAKDAAMGPLRELGDKLLETTRESIRPLEVKDFKNSLEYIKPSVSQEGLEKYEEWAAKF
FT                   GSSGV"
FT   CDS_pept        complement(273009..274157)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000186929" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19349229"
FT                   /locus_tag="CAGL0J02750g"
FT                   /product="Similar to uniprot|P39101 Saccharomyces
FT                   cerevisiae YER048c CAJ1"
FT                   /function="heat shock protein binding"
FT                   /function="unfolded protein binding"
FT                   /biological_process="protein folding"
FT                   /protein_id="CAG60773.1"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="GO:0031072"
FT                   /db_xref="GO:0051082"
FT                   /db_xref="HOGENOM:HBG336641"
FT                   /db_xref="HOGENOM:HBG447731"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR003095"
FT                   /db_xref="InterPro:IPR015609"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="UniParc:UPI00003B69FC"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPM0"
FT                   /transl_table=1
FT                   /translation="MVKDTEFYDVLGISPEATPSEIKKAYRKMAMLTHPDKHPDDPEAQ
FT                   AKFQAVGEAYQVLNDPALRKQYDEFGKDNAVPQQGFEDAEEYFTAIFGGDGFKDWIGDF
FT                   SLFKELNEATDMMSEDATTDATAAATTSEAGMVKHDGKTDAKDKSGKMTKEQREKLWEM
FT                   EKKRREEVAKQVEELARKLKEKLLQYNLAVKGGHLDDFNRKLDQEVEELKLESFGLELL
FT                   YLIARVYKTKANNYLMAKKTFGFSKIFTSTRDNARTVKSAYNLLSTGMEAQKAMEQMSK
FT                   VDEDQLDQYERAKFENEMAGKALGVMWAMNKFELERKLKDVCNTVLSDKSVSSSERRER
FT                   AKGLLFIASRFASAKRSPEEAEEAKVFEEFILGEKQKHGSKP"
FT   tRNA            274420..274491
FT                   /gene_name="tRNA-Gln (TTG)"
FT   CDS_pept        274876..275187
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000038164" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17438913"
FT                   /locus_tag="CAGL0J02794g"
FT                   /product="Similar to uniprot|Q6Q560 Saccharomyces
FT                   cerevisiae YER048wa"
FT                   /protein_id="CAG60774.1"
FT                   /db_xref="HOGENOM:HBG435467"
FT                   /db_xref="HOGENOM:HBG587877"
FT                   /db_xref="InterPro:IPR008011"
FT                   /db_xref="UniParc:UPI00003B69FD"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPL9"
FT                   /transl_table=1
FT                   /translation="MVARQQVLQLYKQIIKNANQFSNYNFREYFLRKARTEFKANKALT
FT                   DAAKIESLFQGAQRDLGVLKRQSIISQMYTFDKLVVEPVEPVEPVEPVEPVEPVEPKQ"
FT   CDS_pept        275547..277424
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000165892" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17438914"
FT                   /locus_tag="CAGL0J02816g"
FT                   /product="Similar to uniprot|P40032 Saccharomyces
FT                   cerevisiae YER049w"
FT                   /function="L-ascorbic acid binding"
FT                   /function="iron ion binding"
FT                   /function="oxidoreductase activity, acting on paired
FT                   donors, with incorporation or reduction of molecular
FT                   oxygen, 2-oxoglutarate as one donor, and incorporation of
FT                   one atom each of oxygen into both donors"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAG60775.1"
FT                   /db_xref="GO:0005506"
FT                   /db_xref="GO:0016706"
FT                   /db_xref="GO:0031418"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG052213"
FT                   /db_xref="HOGENOM:HBG327986"
FT                   /db_xref="InterPro:IPR006620"
FT                   /db_xref="InterPro:IPR019601"
FT                   /db_xref="UniParc:UPI00003B69FE"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPL8"
FT                   /transl_table=1
FT                   /translation="MKRKAEAQENGNKQLDLEEDKVKGLFNQKLWTPEFREGLKNQIDS
FT                   SAPYNWGNISGLVNDDLLRAVRKEIETEIHFTKKETDIYKVNQSGDLANLSGLNWDDLS
FT                   RLPNMYKLRQILYSDVYRDLIGYVTGAGKLSGSKMDMSVNTYTKGCHLLTHDDVIGSRR
FT                   ISFILYLPDPDRKWKPQYGGGLRLFSSILPNIPETDPCAKFVPQFNEIAFFKVLPGFSF
FT                   HDVEEVKVDKHRLSIQGWYHFPQPGEPGYTPGQEEAWVKNNTSTLTQLETNVLQDFEYP
FT                   KQERDILPYHQVKHFEKVLYAADGKKIDEDEVKSVVQDTDSLSEKEYKYLSQYISAEHL
FT                   TKEGIKKLQEQFLENSTLQIKDFLNEEVSELLKKMIKTEELEKACPYMAKDVETPWQTA
FT                   MPSHKWRYMYIDGKNPRKLLKASDIMEALNNEELPNFELLRETLPKDGSVDVELKLIDL
FT                   AIFYKSTIFKKYLALLTALCPLSEQILIRRFRPGNDFTLATQCRLNEFLQDVEGILPSI
FT                   LVGNLCLTPSSGWESGEVGGYELYMMDDENTEEEERMHKDVEDASVYRTDDNGDSVLVN
FT                   NPPSWNTFNLVLRDQSVLEFVKYVSCAAKSSRWDVKMEWDVKYVGEDNE"
FT   CDS_pept        complement(277727..278209)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248555" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17438915"
FT                   /locus_tag="CAGL0J02838g"
FT                   /product="Similar to uniprot|P40033 Saccharomyces
FT                   cerevisiae YER050c RSM18"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="CAG60776.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG123601"
FT                   /db_xref="HOGENOM:HBG203663"
FT                   /db_xref="InterPro:IPR001648"
FT                   /db_xref="UniParc:UPI00003B69FF"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPL7"
FT                   /transl_table=1
FT                   /translation="MFMVGRICGIESANVAMGLRMVQKRGIVDMRPKKKSVIDVDFEGS
FT                   RENIKTINANFVPQFQRSAVYDPFDFSLSRLNLDRKMNRPKIQHHDLFEKYGLNPLNFY
FT                   ARPEILSYYVGSTGKILHRDVTGLSAKNQRRMAKAIRRCQAIGLMSKTHRFTNFLE"
FT   CDS_pept        278605..279816
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000246712" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17438916"
FT                   /gene_name="JHD1"
FT                   /locus_tag="CAGL0J02860g"
FT                   /product="JmjC domain-containing histone demethylation
FT                   protein 1"
FT                   /EC_number="1.14.11.27"
FT                   /function="histone demethylase activity (H3-K36 specific) "
FT                   /function="metal ion binding"
FT                   /function="oxidoreductase activity, acting on single donors
FT                   with incorporation of molecular oxygen, incorporation of
FT                   two atoms of oxygen"
FT                   /biological_process="oxidation-reduction process "
FT                   /biological_process="regulation of transcription "
FT                   /biological_process="transcription"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG60777.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006350"
FT                   /db_xref="GO:0016702"
FT                   /db_xref="GO:0045449"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="GO:0051864"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG189890"
FT                   /db_xref="HOGENOM:HBG398146"
FT                   /db_xref="InterPro:IPR003347"
FT                   /db_xref="UniParc:UPI00003B6A00"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FPL6"
FT                   /transl_table=1
FT                   /translation="MAVKIEQALGEKRSLNDNDEVPRKKRYNFRKKVELDYSALNEGED
FT                   KKSKFFHPHIALFEKEFEKCLSNVTEDMSMTCSEYCKRFDDIDFPLKISDPENSGMVVS
FT                   TNNKTTRDLTVDDITQAVGDDYFVNVMDVQSQENERWSLREWCNYFNKPAEEKDRIRNV
FT                   ISLEVSHVEDLQYDRPDIVDDKDLVDIVWNNVENLDTENDPRPKVTKYCLMSVKNAFTD
FT                   YHLDFAGTSVYYNLAFGKKKFILYPPTPENIENYIEWSTSTYQNMLFLGEKLTGGVAME
FT                   LNGGDLFMIPSGYIHVVYTPEDSLIFGGNYLTFRDISQQLKIVDVEKQTGVTKRYTFPM
FT                   FDEVMGRTCEWLCQNQKKGKQMQVKKETVNDLISYMKSGKTKYKPTNFINKKQMLQELS
FT                   NLYL"
FT   CDS_pept        complement(279998..281590)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000293094" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19349230"
FT                   /locus_tag="CAGL0J02882g"
FT                   /product="Similar to uniprot|P10869 Saccharomyces
FT                   cerevisiae YER052c HOM3"
FT                   /function="amino acid binding"
FT                   /function="aspartate kinase activity"
FT                   /biological_process="cellular amino acid biosynthetic
FT                   process"
FT                   /protein_id="CAG60778.1"
FT                   /db_xref="GO:0004072"
FT                   /db_xref="GO:0008652"
FT                   /db_xref="GO:0016597"
FT                   /db_xref="HOGENOM:HBG236672"
FT                   /db_xref="HOGENOM:HBG724395"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001341"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR018042"
FT                   /db_xref="UniParc:UPI00003B6A01"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPL5"
FT                   /transl_table=1
FT                   /translation="MAYSTSATSNWVVQKFGGTSVGKFPVQIVDEIVKYYSSSKQDGGF
FT                   DNDVAVVCSARSSYTKQEGTTSRLLKCCDLASQDQEYSDIIETIRQDHVSNAERFLEDS
FT                   PLVAKLIDDTNKELALVDKYLSASKVLGEVSNRTIDLVMSCGEKLSCLFITALCNDRGC
FT                   KAKYVDLSNVVPSDYQTTTLDTSFYTFLVQALKEKLEPFVNSKERIVPVFTGFFGFIPM
FT                   GLLNGVGRGYTDLCAALIAVALNADELQVWKEVDGIFTADPRKVPQARLLDSVTPEEAS
FT                   ELTYYGSEVIHPFTMEQVIRAKIPIRIKNVQNPKGNGTIIYPDNVAKKGESTPPHPPEA
FT                   LSSTFFEKKRRGATAITTKNDIVVLNVHSNKKTLSHGFLAQIFTVLDKYKLVVDLISTS
FT                   EVHVSMALPIPDSDSMKALRSAVEKLKPLGSVDIIKKMSIVSLVGKQMKQFIGIAGTMF
FT                   TTLAEQGINIEMISQGANEINISCVIDEMDSIKALQSIHKKLLDELPENGSGSEQFEKA
FT                   VDERLEQIKRLNL"
FT   CDS_pept        complement(282119..283750)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000112724" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18501406"
FT                   /locus_tag="CAGL0J02904g"
FT                   /product="Similar to uniprot|P40036 Saccharomyces
FT                   cerevisiae YER054c GIP2"
FT                   /protein_id="CAG60779.1"
FT                   /db_xref="HOGENOM:HBG123602"
FT                   /db_xref="HOGENOM:HBG203665"
FT                   /db_xref="InterPro:IPR005036"
FT                   /db_xref="InterPro:IPR016717"
FT                   /db_xref="UniParc:UPI00003B6A02"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPL4"
FT                   /transl_table=1
FT                   /translation="MTYIRAGAVPLQEKSPREKHTANVYAGKMNGAIVGGSGKLTSLQF
FT                   LHKPQRVSQLNKDRFPEEELLRNTQLNKNLHQVDSNYREYSQGPGDGGASERQQARDDL
FT                   IPLSPKSTLPELDTNMLDNTLDSDNSSNDLAPFSPPVYKKSGEPVKSVLKRRSKSLPGT
FT                   PGLNTSMHGASPPNKLMRSKSVHFDQTAPVRYFNENERPIDVSNADIYQQYGAYLNEYG
FT                   IEDRRKAGRAGGLSAMMQEMSLDDKTKERLRALELESKRVDEGYDSTIAAGGQGNAGPK
FT                   LRKSKRFHAIKKKDKDNENNKENVSNPNSTPSSANSSSTSLRDMGTAANQGNTPYSNYR
FT                   TDSGASVSNGGSMFNGSYSGKQQQRVVGLYNENFPILSNKNPKSLKLNIFINLSQGKEV
FT                   FLQELSLHIHRERAFYSPGSGVDIGTPINTRLLSGRVLVKNIFFDKRVLIRYTWDRWRN
FT                   VQDVEGVWVSSAQGLVPGGAAMDVFHFVIDDATKWEGKASLEFCIQYTTRDDTQRLEFW
FT                   DNNCGKNYCVDLVMDGFRNPFANALK"
FT   CDS_pept        283904..284287
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000246549" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17438917"
FT                   /locus_tag="CAGL0J02926g"
FT                   /product="Similar to uniprot|Q02771 Saccharomyces
FT                   cerevisiae YER058w PET117"
FT                   /protein_id="CAG60780.1"
FT                   /db_xref="HOGENOM:HBG058651"
FT                   /db_xref="HOGENOM:HBG395891"
FT                   /db_xref="UniParc:UPI00003B6A03"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPL3"
FT                   /transl_table=1
FT                   /translation="MINEPGGEVIKAGGREGVTAILASIYNQDQTMSRASKITFGVSCA
FT                   VTLATIIGVHYVQELERETLHQGPIKDAKRVAEKKKLMPAGTDEKKLLNRSEHELQQEL
FT                   RKKYESMQPLSGEVVTQDGERVK"
FT   CDS_pept        285162..286709
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000162981" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17438918"
FT                   /gene_name="FCY2"
FT                   /locus_tag="CAGL0J02948g"
FT                   /product="Cytosine permease"
FT                   /function="nucleobase transmembrane transporter activity "
FT                   /cellular_component="membrane"
FT                   /protein_id="CAG60781.1"
FT                   /db_xref="EMBL:ABG43008.1"
FT                   /db_xref="EMBL:ABG43009.1"
FT                   /db_xref="GO:0015205"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG123924"
FT                   /db_xref="HOGENOM:HBG396658"
FT                   /db_xref="InterPro:IPR001248"
FT                   /db_xref="InterPro:IPR012681"
FT                   /db_xref="UniParc:UPI00003B6A04"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPL2"
FT                   /transl_table=1
FT                   /translation="MSYEDKKDLYDMEMQVESSANSHVETDGYNDATVLETKLSLLNRL
FT                   AAMISAETKGIEPITDDEKNDDSLINAASMWFSANMVLPALAIGGLGPLVFGLNFGVSV
FT                   LTIVFFNILGLFAVAFFSVFGAKFGLRQMVLSRYLVGNITARIFALINSVACVGWGIVN
FT                   TVAASQLLNEINPGSHQLPLWGGCLVIIGATILVSFFGYKVIHTYEKYSWVPNFAVFLV
FT                   LIARLKISGKFHNGAWGSGPTTAGSVLSFGSAVFGFASGWTTYAADYTVYMPRNTNSYK
FT                   IFFALVAGLAFPLFFTMILGSACAQAAVDYTPWQEFYNKNGMGGLTFAILVPDSLHGFG
FT                   QFCCVVLAMSTIANNVPNMYTIALSAQSVWDPFAKIPRVVWTMIGNLAALGISIPACYY
FT                   FSTFMQYFMDSIAYYLSIYISIALCEHLIYRHNSFSNYNVEDWNNFKKLPIGIAGTISL
FT                   VVGAFGVALGMSQSYWVGEIARHIGEYGGDIAIELGAGWAFIAYNICRPLELKYFGR"
FT   CDS_pept        complement(286973..288319)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000060166" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17438919"
FT                   /locus_tag="CAGL0J02970g"
FT                   /product="Similar to uniprot|P39525 Saccharomyces
FT                   cerevisiae YER061c CEM1"
FT                   /function="catalytic activity"
FT                   /biological_process="biosynthetic process"
FT                   /protein_id="CAG60782.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0009058"
FT                   /db_xref="HOGENOM:HBG407714"
FT                   /db_xref="HOGENOM:HBG757733"
FT                   /db_xref="InterPro:IPR000794"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR016038"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR017568"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="UniParc:UPI00003B6A05"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPL1"
FT                   /transl_table=1
FT                   /translation="MSRRVVVTGLGCVTPLGKSVKESWHRLLQRDSNGLVKLDQLTKGD
FT                   FAKWRGIFPPELRVGAVSPIESFEVNSQLFTSQDDRRMSRFIKLATIASYEALVSSGLV
FT                   NKETKMSEDGRIPIDQHNQGIDPDKVGCLIGSGIGSIEDIYETSVTFDSNTKKNRINPY
FT                   FVPRILTNMAAGNIAIKFNLRGPTHSVSTACATGNNAIGDGYNMIKLGMQDICLAGASE
FT                   ASVHPLSLAGFLRAKSLSPDGISRPFDEERNGFVLGEGAGIVVLESLESAERRGAPILA
FT                   EIVGYGLSCDAHHITSPPNDGEGASRAIKMALDLSHGNVNARDIEYVNAHATSTKLGDN
FT                   TECCAIQNTLIDNVNRQKPLYISSNKGSIGHLLGAAGAAESIFTILSLYNRTIPHTYNL
FT                   KNVLGNFESSSMRFVKSQPHKVADLEYALCNSFGFGGVNTSLLFRRWHE"
FT   CDS_pept        288611..289303
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000840" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17438920"
FT                   /locus_tag="CAGL0J02992g"
FT                   /product="Similar to uniprot|P40040 Saccharomyces
FT                   cerevisiae YER063w THO1"
FT                   /function="nucleic acid binding"
FT                   /protein_id="CAG60783.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="HOGENOM:HBG058655"
FT                   /db_xref="HOGENOM:HBG396424"
FT                   /db_xref="InterPro:IPR003034"
FT                   /db_xref="UniParc:UPI00003B6A06"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPL0"
FT                   /transl_table=1
FT                   /translation="MSNYSALTVVQLKELLTERNLSVAGLKNQLVERLTNDDKAKEAAG
FT                   EAAPAPVTEEAAPAPAAAPVAAEVEEAKPEEAKPEEETKAEPASNEAAPAVASEQPAEA
FT                   SEDKPAEVQEKAPEVKEPEKELFDILTAEEIKQRATELIDKKLHRAKKFGAEQDQIDSL
FT                   EKLKVRIDRFGVDRNMSIALELGLVKPKEVRQQNRSNKNNNRNGHKGGNNKNRKGRVNK
FT                   NRGSGRRW"
FT   CDS_pept        complement(290111..291832)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19349231"
FT                   /locus_tag="CAGL0J03014g"
FT                   /product="Strain CBS138 chromosome J complete sequence "
FT                   /protein_id="CAG60784.1"
FT                   /db_xref="HOGENOM:HBG123603"
FT                   /db_xref="InterPro:IPR007147"
FT                   /db_xref="UniParc:UPI00003B6A07"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPK9"
FT                   /transl_table=1
FT                   /translation="MPFSLSGYGTTHKIREQLRFTDEIKWKQFSSRRLELIDKFELSKY
FT                   KASEQDDNIKQIANMLRIEFEFPVEATQGFEKLVTAAVQSVRRNRKRSKKKSPSSSSST
FT                   SKRVRKPLTPTPSKTQAKRNRSDSVTSNSSDDGHASDSSSMSHSRASSATTSTAAASPH
FT                   STSASNNGTHITRVNTPSSIASPPSTISLPFHQSVLSPPNQNFQTAVQNILLPLPTSLK
FT                   KSTLLSNNTDSNNMPPAQETQKTLTDDDVARSIMSDLIVLPVINNKEFVDLVKESHTCN
FT                   TIINKQDSQANTGNSGNSGNSGPDVSTIFAVFANMEILGEMVLKSSVSFSVEKNFNDKF
FT                   SKFASTKEYITLKTFQQESLTTFAKNLFNKFNINANTFKQNDSPFIVKLLFIIIGALVT
FT                   DHGFEKTLAVLNPFLEDLTITLFTAPTPTPVAPPEQHQRSKSAVGLDILSTVSLQIDQE
FT                   SQQHNSQMTSNQNNLFAQSNGSQTIKLPQIPRRSQTPSNTLSLPIPAPAASIPPRSVSA
FT                   LTTQSKPDLSVIDNIINRIHQKNTTQNQQVSESNNGMKRHLFKDGNLPHPIAQSLS"
FT   CDS_pept        complement(292534..294195)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000238475" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21044857"
FT                   /gene_name="ICL1"
FT                   /locus_tag="CAGL0J03058g"
FT                   /product="Isocitrate lyase"
FT                   /EC_number="4.1.3.1"
FT                   /function="isocitrate lyase activity"
FT                   /biological_process="glyoxylate cycle"
FT                   /biological_process="tricarboxylic acid cycle"
FT                   /cellular_component="peroxisome"
FT                   /protein_id="CAG60786.2"
FT                   /db_xref="GO:0004451"
FT                   /db_xref="GO:0005777"
FT                   /db_xref="GO:0006097"
FT                   /db_xref="GO:0006099"
FT                   /db_xref="HOGENOM:HBG056305"
FT                   /db_xref="HOGENOM:HBG308645"
FT                   /db_xref="InterPro:IPR000918"
FT                   /db_xref="InterPro:IPR006254"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018523"
FT                   /db_xref="UniParc:UPI00017BD8C0"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FPK7"
FT                   /transl_table=1
FT                   /translation="MPVPNSEANEFQALQARIDADAKEIEQWWSEPRWNKTKRTYSARE
FT                   IAIRRGTFPPLTYPSSVMAKKVYKVLEKHHKEGTVSRTFGALDPVQVSQMAKFLDTIYV
FT                   SGWQCSSTASTSNEPGPDLADYPMDTVPNKVEHLFKAQQFHDRKQWENRAKATSQEELD
FT                   AMGPAIDYMTPIIADADAGHGGLTAVFKLTKMFIERGAAGIHMEDQTSTNKKCGHMAGR
FT                   CVIPVQEHINRLVTIRMCADIMHSELVIVARTDSEAATLISSTIDTRDHYFVVGATNPD
FT                   IEPFAEYMDRAIMAGVSGDELQKLEAAWIEKAGLKLFHEAFADEVNKSSVSNKQEIIKK
FT                   FNDKVGPLTETSHREAKKLAKELLGKDIFFDWDLPRVREGLYRYRGGTQCSVMRARAFA
FT                   PYADLVWMESNYPDFEQAREFAEGVKAKYPDQWLAYNLSPSFNWPKAMSVDEQATFIER
FT                   LGQLGYIWQFITLAGLHTTALAIHKFSEDFAREGMKAYAQNVQQIEMDEGVDVLKHQKW
FT                   SGAEYIDGLLKLAQGGVSATAAMGQGVTEDQFKSNL"
FT   CDS_pept        295476..295949
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000841" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17438921"
FT                   /gene_name="RGI1"
FT                   /locus_tag="CAGL0J03080g"
FT                   /product="Respiratory growth induced protein 1 "
FT                   /cellular_component="plasma membrane"
FT                   /protein_id="CAG60787.1"
FT                   /db_xref="GO:0005886"
FT                   /db_xref="HOGENOM:HBG058657"
FT                   /db_xref="HOGENOM:HBG396390"
FT                   /db_xref="InterPro:IPR022554"
FT                   /db_xref="UniParc:UPI00003B6A0A"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FPK6"
FT                   /transl_table=1
FT                   /translation="MAKKDKKPKVNTIVTKDGESLKVFEDLNDFEMFIKNETEDEEFDH
FT                   IHCKLTYYPPFVLHESHDDPEKIKDTNNSHNKKFVRHLHQHVEKHLLKDIKEALHKPEL
FT                   KFHDKSKDETFEHIVWHYGEETEYHDRKFRIQVTVTCNHDDAMVDVDYKTIPL"
FT   CDS_pept        296729..298591
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248860" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21044858"
FT                   /locus_tag="CAGL0J03102g"
FT                   /product="Strain CBS138 chromosome J complete sequence "
FT                   /function="RNA binding"
FT                   /function="nucleotide binding"
FT                   /function="zinc ion binding"
FT                   /protein_id="CAG60788.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG058658"
FT                   /db_xref="HOGENOM:HBG203669"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR000571"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR003954"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="UniParc:UPI00003B6A0B"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPK5"
FT                   /transl_table=1
FT                   /translation="MINPHVQENLQAIQNTLSNYDTSFLSEDEEDYCPLCIEPMDITDK
FT                   NFFPCPCGYQICQFCYNNIRQNPELNGRCPACRRKFDDESVRYVVLTPEELKMERAKLA
FT                   RKEKERKQREKEKKEYEQNNRKHLAGTRVIQKNLVYVIGVNPPVPPEEVAATLKSDKYF
FT                   GQYGKINKIVVNRKAPHGGSNNDHYHHHAPGYGVYITFSSKDDAARCIAQVDGTYMDGR
FT                   LIKAAYGTTKYCSSYLKGMVCPNPNCMFLHEPGEEVDASNKRELSKPQLHTQNSMNSGS
FT                   FRNGSEFGSAAASPLPLKAHLNSATSSVAANNDSSASTPVLTPAPAPPSTSNPWGISQT
FT                   ASAIANINLSKPNSSINLPTLNDNVTQDNDNNNEVPSKPKPVSNTNTSSSKKKNSSKEY
FT                   VDPYDALNGCITFMNERFKSLSNYQNKTFSLRSDAIDQETLKSYPPLFTASNIKISETS
FT                   ENILTQKLVEILAIKPTDYSQSVIQFLQSVSASQPELINLPSVQSFTSANNAQATQTPI
FT                   NNPINPNLAQLGNGGVMGPGTPGPQNVMLQAMQPPQQMQAQPPQQMQQMPMNMGGNANG
FT                   MFVSPQELAQKQAQPQMAQMQSNNVGSNDLLNQLISGKRLAAAN"
FT   CDS_pept        299422..302043
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000201928" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17438922"
FT                   /locus_tag="CAGL0J03124g"
FT                   /product="Similar to uniprot|Q01217 Saccharomyces
FT                   cerevisiae YER069w ARG5"
FT                   /function="N-acetyl-gamma-glutamyl-phosphate reductase
FT                   activity"
FT                   /function="NAD or NADH binding"
FT                   /function="acetylglutamate kinase activity"
FT                   /biological_process="arginine biosynthetic process "
FT                   /biological_process="oxidation-reduction process "
FT                   /cellular_component="mitochondrion"
FT                   /protein_id="CAG60789.1"
FT                   /db_xref="GO:0003942"
FT                   /db_xref="GO:0003991"
FT                   /db_xref="GO:0005739"
FT                   /db_xref="GO:0006526"
FT                   /db_xref="GO:0051287"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG056300"
FT                   /db_xref="HOGENOM:HBG326956"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR000706"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR004662"
FT                   /db_xref="InterPro:IPR006855"
FT                   /db_xref="InterPro:IPR011241"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR023013"
FT                   /db_xref="UniParc:UPI00003B6A0C"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPK4"
FT                   /transl_table=1
FT                   /translation="MVSVLVSTKGFNPAKFKQASKLLNKSTVGFLSTSAKNKYSLQSKV
FT                   QNIKNSEVPKTFTRSKVGFSKRSLSSSNGIGTSGTRSTVIQLLNNISTKREVEQYLKYF
FT                   TSVSQQQFAVIKVGGAIISDNLPELASCLAFLYHVGLYPIVLHGTGPQVNGRLEAQGIE
FT                   PDYIDGIRITDEHTMAVVRECFLEQNLKLVTALEQLGVRARPITSGVFQAEYLDKSKYQ
FT                   LVGDITKVNKDAIEASIKAGALPILTSLAETPSGQMLNVNADVAAGELARVFEPLKIVY
FT                   LNEKGGIINGETGERISMINLDEEYEDLLKQSWVKYGTKLKIKEIKELLDYLPRSSSVA
FT                   IINVQDLQKELFTDSGAGTMIRRGYKLLKRSSLSEFQSADALRNVLQRDADIASKAQSA
FT                   ATYLRELEKAQFVSYSDEPLEALAIVRTEPKIPKLEKFLCSNSAWLNNVTDNVFSTLKR
FT                   DFPALQWIVSEDDANIAWHFDKSQGSYLKDGKVLFWYGVKDLNTVSELIGEFTKGVTNS
FT                   GHSSGVFGSQQAKRAYSTVRRTPPKPEATNTSPARVALIGARGYTGRNLVALIDSHPYF
FT                   EISHVSSRELKGQKLPDYKKAEIIYDNLQIEDIKKLESENAVDFWVMALPNNVSEPFIE
FT                   AIDSCNGKSKIIDLSADHRFVSEEEWAYGLPEINDREHIYKAKKISNPGCYATGSQLSI
FT                   APLLKYVDGLPTVFGVSGYSGAGAKPSPKNDPENLNNNIIPYALTNHIHEREISTRLGH
FT                   EVAFMPHVGQWFQGIALTVSIPIKKGSIQSNEEAMNIYKDFYKGENLVHIMEDIPSVKE
FT                   IAGTHGVVIGGFKLNDNKDRIVVCGTIDNLLKGAATQCLQNMNLAMGYGEYDGIPKDKI
FT                   VS"
FT   CDS_pept        302881..305565
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000057035" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19349232"
FT                   /locus_tag="CAGL0J03146g"
FT                   /product="Strain CBS138 chromosome J complete sequence "
FT                   /function="ATP binding"
FT                   /function="ribonucleoside-diphosphate reductase activity "
FT                   /biological_process="DNA replication"
FT                   /biological_process="oxidation-reduction process "
FT                   /cellular_component="ribonucleoside-diphosphate reductase
FT                   complex"
FT                   /protein_id="CAG60790.1"
FT                   /db_xref="GO:0004748"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005971"
FT                   /db_xref="GO:0006260"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG006382"
FT                   /db_xref="HOGENOM:HBG296647"
FT                   /db_xref="InterPro:IPR000788"
FT                   /db_xref="InterPro:IPR005144"
FT                   /db_xref="InterPro:IPR008926"
FT                   /db_xref="InterPro:IPR013346"
FT                   /db_xref="InterPro:IPR013509"
FT                   /db_xref="UniParc:UPI00003B6A0D"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPK3"
FT                   /transl_table=1
FT                   /translation="MYVYKRSGRKEPVKFDKITARISRLCYGLDPRIDAVKVTQRIISG
FT                   VYEGVTTVELDNLAAETCAYMTTIHPDYATLAARVAISNLHKQTTKQFSQVVSNLYHYI
FT                   NPATGKHAPMISDEVYQIVMDNKDELDSAIVYDRDFQFNYFGFKTLERSYLLRINGEVA
FT                   ERPQHLIMRVALGIHGRDLEAALETYNLMSLRYFTHASPTLFNAGTPHPQMSSCFLVAM
FT                   KDDSIEGIYDTLKECALISKTAGGIGLHIHNIRATGSYIAGTNGTSNGLIPMVRVFNNT
FT                   ARYVDQGGNKRPGAFALYLEPWHADIFDFIDIRKNHGKEEIRARDLFPALWVPDLFMKR
FT                   VEQNGNWTLFSPSSAPGLSDCYGKEFEELYERYEREGRGKTIKAQKLWYSILEAQTETG
FT                   TPFMIYKDACNEKSNQRNLGVIKSSNLCCEIVEYSSPDETAVCNLASIALPAFIETSED
FT                   GKTSTYNFQKLHDIAKVITRNLNKVIDRNYYPVPEAKNSNMRHRPIALGVQGLADTFML
FT                   LRLPFDSEGAAKLNIQIFETIYHASLEASCELAQKDGPYQSYQGSPISKGVFQFDMWNA
FT                   KPFGMWDWDALRKDILKHGVRNSLTMAPMPTASTSQILGYNECFEPVTSNMYSRRVLSG
FT                   EFQVVNPYLLRDLVDLGIWDEGMKQHIITQNGSIQNLPNIPQELKDLYKTVWEISQKTI
FT                   INMAADRSVYIDQSHSLNLFLQAPTMGKITSMHFYGWKKGLKTGMYYLRTQAASAAIQF
FT                   TIDQSVAQQAANNIADLSNLKRPSYVESEPSYVPSDFKADWENIKPSKITYSETEDESR
FT                   NVSLTPSASSSNDDLSSSVGSLKISEHPATPVSSTTTNIPVKEDKKEVAPEAEDAESEF
FT                   DIYNSKVIACAIDKPEACEMCSG"
FT   CDS_pept        306171..308612
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000066125" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17438923"
FT                   /locus_tag="CAGL0J03168g"
FT                   /product="Similar to uniprot|P32844 Saccharomyces
FT                   cerevisiae YIL068c SEC6"
FT                   /protein_id="CAG60791.1"
FT                   /db_xref="HOGENOM:HBG202973"
FT                   /db_xref="HOGENOM:HBG436393"
FT                   /db_xref="InterPro:IPR010326"
FT                   /db_xref="UniParc:UPI00003B6A0E"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPK2"
FT                   /transl_table=1
FT                   /translation="MVANSMNLADILKDEVSLERVKELKDQLLKEKSTIDYQLSKESNK
FT                   NYEAVQESIKLLNISQKDVIEVKDQLSKVKTLSDESKSSISRYDIIFDATRMYEKVDMT
FT                   SEIYDKIVAFSDTVEQVNRMLDTELAQDGLETGCPYLIQIHYLLTTIRNFQDQMTIMAN
FT                   VSTDDVQRTCQKLFSKVSGLVDKFDQLLESLIYDIVEMIRAENYSLVVRLFKIIDFEER
FT                   EDLRIEAIRNIIKKKEIEAEKSTFKKLPSSKNIGRLELESNSKALEYPTDQGLYQEIIN
FT                   GTITTRVQSRGYKNLLYNKIKQSIQEMFIEVRKEYDGDKKFDVLNNLDWVFNELLVVKD
FT                   YVSKYSPPYWNIFDKYYQFYYDELHILINELVDAEPETIIILDIIDFDKTFQNTLVKDF
FT                   GFKRKETKTVIGDTQKETLFKDYLNLIVIKMTEWLGNLQKTEFKTFKDRSIPPQSDAEN
FT                   LLLLEGTKTCFQMFSQQVEVAAGSSQAKILVGVIEKFSELIENRLSNWISVVDEEVRRL
FT                   MKYNELYDLDPNAIAPENEVPGGLLEYVIALANDQMRAADYAMAIGSKYGAMVTKAYEK
FT                   EIQTNIDNILDRFADVSQVCISALLTIIFDDLKKPYSEIFSKTWYKGSQAQQISDTISE
FT                   YLEDIKVLMNPVLYGLFMERLIENTILGYIGALKYEHSIKNKNNKFLESVKRDFEIFYK
FT                   LFATYIGSSDETIEIVKEKFEVMDYFMDLCCEPIDSVMGIWDNFLQRYPDVPVVILEFV
FT                   LKSRKDIDRSRRKKLVQRAIDLSLRPEHLAFISSEEYEPSYLSNFTIKSAKKSEDVGDD
FT                   Y"
FT   CDS_pept        complement(308707..309045)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000142337" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17438924"
FT                   /locus_tag="CAGL0J03190g"
FT                   /product="Similar to uniprot|P40045 Saccharomyces
FT                   cerevisiae YER071c"
FT                   /protein_id="CAG60792.1"
FT                   /db_xref="HOGENOM:HBG203670"
FT                   /db_xref="HOGENOM:HBG252690"
FT                   /db_xref="InterPro:IPR005334"
FT                   /db_xref="UniParc:UPI00003B6A0F"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPK1"
FT                   /transl_table=1
FT                   /translation="MVIEKIDDKSSNSPLTAPRLIDLIESQFSESQVSADTLIQHILES
FT                   LNKHSSQYKYIVSVTSIDIPTESSSSCEIDNKFGASWNAKKDGFLTHVLEDKHAGKNHV
FT                   VSVAWLSK"
FT   CDS_pept        310357..311910
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000271505" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17438925"
FT                   /locus_tag="CAGL0J03212g"
FT                   /product="Strain CBS138 chromosome J complete sequence "
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAG60793.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG439831"
FT                   /db_xref="HOGENOM:HBG752218"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniParc:UPI00003B6A10"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPK0"
FT                   /transl_table=1
FT                   /translation="MFSRTITRTLRAPAVLRLYSTNVPLEVPVTLPNGIKYMQPTGLFI
FT                   NGEFVKSHEGKTFDVLNPSTEETIATLYEAQAADVDIAVKAAKEAFENHWSREDPEVRA
FT                   RALFNLADLVEANLETLAGIDSLDNGKSLLCSRADVALVAKYLRSCGGWADKIYGDVID
FT                   TGKSHFTYSVKEPLGVCGQIIPWNFPLLMWSWKIGPALATGNTVVLKPAELTPLSALFA
FT                   SKLCQEAGIPAGVVNIIPGPGKTVGERICTHPDIKKVAFTGSTATGSRIMKTAADSIKK
FT                   VTLELGGKSPNIVFADADLEQAVENIAHGIFFNSGEVCCAGSRIYVQDKCYDEVLDRLK
FT                   KYTESLKVGNPFGDNTYQGSQTSQQQLDKILEYVDIGKQEGARIVTGGERIGEKGYFFK
FT                   PTVFADVKENMRIVKDEIFGPIVTVSQFSTVDEVIAMANDSQYGLAAGIHTNDVNKAVE
FT                   VSSRLKAGTIWINTYNAFHQNVPFGGFGQSGIGREMGSAALDNYTQVKSVRMAITKPRV
FT                   "
FT   CDS_pept        join(313017..313019,313621..314025)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000186306" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18501407"
FT                   /locus_tag="CAGL0J03234g"
FT                   /product="Strain CBS138 chromosome J complete sequence "
FT                   /function="nucleotide binding"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="CAG60794.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG008282"
FT                   /db_xref="HOGENOM:HBG316677"
FT                   /db_xref="InterPro:IPR001976"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR018098"
FT                   /db_xref="UniParc:UPI00003B6A11"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPJ9"
FT                   /transl_table=1
FT                   /translation="MSDSVTIRTRKVITNPLLARKQFVVDVLHPNRANVSKDELREKLA
FT                   EAYKAEKDAVSVFGFRTQFGGGKSTGFGLVYNSVADAKKFEPTYRLVRYGLAEKVEKAS
FT                   RQQRKQKKNRDKKIFGTGRRLAKKVARRNAD"
FT   CDS_pept        join(314612..314702,314870..314977,315081..315166)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000192480" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17438926"
FT                   /locus_tag="CAGL0J03245g"
FT                   /product="Similar to uniprot|Q3E834 Saccharomyces
FT                   cerevisiae YER074W-A YOS1 Hypothetical ORF "
FT                   /protein_id="CAR58043.1"
FT                   /db_xref="HOGENOM:HBG607174"
FT                   /db_xref="InterPro:IPR013880"
FT                   /db_xref="UniParc:UPI00017BD8C9"
FT                   /db_xref="UniProtKB/TrEMBL:B4UN27"
FT                   /transl_table=1
FT                   /translation="MIFGLGRLFYVTLLLINAVAVLSEERFLSRIGLGRSGSEAPAFGQ
FT                   NANSTKSKVVQLIGAVQTLLRNRTMQELTHSVPLIGINILVIVYELLLG"
FT   CDS_pept        complement(315380..318034)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000115788" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19349233"
FT                   /locus_tag="CAGL0J03256g"
FT                   /product="Strain CBS138 chromosome J complete sequence "
FT                   /function="protein tyrosine phosphatase activity "
FT                   /biological_process="protein dephosphorylation "
FT                   /protein_id="CAG60795.1"
FT                   /db_xref="GO:0004725"
FT                   /db_xref="GO:0006470"
FT                   /db_xref="HOGENOM:HBG058350"
FT                   /db_xref="HOGENOM:HBG203671"
FT                   /db_xref="InterPro:IPR000242"
FT                   /db_xref="InterPro:IPR000387"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR016130"
FT                   /db_xref="UniParc:UPI00003B6A12"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPJ8"
FT                   /transl_table=1
FT                   /translation="MDSSSPTGDSDFKCAIRQMAPPSLDIPHSNGSSIVRSPLVKSVTS
FT                   PVFAPSIKQASTFKKPSGCALVSALECNRILENKDIIVLDLRTYSEYSKSSIRDSIHVG
FT                   LPSTLLRRKNFDFNKLVQNLPVDDRVRLENKMNAMALEAKKLSFLIYDNTPNQTDTSLS
FT                   LPCYGVATKISEYRNQDERMENCGLYILNVGYSVFKLLFPDDVIESTETCLKNITECSA
FT                   MNSPMVEHPDLFIPMPHNINTSGEEYIRQTVNGLSFSPSLASTATKSPSISGSSINNSM
FT                   TNSNDFSLESPVSTSSPISALFKFQLPNRQQLASPVFKLPQNEEALSLEDYISAVNARE
FT                   NQENRTKEFKFQSFEFPKKHQSAEYSTRSPNEDKLNFQRKYAKLCTEYNDDLINEVIPQ
FT                   WFQELVTKSKVEIISQFQKLDYLERRRLNKSISKHKSTKSALTTISRPELSKMTPIDEK
FT                   SFDFNSNKGSMSTQIKRKKSQKRSYSQPNCSYLKSDWKCCIDVDDMEDEHDIEISSGVE
FT                   LGVKNRYKDIFPFENTRVKLKRRSVSSLSSSQEQTPNHSRDNSLVNKLNDLTLTQPVDN
FT                   YINANYIELPSLPNTLSDQKKELLKNLSAGKGRNCRYIATQAPMKTTVHDFYTCLLNNK
FT                   VPIILSLTDTFENGIEKCVQYWEDGDYEGFKVKLLEEIEVPKSYGTESEPADKDNKNDI
FT                   VLRRINIEYDEAGCNYEVIQIQIRNWPDLGVLTDPTNIIQIIHLKNSIIDSLFERKMYQ
FT                   PGTRPTVLVHCSAGCGRTGTWCTIDSVISNLDVFEVLRNELQVEMKGKVYDPISWTINT
FT                   FRKQRISMVQNVNQFLFIYDSLVCYFSLCLENHGKKDILTKPLSAIYDQSRHIKSLNEF
FT                   VDKKMKEVEPIFI"
FT   CDS_pept        complement(318843..320753)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18501408"
FT                   /locus_tag="CAGL0J03278g"
FT                   /product="Similar to uniprot|P40050 Saccharomyces
FT                   cerevisiae YER077c"
FT                   /protein_id="CAG60796.1"
FT                   /db_xref="HOGENOM:HBG123605"
FT                   /db_xref="UniParc:UPI00003B6A13"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPJ7"
FT                   /transl_table=1
FT                   /translation="MSMIAVKVSRVTVRFYHGSLVNFGNTNLKEKLHVLKKKSTVIRKS
FT                   SKELQRLAEKQKIKRNKAQKASYHKDRAVHILKSKYGISDISRDQLGPTSENDIKFLSK
FT                   IKDNRLLYTILGVNGFQLRDAILVTKDVEKFLKRGQVEKAVMLVKLAKAKGSSGANLIM
FT                   DYYLNELHSPKSAVDMYNWRKKNGIPINEYTDVTLFDGLAKQPEPISTKYGEMVLKILD
FT                   SKGEDEEFNIREFNAALGALTNCTDYSLAFQLFDSRSQRYSRKFDAITFTTMIKACNKI
FT                   KDEDLLISMLNEIIAKMTHRSIDPMLVNQLVSALSGSDRSKRLNREALLLASEVFTLDL
FT                   GISDSGVERRIHYDVIKESMRSRGDGLRQDKLYPSIIQACNYSDLPQIGIKFFAKITGF
FT                   PYENETGGEQALLEGPQLTYQLFKNYIDLLVRHRTSVCGSRSMDLFETINSTPSLKQLP
FT                   MKVLLRHVYTAVQRQGNKQSVYCDATRANALLQRVNEFVKHVEPTKDNVVPLAAWKFVL
FT                   PIAEKLQQGSQLSEEPQVHLTQSFLSTISALRLPLNKEAKSTLLAGIRVINSLGEQLRL
FT                   PPTVDLEDIPLELRDKFLYRRLLLRVKTRLVHIVDSIDKNTPQLPDDLSQLISQLGLHK
FT                   R"
FT   CDS_pept        complement(321030..322493)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000008762" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17438927"
FT                   /locus_tag="CAGL0J03300g"
FT                   /product="Similar to uniprot|P40051 Saccharomyces
FT                   cerevisiae YER078c"
FT                   /function="aminopeptidase activity"
FT                   /function="manganese ion binding"
FT                   /function="metalloexopeptidase activity"
FT                   /biological_process="cellular process"
FT                   /biological_process="proteolysis"
FT                   /protein_id="CAG60797.1"
FT                   /db_xref="GO:0004177"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="GO:0008235"
FT                   /db_xref="GO:0009987"
FT                   /db_xref="GO:0030145"
FT                   /db_xref="HOGENOM:HBG445006"
FT                   /db_xref="HOGENOM:HBG545079"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001131"
FT                   /db_xref="InterPro:IPR007865"
FT                   /db_xref="UniParc:UPI00003B6A14"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPJ6"
FT                   /transl_table=1
FT                   /translation="MTMMLRRYLSNGAKFVNRPKVQWNLGQRLHENRPFLLQPGELTPG
FT                   ITAAEYYQRRAELVRNLPVGSCLIILANQIKFASGAVFYPFQQDNDLFYLTGWNEPDSI
FT                   MVLEKPSENIEDHELTMFVPPKNEFKEKWEGFRTGVDAVKEFFNADHSYSVDNSMSMVN
FT                   ELAKIIKRNKGIYFDPDSNKNSKINSNILNLIKETNKGTPKKLKSLVADLRKVKSESEI
FT                   RLMRRAGQISGRSYNMAMAQRFRNERTLHTFLEHKFISGGCDKSAYIPVVATGPNALCI
FT                   HYTSNDDVMYDDEMVLVDAAGALGGYCSDISRTWPVAGKWPSSAHKDLYEAVLNVQRES
FT                   LKNCKKALENNMSLHDLHEASVKLTKQELKNLNFSKATEIAEKLYPHYIGHNLGLDVHD
FT                   VPEVSRFNPLVEGQVITIEPGLYIPDSPEYPAEFRNIGIRIEDDVVLKKDGYINLTVEA
FT                   VKEIKDIENVMQNGTTTDFEDDVVSPLQG"
FT   CDS_pept        322732..324672
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000246542" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17438928"
FT                   /locus_tag="CAGL0J03322g"
FT                   /product="Similar to uniprot|P40053 Saccharomyces
FT                   cerevisiae YER080w"
FT                   /protein_id="CAG60798.1"
FT                   /db_xref="HOGENOM:HBG058354"
FT                   /db_xref="HOGENOM:HBG395482"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniParc:UPI00003B6A15"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPJ5"
FT                   /transl_table=1
FT                   /translation="MLRIPSRIGSRQVLACAGRNLKCGSVMRHISRRNISKEPEKVYTN
FT                   LADVNDPKRDQFFKYTWGTWLQNDKLEKDKRTTKFSLNGLNSVLDDIYRQATKNTKDNF
FT                   KSETEIVPQPLTNKNRTVSMPNNIAITKLGTLNPNEKSVTIKTIASVHEGKHHRIYKVQ
FT                   TNLSDEKSFVLRIPYQLDDDKATISHRIRSEVATLDFLDLQLKMKVPKVICYAADDGNP
FT                   LGVPFILQEYIDGSLLMKDWNPLMDDKALMVETGEGSTENPELASLNKVVKSMADFHAK
FT                   LNSISFNAAGSIYFKNDSNLNSETVIDNISNDLASNLKDRWVLGPSVERRLWKKKSDLA
FT                   IEERLKYLGPWKEDKETSISAQILRDTAILELKNAEARLAKSEQNGSKDKNTETLIKKQ
FT                   IETFQNVEKISGDLISSEMKAIPNIKDLLKPTIFHPDLDPMNVLIENKTETPFMLDLEG
FT                   AVVKPFILQSSPQFVAYDGPKIYNMKSDIPEFEKLSEEERKHYEFMYKRTRNQFLWEKA
FT                   VNERLPNLIMTVAPPVKVLRRPYTAVLEQKTDNDYILVDDSFFQLREAWAFFFKNGLVT
FT                   KEEFPLTFTDEQVKQHADDLNSLHEKLVSTPFAATQGWVPQDMFDNLVRAGVIIKDSTG
FT                   NFTVNDINPSA"
FT   CDS_pept        complement(324829..326460)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000165037" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21044859"
FT                   /locus_tag="CAGL0J03344g"
FT                   /product="Similar to uniprot|P40055 Saccharomyces
FT                   cerevisiae YER082c"
FT                   /protein_id="CAG60799.1"
FT                   /db_xref="HOGENOM:HBG330635"
FT                   /db_xref="HOGENOM:HBG356743"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR012952"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="UniParc:UPI00003B6A16"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPJ4"
FT                   /transl_table=1
FT                   /translation="MSTEKYRRNANVQRKGVKKTKDVYKTKDKKLKANLRKQDKRYKEA
FT                   VESASATEFLLPESSGFMEAETEMEKTFRVKQDEIRDSVDVLTASKGIDLKLNDFGPYH
FT                   VNFNRNGTHMLITGLKGHVASMDWRKGELRAELNLNETCNAACYLQNEQFFAVAQKKYT
FT                   FIYDHEGVELHRLKQHIEARHLEFLPYHYLLATAGQTGWLKYHDVSTGQMVSELRTKLG
FT                   PTTSMTHNPWNAVMHLGHSNGTVTLWSPSMPEPLVKLLSGRGPINSVAVDRSGYYMATV
FT                   SQDKSLKIWDIRNFKELHSVENLPTPGTNVTISDTGVLAVSRGPHVTLWKDALKSSKSA
FT                   RPCFGSINGDPNRNTPYMTQLFPGNKVRNMKFVPFEDLLSVGHESGVTNLIIPGAGEAN
FT                   YDALEINPFETAKQRQEQEVRTLLNKLPADSISLDPNVIGTVSSKAAATRLTAKDLEQV
FT                   TLQQDNVKNDNSDIPQVKVDTKGKNSGLRAFMRKKTKNVIDERKVRVQKLIEKEKQLRD
FT                   RKHKISKGELDENYTDVVDSALGRFK"
FT   CDS_pept        complement(326713..327555)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000066100" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17438929"
FT                   /gene_name="GET2"
FT                   /locus_tag="CAGL0J03366g"
FT                   /product="Golgi to ER traffic protein 2 "
FT                   /biological_process="vesicle-mediated transport "
FT                   /cellular_component="Golgi membrane"
FT                   /cellular_component="endoplasmic reticulum membrane "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAG60800.1"
FT                   /db_xref="GO:0000139"
FT                   /db_xref="GO:0005789"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0016192"
FT                   /db_xref="HOGENOM:HBG058353"
FT                   /db_xref="HOGENOM:HBG203676"
FT                   /db_xref="InterPro:IPR014802"
FT                   /db_xref="UniParc:UPI00003B6A17"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FPJ3"
FT                   /transl_table=1
FT                   /translation="MSLSEAEKRKILRERRQQKFSRGGASERLNKIVGGQGSQLDTKSA
FT                   LDEKPEVVEEIPREAVKPEMNSSVQAKKESTAQAKAEDPQVELFRQLAEMQGQGATEST
FT                   PDLFSMMKNLGATGDSPFPMAEQQVEAIDPELVEYHKYRVNTLTAKTTLVKWIVLLAYI
FT                   FLLTRTDDTYFPFVVRSYLPEVFTSQSSFFSIFLTFEILATSIYYQLSVGVERETGVKT
FT                   LQDTSKIVSLVSMVPEGILPIADLRGKVILAMKYWNIIAMMIGDVCFVLVAIGLVSQI"
FT   CDS_pept        327822..329105
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18501409"
FT                   /locus_tag="CAGL0J03388g"
FT                   /product="Strain CBS138 chromosome J complete sequence "
FT                   /function="nucleic acid binding"
FT                   /function="zinc ion binding"
FT                   /protein_id="CAG60801.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG123667"
FT                   /db_xref="HOGENOM:HBG203314"
FT                   /db_xref="InterPro:IPR001878"
FT                   /db_xref="InterPro:IPR013084"
FT                   /db_xref="InterPro:IPR016713"
FT                   /db_xref="UniParc:UPI00003B6A18"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPJ2"
FT                   /transl_table=1
FT                   /translation="MATFVEDTKGEKMLAPSIEDVNEDPDELRSIRGQSRYFGETEDDT
FT                   IKEPEAKCSNCSETGHFKRDCPHVICSYCGVMDDHYSQQCPTTMRCALCNESGHYRMHC
FT                   PLKWKKLNCTLCNSPKHLRNRCPSVWRVYLLKNEDNKRKVLPMHQIYCYNCGDKGHYGD
FT                   ECDKARSSRVPNDDGSAFSGKNLSSELRGQYTHNIDRQRSSQDMVSSVYDNLRSSQPIA
FT                   YQVGSDRGSLLEDSDKQTDSNRPSRFSNTKIDTARLSKTPARYVQDRSSKNKRKFKDSL
FT                   YDDGEDDEDEEDQLYKENSRHDNHKRSDRRSRYGNKKTNGNSGYNQQQSHFYRPPYQGY
FT                   QSASYEQYPSQNSGYEHHSGILPTRSGVNVGATNTGHYQQQYYQNNSSTYPPQNMIYNQ
FT                   QVPMSAYAPPAPTPVKPSRSGVIKRYDE"
FT   tRNA            complement(329320..329393)
FT                   /gene_name="tRNA-Ile (AAT)"
FT   CDS_pept        330031..331899
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000142336" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17438930"
FT                   /locus_tag="CAGL0J03432g"
FT                   /product="Strain CBS138 chromosome J complete sequence "
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="CAG60802.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG190562"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI00003B6A19"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPJ1"
FT                   /transl_table=1
FT                   /translation="MNTPHIPKYEPGTTVTVGSHSVHILKYLTSGGYAQIYSAQIMPAD
FT                   QFLGTNMAVLKRVIVPDKSHLNTLRAEVDAMKRLKHHKYIVSYIDSHAAKSQYMDGTYE
FT                   VFLIMEYCSRGGLIDFMNTRLQNRLTETEILTIQLHISQGVAAMHTLQPPLIHRDIKIE
FT                   NVLISNDHKYKLCDFGSVSGYIRPPKTPEELAYVRHDIMMSTTAQYRAPEMLDLTKGFS
FT                   VNDKSDIWALGVFLYKLCYYTTPFEQTGEAGILNGGVEFPPYPHYSDAVKQLIMSMLAK
FT                   NPLHRPNIFQIIQTVSKLLNVNCPIPNIHVPTDISIAVSNNNTGNMSINGYYKPMNQNS
FT                   GISTPHSAGKMLAGFQNDMPKPSTKLGKQELFSRSKTVPNDIGGLNERSDISAFLLRKK
FT                   AELEATPNPLESSKYIDDDSSSTTSEDSFDDHASFISKTQSAHSVSTVDRFNAYLKAND
FT                   SISEEDSDESFMPGASHLNRFRSDTQETSNKRQTKDEILLKRRSLPFTNNEARRNQSTD
FT                   SELDTLSKAEKKEQLRQRMMSALNASEDVIKKTKSRDGSVSNDNNYLLKSKLHGRRDNE
FT                   QRFSSVVVNPLDNSNNLPTKKTPPVKPPKPDHLKPKVPPKPAFLKT"
FT   CDS_pept        complement(332090..334171)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000161343" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19349234"
FT                   /locus_tag="CAGL0J03454g"
FT                   /product="Strain CBS138 chromosome J complete sequence "
FT                   /protein_id="CAG60803.1"
FT                   /db_xref="HOGENOM:HBG058578"
FT                   /db_xref="HOGENOM:HBG738492"
FT                   /db_xref="InterPro:IPR000286"
FT                   /db_xref="InterPro:IPR017321"
FT                   /db_xref="InterPro:IPR019154"
FT                   /db_xref="UniParc:UPI00003B6A1A"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPJ0"
FT                   /transl_table=1
FT                   /translation="MGVELKQEPGESKRKLEDDVASQDVKRPVIVPTRKAQIHYTPLKT
FT                   GICYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVNDIGDL
FT                   MLKIPIRAATAEEILEVHSKEHLEFIEKTEKMNREELLKETEKGDSVYFNNDSYATSRL
FT                   PCGGAIEACKAVVEGRVKNSLAVVRPPGHHAEPEAAGGFCLFSNVAVAAKNILKNYPES
FT                   VRRILILDWDVHHGNGTQKAFYDDDRVLYISLHRFELGKYYPGTIQGQYDQIGEGKGKG
FT                   FNCNITWPVGGVGDAEYMWAFEQVVMPMGREFQPDLVIISSGFDAADGDTIGQCHVTPS
FT                   CYGHMTHMLKSLARGNLCVVLEGGYNLDAIAISALSVAKILIGEPPDELPDPLREPKAE
FT                   ALEIIDKVISLQSKYWKCFGKRYGNLGLPSENVVKALMMSKSFPLQTAIRQEQFHQLSE
FT                   DFGFVTLPLLNMEVPQDSVICSPNLFNETTILVVVHDTPEIWAKRNVITGTIDPSTSLV
FT                   VDSGAEFIKWGLERKYGIMDINIPQSLFEQENYTAVLTSQEILIYIWDNYLKFFPSLTK
FT                   VAFIGIGDASAGIVHLLGHRDTRSVVKSVVSFIGKKSLKPLVPLVNESLGDWYFKNSLV
FT                   FTDHSHSCWGDNENRKPRKKFGRVLRCDAEGMNNIIEERLEESTDFILDSFEEWSDSE"
FT   CDS_pept        334536..336089
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000091641" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17438931"
FT                   /locus_tag="CAGL0J03476g"
FT                   /product="Similar to uniprot|P25382 Saccharomyces
FT                   cerevisiae YCR072c"
FT                   /protein_id="CAG60804.1"
FT                   /db_xref="HOGENOM:HBG051997"
FT                   /db_xref="HOGENOM:HBG330076"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR012972"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="UniParc:UPI00003B6A1B"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPI9"
FT                   /transl_table=1
FT                   /translation="MSTQLPPPSKKQKKEAQNAREVVGLVPEDVPHVSIKFKAEDTGEF
FT                   VGGTLRVPGGITEKQLEELLNQLNGNGEDPVPYTFSCTVKNTKNAVTTTHTVDIVDNIY
FT                   SSLLKPGHNSTEDIITLDFQPRAVFKVKPITRSSSAIAGHGATILCSAFAPHTSSRVVT
FT                   GGGDNTARIWDCDTQTPKVTLNGHRNWVLCVSWSADGEVIATGSMDNTIRLWDAESGKP
FT                   LGDALRGHSKWITSLTWEPIHLVEPGSKPRLASASKDGTIRIWDSSRRVCLMTLGGHTN
FT                   SVSCVKWGGEGILYSGSHDKTVRAWDMKQNGKCINILKSHAHWVNHLSLSTDYALRVGA
FT                   FDYTGVKPANAKEARDKALQNYEKVARKNGKHEELMVTASDDFTMFLWNPLKGTKPISR
FT                   MTGHQKLVNHVAFSPDGKYIVSASFDNSIKLWDGKEGTFLSTFRGHVASVYQVAWSSDC
FT                   RLLVSCSKDTTLKVWDVKTRKLSVDLPGHQDEVYTVDWSVDGKRVCSGGKDKMMRLWTH
FT                   "
FT   CDS_pept        336384..336755
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000907" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17438932"
FT                   /locus_tag="CAGL0J03498g"
FT                   /product="Similar to uniprot|P25642 Saccharomyces
FT                   cerevisiae YCR071c IMG2"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="CAG60805.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG123606"
FT                   /db_xref="InterPro:IPR007740"
FT                   /db_xref="UniParc:UPI00003B6A1C"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPI8"
FT                   /transl_table=1
FT                   /translation="MLSRVARRNGVFVRFQSSAVFPSVSEVRNDELVGHGSYTSKSYFV
FT                   ERSRVGNLPVYSDYRGGGNKVVTEIRRIRGNAVQLKKDLQAVLPHIPEKDWRVISQSNK
FT                   IEIKGNYISELKSVLSETF"
FT   CDS_pept        complement(336992..337960)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000065981" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20196052"
FT                   /locus_tag="CAGL0J03520g"
FT                   /product="Strain CBS138 chromosome J complete sequence "
FT                   /function="peptidyl-prolyl cis-trans isomerase activity "
FT                   /biological_process="protein folding"
FT                   /protein_id="CAG60806.1"
FT                   /db_xref="GO:0003755"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="HOGENOM:HBG057999"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR015891"
FT                   /db_xref="UniParc:UPI00003B6A1D"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPI7"
FT                   /transl_table=1
FT                   /translation="MLANILLFLFTMLFSMQSTLADSADVDLRSMYAPDPPATNRISMT
FT                   ISYFPKGSDVKKEVDFSIDVYGTVCPKARDNFITLIRGIKAVIEGRGSGVMTLRYPGTK
FT                   FTNVLPNKYILGGEILPGISPYSIYGDKWPEENFDLKFDRPGRIAMWNHGQGKQESQFF
FT                   ISTNPKPDTELDGRYSIFGQVVSGLDVILNEVQHAEVSSTKDMILKYMVKEDLRLAKPD
FT                   ELHAKWLKRLEEYNNGDKTKGVSIARYFKAEETAAIPKKMPANALYNGYVRHSGFPLFK
FT                   VFFILVSLAVCFYVFKHRAEFLKRTNIVSLKQWRSVPETKA"
FT   CDS_pept        complement(338756..340270)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000034133" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20196053"
FT                   /gene_name="ATG15"
FT                   /locus_tag="CAGL0J03542g"
FT                   /product="Putative lipase ATG15 "
FT                   /EC_number="3.1.1.3"
FT                   /function="triglyceride lipase activity"
FT                   /biological_process="autophagy"
FT                   /biological_process="lipid catabolic process"
FT                   /cellular_component="Golgi membrane"
FT                   /cellular_component="endoplasmic reticulum membrane "
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="multivesicular body membrane "
FT                   /protein_id="CAG60807.1"
FT                   /db_xref="GO:0000139"
FT                   /db_xref="GO:0004806"
FT                   /db_xref="GO:0005789"
FT                   /db_xref="GO:0006914"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0016042"
FT                   /db_xref="GO:0032585"
FT                   /db_xref="HOGENOM:HBG192013"
FT                   /db_xref="HOGENOM:HBG398588"
FT                   /db_xref="InterPro:IPR002921"
FT                   /db_xref="UniParc:UPI00003B6A1E"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FPI6"
FT                   /transl_table=1
FT                   /translation="MLGRQVTMLLKVIVAVAVLFVWHRSRDSSRGDGSNGDGLSDSSGN
FT                   GFRLEHIWAYDPEDVVSSCVDVSEEMRVSADEYVSMESGSEFVESWWAKTGARPFSHVF
FT                   DLRSRSMDIQRLQDRDPVSMEKYIDFSLENPELARTIELEWETAKIQVPDVRNRNTVLA
FT                   LALMSSNAYVRTPYTGDWRNLSSSWGHTGEEKFGWDKDGLRGHIFVNKITKVVVIAIKG
FT                   TSSQGLFGSGEEDTITNDKINDNLLFSCCCARISYLWTTVCDCYMKSYTCDENCVEAEL
FT                   KRKDRYYAATLKLYKQVTEMYPDSAIWLTGHSLGGALAALLGRTYGVPAVTFEAPGELL
FT                   PAKRLHLPLPPGLPDYEEAIWHFGHNADPIFMGTCNGASSSCSIGGYAMETACHSGQYC
FT                   MYDVVNDKGWRVNLLNHRIHRVIDEVILEYGRPAKCQRAPTCIDCYNWKFVNKRRNRRE
FT                   ESSSSIASSSQLTSSHSESETLTSTDAPEKTCIGRNWLGICTDYGV"
FT   CDS_pept        340647..343736
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20196054"
FT                   /gene_name="SED4"
FT                   /locus_tag="CAGL0J03564g"
FT                   /product="Putative guanine nucleotide-exchange factor SED4 "
FT                   /function="GTPase activator activity"
FT                   /biological_process="protein transport"
FT                   /biological_process="vesicle-mediated transport "
FT                   /cellular_component="Golgi membrane"
FT                   /cellular_component="endoplasmic reticulum membrane "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAG60808.1"
FT                   /db_xref="GO:0000139"
FT                   /db_xref="GO:0005096"
FT                   /db_xref="GO:0005789"
FT                   /db_xref="GO:0015031"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0016192"
FT                   /db_xref="HOGENOM:HBG123607"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="UniParc:UPI00003B6A1F"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FPI5"
FT                   /transl_table=1
FT                   /translation="MVFDSEYDLGYPVYGAQFLSDGMLLVAGGGGVGVMIPNKLTALRV
FT                   NFEKKKVLKRYREITLDSQDDSPSNLGVAQNMILMGCNEGYDKISSTGENHHIRKFVFE
FT                   NDHLKFIGAIDFDGSTDPEVYTKLICMSKDGTIAAIASSKLPTVIRIIDPIDLTEKYEI
FT                   ETGRDVRDIHFSPDGKLLVYITATSLEVVSVVTGRFLFRKTDFNKATDLARVKFINDDD
FT                   FVLASGFKDKAGIALTTFRIRNTNPTILSSKKVFKDYKKITAMDVDPKGQLIALTTDDN
FT                   SLALLSVKKLNVIKLFKQVHKDTITRVTVSPGGQYVATGSTDKTVHIFKISPDAMGGSN
FT                   LWKSLLRFLFNVMKLAVVVIWAHLFYKYDLHHKLYDVTKVQLEKRSIEFPSFLDGILGT
FT                   TTTRSTIIEGDIVSVVTDTAPALTSSVFSEDNKEYAKVEETTPSNSWSSVSESYWPSEV
FT                   SNDIESVQENFDDIENKILENEDVVMKNDAIETEDESVGFDIDDTIKPIAPIDIDLELD
FT                   DPLASTSVDTSEVLSSQVPVQLETLSGQSEIIDDKPEHLDEEVSEGFLGDHSKANLETE
FT                   IENASTSISIEESTNSHSTFIESSSSLEEGRNTTSESSREISSETSIIKEDMLYPTENV
FT                   SEQSATDKVNKNQSIDKIDVSSSSSIPTSSEGSSNSIVGDEAQMHISSLSSIETELSSS
FT                   SIMINEESTIRNADSVVDENHSESKLPTEAKTSIVGSIDNENIDSTELNNLEEAVKTSS
FT                   NESSLSQVTEELVKNNERVSNQSLSTVSTEHTEMKESSNLTEKKPESNSPESNLSESSL
FT                   QTHDFSQISDTERNIVSSSAFVTDLPSEEASVNPGNTEGTIVNASLVDSQSSNSSVKTV
FT                   ETNVSQDEQTSQNETLSVGAATIDVIQGSYTSVSDSLDGMNNEEVGNKVHIEDVSNTLE
FT                   IDSSASALSEQGDNQFSDSTPEVVNVINEFTTTPENETSSPLASSSTTFMTESPSPIAV
FT                   ANEVIENIQQDEQVAQQMEDTNSGSSNFQDTQHNVINDEL"
FT   CDS_pept        complement(343893..345128)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000248313" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17438933"
FT                   /gene_name="RAD18"
FT                   /locus_tag="CAGL0J03586g"
FT                   /product="Postreplication repair E3 ubiquitin-protein
FT                   ligase RAD18"
FT                   /EC_number="6.3.2.-"
FT                   /function="damaged DNA binding"
FT                   /function="ligase activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="DNA repair"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG60809.1"
FT                   /db_xref="GO:0003684"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006281"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0016874"
FT                   /db_xref="HOGENOM:HBG058001"
FT                   /db_xref="HOGENOM:HBG204057"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR003034"
FT                   /db_xref="InterPro:IPR004580"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR017907"
FT                   /db_xref="InterPro:IPR018957"
FT                   /db_xref="UniParc:UPI00003B6A20"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FPI4"
FT                   /transl_table=1
FT                   /translation="MDVLTSAADFKKSKVPQLQELDDLLRCHICKDFLKNPVLTPCGHT
FT                   FCSLCIRGYLSNEPKCPLCLHELRESMLRSEYLVNEITETYKAARQRLLDELNSLETNQ
FT                   DNSVIEVVSDKEPSLLQIDDDVNENSNHITVNDTSDIIDEDNEIQITGTKRTARTILNG
FT                   SRPTKAAKISDMFTTRKAKTEEKAPCPICSQLFPIRYLERTHLDECLTKPPTSSPPIKQ
FT                   SRLSPKPSESVSHVKRYLNSTNTSTQQRLPKLNFAKMTTSQLKQKLASLSLPVSGTRAN
FT                   MVARYNYYEMLWNSNFIDSINPVSESELRRQLMSWDASHNGNNNSSNGGTNTISQLMKM
FT                   NSKNKGKEYEKLLKDFKKDSFDKKGWMLLHKNSFNRLLCDAKKTRRKTENETLMTSQSP
FT                   RESSTQTELSAT"
FT   CDS_pept        complement(345752..347398)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000142335" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17438934"
FT                   /locus_tag="CAGL0J03608g"
FT                   /product="Similar to uniprot|P25364 Saccharomyces
FT                   cerevisiae YCR065w HCM1 transcription factor "
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="sequence-specific DNA binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG60810.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0043565"
FT                   /db_xref="HOGENOM:HBG123608"
FT                   /db_xref="HOGENOM:HBG204056"
FT                   /db_xref="InterPro:IPR001766"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR018122"
FT                   /db_xref="UniParc:UPI00003B6A21"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPI3"
FT                   /transl_table=1
FT                   /translation="MEPEFISMYNLHSTSPANIFIDTSNMKKRAMDEALITPPKSTPAK
FT                   SRLVKNPPMGDSSDSRPLSPARSSPITTTKAKRQKTVGSARSNGTLTLEELFESLAKRK
FT                   ESGDKNSKPQYSYAVLICLAILQSPEGKLTLSQIYCWISVHFPYYRPKDASWQNSIRHN
FT                   LSLNSAFTKTEKSSDGKGHFWQVKVGSESKFFKGDYGDYENLRKQVQTIEKYFDIDPAM
FT                   LEEFDNEKPTYLNRESTNEKKNTSNAQTSASESSSISSTPNADSSFTDLNSTFSIKVSP
FT                   PEDKPKDGSISQGKEEVFNFGMVIRQNDHNLLDSPYPMKKTELPEIATPLSKSKTERLP
FT                   TIGDIQDPITTLNPLNSPPNMRRYMCSFNSSFDTDSPSHARHEPSTLLGPVPMSSSPTT
FT                   LPQITTPYVNRYSEDTTHLKLPPIQVNVLKTPEVNSITNVKTPARFTETPKDSNSILRK
FT                   LQTPSHLFEDTYLSPMFRAMGTPLKFSATPCDTKHNNLSPRSQQIPGFHKATKFPSSGL
FT                   FGVDIFSVLKRAGSTSSNAQDKKDESNDGSK"
FT   CDS_pept        complement(348518..348964)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000235066" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17438935"
FT                   /locus_tag="CAGL0J03630g"
FT                   /product="Similar to uniprot|P25337 Saccharomyces
FT                   cerevisiae YCR063w"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG60811.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="HOGENOM:HBG020790"
FT                   /db_xref="HOGENOM:HBG328980"
FT                   /db_xref="InterPro:IPR001748"
FT                   /db_xref="UniParc:UPI00003B6A22"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPI2"
FT                   /transl_table=1
FT                   /translation="MKVKGYERVEPVLAEFERRLKEIGKDKSKSLGKGQGKEDLWRIVQ
FT                   IHSERSRYVYTMYYKRRAISRELYEWLLKKKVADRRLIAKWRKRGYEKLCCLQCVQQSE
FT                   TNHGSTCICRVPRLQLEAEAEKKGVPVSFKECVNCGCHGCASTD"
FT   CDS_pept        349217..352498
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000216621" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19349235"
FT                   /locus_tag="CAGL0J03652g"
FT                   /product="Similar to uniprot|P26637 Saccharomyces
FT                   cerevisiae YPL160w CDC60 leucine-tRNA ligase "
FT                   /function="ATP binding"
FT                   /function="leucine-tRNA ligase activity"
FT                   /biological_process="leucyl-tRNA aminoacylation "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAG60812.1"
FT                   /db_xref="GO:0004823"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006429"
FT                   /db_xref="HOGENOM:HBG014191"
FT                   /db_xref="HOGENOM:HBG445334"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR004493"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniParc:UPI00003B6A23"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPI1"
FT                   /transl_table=1
FT                   /translation="MSDEKKGLVLENTGRRDALIAIEKKYQQVWAEEHQFELDAPSIDD
FT                   EPITMSTEELHKKYPKFMSSMAYPYMNGVLHAGHCFTLSKVEFSIGFERMNGKRALFPL
FT                   GFHCTGMPILACADKLKREAEMFGTDFSKAPAEDEEEPQVEEKKAESEDVTKFKAKKSK
FT                   AAAKKGRGKYQFEIMLQLGIPRDEVYKFADASYWLTYFPPLCQRDCSSLGSRIDWRRSY
FT                   ITTDENPYYDAFIRWQMNKLKALGKIKFGERYTIYSVKDGQPCMDHDRQSGEGVTPQEY
FT                   VGIKIEATEFAPEAKKLIDENDKIDKSKKIYFVAATLRPETMYGQTCCFVSPKIDYGIF
FT                   DAGDSYYITTERAFKNMSYQKLTPVRGEYSPVAVINGKAFIGTKIHAPLTPYKELRILP
FT                   METVIATKGTGVVTCVPTNSPDDYMTVKDLIKKSEYYGIDPTWIDMELIPVIKTDKYGD
FT                   LTAKALCEELKIQSPNDTTKLAEAKKIAYKEDYYSGVMIYGDYKGEKVEIAKAKVKADM
FT                   IAKGEAFVYNEPEGLVMSRSGDECIVSLEDQWYLDYGEEEWRKQAEECLSQMEVFAPEV
FT                   NHAFKGVLGWLRNWAVSRTYGLGTKLPWDDKYLVESLSDSTIYQAFYTVAHLLFKDYYG
FT                   KEIGPLNIKPEQMTDDVFDYIFQHVDDVKSDIPLRSLQILRREFEYFYPLDVSISGKDL
FT                   IPNHLTFFIYTHVALFPKKFWPKGIRANGHLMLNNAKMSKSTGNFMTLEQIVEKFGADA
FT                   SRIALADAGDTVEDANLDESNANAAILRLFNLKEWSEEIVKDIDTLRSGEITEIFDVAF
FT                   EHEMNSLIEETYKQYELTNYKNALKTGLFDFQTARDYYREATGTMHKDLVLRYIETQAL
FT                   MLAPIAPHFAEYVYRDVLGKKGSVQTANFPRASKPIDRSILAGLEYVRALQRSIREAEG
FT                   QALKKKKGKGAEVDQSKPVKLTLLVSKTFPEWQAGCIEIVREMFANQTLNDNKMIKEKV
FT                   NPKEMKRAMPFISLLKQRLATESPEAVFNRELQFNETETIKATIDNIKKAAQQLKVEEI
FT                   EVLAFPHGSNVATNIFTGQEVELPSAPKAIESALPGNPSILFNNI"
FT   CDS_pept        352904..354208
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000179738" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17438936"
FT                   /locus_tag="CAGL0J03674g"
FT                   /product="Similar to uniprot|Q08650 Saccharomyces
FT                   cerevisiae YOR245c"
FT                   /function="transferase activity, transferring acyl groups
FT                   other than amino-acyl groups"
FT                   /protein_id="CAG60813.1"
FT                   /db_xref="GO:0016747"
FT                   /db_xref="HOGENOM:HBG521388"
FT                   /db_xref="HOGENOM:HBG561030"
FT                   /db_xref="InterPro:IPR007130"
FT                   /db_xref="UniParc:UPI00003B6A24"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPI0"
FT                   /transl_table=1
FT                   /translation="MFGNAFHLRNRIHKRSSSSDRLDQDESSDDGDNAPNIVEQKTKDI
FT                   KLVKPLKRPRLSNCCSPTTPMANRLQTMAVAWHISSFVLFSIFSLLIISNPFTWIVVIP
FT                   YLIYFFNDRSPANGDVVYRYSPWVRSLKIWKYYCDYFPIELVKTVDLEPTFTPCNEEEE
FT                   KENKKLQEYYTLRLWPSDYEIRLFKKNTVYSHGYKRTGPKYIFGYHPHGIGALGSFGAF
FT                   ATEGRGWSNKFPGIPVSLLTLVTQFHIPFYRDYLLSVGISSVSRKNALKVLDNNQSICI
FT                   VVGGARESLISIPGTSGLILNKRKGFIKLAIQAGNVSLVPVYTFGENDCYNILATDETS
FT                   IIRKLQLWVKENFGFTIPIFYARGLFNYDFGLLPFRAPLHVVVGRPIHVKEQQENPEQS
FT                   LVDHYHELYVEELKRIYLENRDRYGYGAADFEILG"
FT   CDS_pept        complement(354372..355712)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000182457" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17438937"
FT                   /gene_name="ESA1"
FT                   /locus_tag="CAGL0J03696g"
FT                   /product="Histone acetyltransferase ESA1 "
FT                   /EC_number="2.3.1.48"
FT                   /function="chromatin binding"
FT                   /function="histone acetyltransferase activity"
FT                   /biological_process="chromatin assembly or disassembly "
FT                   /biological_process="chromatin modification"
FT                   /biological_process="regulation of transcription "
FT                   /biological_process="transcription"
FT                   /cellular_component="chromatin"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG60814.1"
FT                   /db_xref="GO:0000785"
FT                   /db_xref="GO:0003682"
FT                   /db_xref="GO:0004402"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006333"
FT                   /db_xref="GO:0006350"
FT                   /db_xref="GO:0016568"
FT                   /db_xref="GO:0045449"
FT                   /db_xref="HOGENOM:HBG265333"
FT                   /db_xref="HOGENOM:HBG631736"
FT                   /db_xref="InterPro:IPR000953"
FT                   /db_xref="InterPro:IPR002717"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR016197"
FT                   /db_xref="UniParc:UPI00003B6A25"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FPH9"
FT                   /transl_table=1
FT                   /translation="MAGAEVEEEAGIPKKIESTEEVLIKCQCWVRKDEEERLAEILSIN
FT                   ARVSPSKFYVHYVNFNKRLDEWVTGDRINLDKEVIFPRPKRQLEEDTNKKQKKKKKFPQ
FT                   KAAVVESDAKSSEMGEGSDVMDLDNLNVRGLKDEEISREDEIKKLRTSGSMIQNPHEVA
FT                   HVRNLSKIIMGKFEIEPWYFSPYPIELTDLDVVYIDDFTLQYFGSRKQYERYRKKCTLR
FT                   HPPGNEIYRDDYVSFFEIDGRKQRTWCRNLCLLSKLFLDHKTLYYDVDPFLFYCMTRRD
FT                   EMGHHFVGYFSKEKESADGYNVACILTLPQYQRMGYGRLLIEFSYELSKKEGKVGSPEK
FT                   PLSDLGLLSYRAYWSDVLITLLVEHGKEVTIDEISSMTSMTTTDILHTLKTLNILRYYK
FT                   GQHIIFLNDDILERYNQLKTKKRRHIDAEKLLWKPPVFTASQLRFAW"
FT   CDS_pept        356163..358181
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000203484" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21044860"
FT                   /locus_tag="CAGL0J03718g"
FT                   /product="Similar to uniprot|Q08647 Saccharomyces
FT                   cerevisiae YOR243c"
FT                   /function="RNA binding"
FT                   /function="pseudouridine synthase activity"
FT                   /biological_process="pseudouridine synthesis"
FT                   /protein_id="CAG60815.1"
FT                   /db_xref="GO:0001522"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0009982"
FT                   /db_xref="HOGENOM:HBG338854"
FT                   /db_xref="HOGENOM:HBG603987"
FT                   /db_xref="InterPro:IPR001656"
FT                   /db_xref="InterPro:IPR011760"
FT                   /db_xref="InterPro:IPR017091"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR020119"
FT                   /db_xref="UniParc:UPI00003B6A26"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPH8"
FT                   /transl_table=1
FT                   /translation="MTAEKRSAEVADDEVLKRVKLEVTGDIKERDAGITLYLSDLPGFT
FT                   GQIKQRYTDFLVNEITMEGEVVHLVDKGFKVPKRNAEPKMSDEERKAQKQAEYAKREAF
FT                   EVEEELKASLIDIFGEEDFNKIVDVYKNAQKMESQKSFDDKATRTKIHQLIRQAFNNEL
FT                   ESVTTAENTFKIARNNRNSRVNKQTLVESTKDENGVENYGYGPAKEFIHFTLHKENKDT
FT                   MEAVNVLTKLMRVPNKLVRYAGTKDRRAVTCQRLSISGVNLERLNALNRTLKGMIIGGY
FT                   KYSDVSMNLGELNGNEFHIVIRDAKVDPACGKSLKEVLEAGSKSLVDNGFVNYYGLQRF
FT                   GTFSISTHTIGKELLLGNWRAAIEMILSDQENILPASKEARQLWAQNRDPYEAMKKMPK
FT                   QCIAENAILHTLSNHRKEESGDFGTGAYHDAIMKIPRNLRTMYVHAYQSYVWNKVASKR
FT                   IELFGTDIRVGDLVIIEKDEDKQTDKADGSTSDDDFDEDLRSADFIRAKALTEEEVKSG
FT                   KYTIEDVVLPTPGFDILYPSSDELKQLYVDIMGADGMDPFDMRRKVRDFSLAGSYRNII
FT                   QKPKNFEYKIIQYEDPVQQIVNTDLEILNNQRAKENHQKYMKAKLERYVPDKPGSRTAV
FT                   VLKFQLGTSAYATMALRELMKLETSRRGDMCAVTSST"
FT   CDS_pept        358554..359663
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20196055"
FT                   /locus_tag="CAGL0J03740g"
FT                   /product="Similar to uniprot|Q08646 Saccharomyces
FT                   cerevisiae YOR242c SSP2"
FT                   /protein_id="CAG60816.1"
FT                   /db_xref="HOGENOM:HBG123609"
FT                   /db_xref="UniParc:UPI00003B6A27"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPH7"
FT                   /transl_table=1
FT                   /translation="MDLSNHWARNFSGKLHNIHNGPTLSSIFGLDANYKQDVNISNVHV
FT                   AEVKPFSIRRLAKTLILGSPIESVALNKDNTGKIKKRGAIVLSSYGSCADLKRPKINSA
FT                   DKICRSRTDDNLQKALLGLIQDMSSEDAIELCRNVSLFQKCNKFGNSSILSLGSDTKDI
FT                   TDIVFDNIPANIGLESIVYQLQGGPIAKIQAVPHESNVDQLKKLHVKFTTSKAASDFMK
FT                   LGTRNMFKVNGVYLRPKWVQFCETKTDKWYQDLIKQNTSKNVCRCIILKRYPTKNNMRY
FT                   IQSTKQPPLENIDVNAIRRDFENYGNILDITPVISRKLCISIVYYDIFSAMKAMMSYED
FT                   NTSFLHENYYGKWAIWYGKDISDRPVIPV"
FT   CDS_pept        complement(359858..361342)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000181278" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21044861"
FT                   /locus_tag="CAGL0J03762g"
FT                   /product="Strain CBS138 chromosome J complete sequence "
FT                   /function="ATP binding"
FT                   /function="tetrahydrofolylpolyglutamate synthase activity "
FT                   /biological_process="folic acid-containing compound
FT                   biosynthetic process"
FT                   /protein_id="CAG60817.1"
FT                   /db_xref="GO:0004326"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0009396"
FT                   /db_xref="HOGENOM:HBG033526"
FT                   /db_xref="HOGENOM:HBG744947"
FT                   /db_xref="InterPro:IPR001645"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR018109"
FT                   /db_xref="UniParc:UPI00003B6A28"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPH6"
FT                   /transl_table=1
FT                   /translation="MLITPTLRMASKRTYQDALTALNSLQSNYANIMAVRQSGDRKNRM
FT                   SILEMYEWSRRLGYKVSDFNKLNIVHITGTKGKGSTAAFTSSILQQYQDKLTKIGLYTS
FT                   PHLRSVRERIRINGEPISESKFTEYFFQVWDKLDKTTSPLNEFPHMVPGSKPGYFKFLT
FT                   LLSFHAFMKEECSCCVYEVGVGGELDSTNIIEKPVTCGVSLLGIDHTFMLGDTIEEIAW
FT                   NKGGIFKKDAPAYTIMGQEPAGLKVLQERAKERETSLTEVPTFKQLDNIKLGIAGDFQK
FT                   TNASLAVVLASQALNSLSIIKEDTPINSDSILPEKFITGLKKTIWEGRCQYIKTGKINW
FT                   YIDGAHTKESIEAASRWFAQEVASNNNKKILLFNQQTRDAALLLKVLHSVTNNRLNFSE
FT                   ALFTTNVTWKTGSYNADLVSINVSQEQVDKLEVQKELASVWKDLSSETKSNICANIESA
FT                   INIIEDYDIDEVDVFVTGSLHLVGGFLVVLDKYNNQ"
FT   CDS_pept        join(complement(362913..363517),complement(361909..362911))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000033747" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17438938"
FT                   /locus_tag="CAGL0J03780g"
FT                   /product="Similar to uniprot|Q08641 Saccharomyces
FT                   cerevisiae YOR240w ABP140"
FT                   /protein_id="CAG60818.1"
FT                   /db_xref="HOGENOM:HBG028809"
FT                   /db_xref="HOGENOM:HBG735894"
FT                   /db_xref="InterPro:IPR013217"
FT                   /db_xref="UniParc:UPI00003B6A29"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPH5"
FT                   /transl_table=1
FT                   /translation="MGVADLIKKFEQISQESPKTEVKKPTPAVAEPSDATEATEATEAT
FT                   EATEALTDESAEPAEPTPVEASEETPVETTTEETPAEAAQEAEATTEETPAETAQEAEA
FT                   NTEETPAETAENTPATDSETAPEETPAQEAESEKTEDDQEASAEGDNTQENSEQSSKSK
FT                   KNKKKKNKKKAKKAAAKAATEGENGSNEEETPSDSLRPCQSENKEEIKAITQDLHEETF
FT                   EGIAHESAPNEVEGTSRLGRDNPFEFGKRNLTEDSDVWNHNAWDNVEWGEEQIQQAEEK
FT                   IKLQYDCPVSEFDKELYNSNPSRYWDIFYKNNKENFFKDRKWLQIEFPILYQSTKKDAG
FT                   PVTIFEIGCGAGNTFFPILNENENENLRIIAADFAPRAVELVKESENFNPKYGHATVWD
FT                   LANPDGQLPDGVEPHSVDIAVMIFVFSALSPSQWDHAMDNLHNILKPGGKILFRDYGRY
FT                   DQVQVRFKKNRLLDDNFYVRGDGTRVYFFTEEELRDIFTKKYFKENKIGTDRRLLVNRK
FT                   RQLKMYRCWLQAVFDVPN"
FT   CDS_pept        363777..365039
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000795" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17438939"
FT                   /locus_tag="CAGL0J03806g"
FT                   /product="Strain CBS138 chromosome J complete sequence "
FT                   /protein_id="CAG60819.1"
FT                   /db_xref="HOGENOM:HBG058424"
FT                   /db_xref="HOGENOM:HBG203882"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="UniParc:UPI00003B6A2A"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPH4"
FT                   /transl_table=1
FT                   /translation="MTWNKTATYEHISSIKPRFISRAFAAENQLKSLAFSNELVPDTDA
FT                   HELKTKLLYSQGSEIYELECAYPLITEDKEPVSDYGDAFKAMENVPLQPKWVYQGETVA
FT                   KMEFLGEEEDTNVIAMSKNGSLAWFTEGVKVPVHIVQEMMGPSTKFSSIHSLTRPDNLA
FT                   VADFSLSLDQETIVKSQSNGDEEDSILKLIDNAGKPSEVLRVIRVPGTTVTHSVRFLDN
FT                   HVFASCSDDNVIRFWDTRTADKPLWSLSDPQNGSLTAFDVSQLSGNLFATGFSTGVVKL
FT                   WDARAVEDATLDLSNRQNGEEPIQKEIANWYHRGGDSVVDLKFSSTSPTEFLTVGGSGN
FT                   VYHWDADYALSNYDPENHAPQEASEQLQNESLTFLHTGGSRRSTTAYGLRNTVAWHPVI
FT                   EGLVAHVDPDTLITTYLPYNN"
FT   CDS_pept        365325..366728
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000234206" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18501410"
FT                   /locus_tag="CAGL0J03828g"
FT                   /product="Strain CBS138 chromosome J complete sequence "
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="CAG60820.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG537393"
FT                   /db_xref="HOGENOM:HBG755340"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI00003B6A2B"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPH3"
FT                   /transl_table=1
FT                   /translation="MASLFRPPESTRQNARSPRLKLPPLSNVSLAVPGESPTGKLSATS
FT                   SRGSSATSANMKRPMPPPLPKLDVPLSAASSTEGLVRKMKQLSVEDESPQSGSSRGVER
FT                   DDTTAVNQSVDSFFSNLISVYDQSSSAITSPKIDEPEDSAVKDALATRVPRSLTQGKDI
FT                   DELSEEVWHSKNLLAEIETQGVLGEGAGGSVAKCKLRTGKKVFALKTINILNGDPEFQK
FT                   QLLRELQFNKSFKSEYIVRYFGMFTDEQNSSIYIAMEYMGGKSLEAIYKELLSRGGRIS
FT                   EKVLGKISEAVLRGLSYLHEKKVIHRDIKPQNILLNEDGQVKLCDFGVSGEAVNSLATT
FT                   FTGTSYYMAPERIQGQPYSVTCDVWSLGLTILEVAQGHFPFGPDKMATTIAPIELLTLI
FT                   LTFTPHLDDEPDKNIKWSRAFKSFIEYCLRKEARARPSPRQMIQHPWIQGQMKKQVDMR
FT                   KFITKCWQK"
FT   CDS_pept        367053..367748
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000252083" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21044862"
FT                   /gene_name="mge1"
FT                   /locus_tag="CAGL0J03850g"
FT                   /product="GrpE protein homolog, mitochondrial "
FT                   /function="adenyl-nucleotide exchange factor activity "
FT                   /function="chaperone binding"
FT                   /function="protein homodimerization activity"
FT                   /biological_process="protein folding"
FT                   /biological_process="protein import into mitochondrial
FT                   matrix"
FT                   /cellular_component="mitochondrial matrix"
FT                   /protein_id="CAG60821.1"
FT                   /db_xref="GO:0000774"
FT                   /db_xref="GO:0005759"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="GO:0030150"
FT                   /db_xref="GO:0042803"
FT                   /db_xref="GO:0051087"
FT                   /db_xref="HOGENOM:HBG447395"
FT                   /db_xref="HOGENOM:HBG732630"
FT                   /db_xref="InterPro:IPR000740"
FT                   /db_xref="InterPro:IPR009012"
FT                   /db_xref="InterPro:IPR013805"
FT                   /db_xref="UniParc:UPI00003B6A2C"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FPH2"
FT                   /transl_table=1
FT                   /translation="MRAFSNVSRISRVSRVSRVALAAPARTVPLMNRNAMSMMRFYSED
FT                   AKASEKAGEKAEEKAEEQNLSAEEQKLKDLQEQLDKKTKEAAELKDRLLRSVADFRNLQ
FT                   EVTKKDVEKAKSYALQKFAKDLLESVDNFGHALGAFKEEDLEKSKEISDLYTGVKMTRD
FT                   VFEKTLKKYGIEKLDPLGERFDPNKHEATFELAQPDKEPGTVFHVQQLGYTLNERVIRP
FT                   AKVGVVKED"
FT   CDS_pept        368472..370457
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000247883" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17438940"
FT                   /locus_tag="CAGL0J03872g"
FT                   /product="Strain CBS138 chromosome J complete sequence "
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="CAG60822.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG203881"
FT                   /db_xref="HOGENOM:HBG252860"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="InterPro:IPR020636"
FT                   /db_xref="InterPro:IPR020674"
FT                   /db_xref="UniParc:UPI00003B6A2D"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPH1"
FT                   /transl_table=1
FT                   /translation="MATIPKRHTYGGGPEVHYTRNPYSAAPRNSMSSRGKKHVTFGPYI
FT                   VGSTLGEGEFGKVKLGWTRTPSTGPEQRPAVSKQVAIKLIRRDTIVKNSEKEIKIYREI
FT                   NALKHLTHPNVVRLEEVLQNSKYIGIVLEYASGGEFYKYIQRKRRLKESTACRLFAQLI
FT                   SGVTYMHSKNLVHRDLKLENLLLDKNENLVITDFGFVNEFLPDNEYMKTSCGSPCYAAP
FT                   ELVISTRPYVARKADVWSCGIILYAMLAGYLPWDDDSTNPEGDDIGKLYQYITRTPLKF
FT                   PEYITPIPRDLLRKILVPDPNKRVNMQYIHRHEWLKPHRPFLAVSTSQWDKLIKNSANV
FT                   QLDHTKRVSRTSQHFETEQENSSVNQPVRSDMVNKAMDTSNTTDDAQHSIPNRQPLANV
FT                   FINSRTYSARSASYAPRHSMSDDPNAIESARHAVQNKHESNLATVMGSPNKDKDDTTED
FT                   NNLETVARTSSHHRKPRPTSYYPVDINRSANNFSPIVLNLTNSDENDNSKHPYSTSTSN
FT                   NPVAPTPQRDQSQVVTDEHGLQLEKNRVREQPLTSDKSRMSSLRSNATAKSSDSKKNKR
FT                   FSLLSFYTNNGSKTSLHNDSKVSVTPSSKEESATVPPSIPSVVHHTDTTENKRNHRASM
FT                   MGPSAGGDKSTARRVIDFFKRRSMRM"
FT   ncRNA           370868..371465
FT                   /ncRNA_class="snoRNA"
FT                   /gene_name="SNR17"
FT                   /locus_tag="CAGL0J03883r"
FT                   /product="U3 RNA"
FT   CDS_pept        371724..372377
FT                   /evidence="1: Evidence at protein level "
FT                   /gene_family="HOG000040235" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20196056"
FT                   /locus_tag="CAGL0J03894g"
FT                   /product="Strain CBS138 chromosome J complete sequence "
FT                   /function="NADP or NADPH binding"
FT                   /function="dihydrofolate reductase activity"
FT                   /biological_process="glycine biosynthetic process "
FT                   /biological_process="nucleotide biosynthetic process "
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAG60823.1"
FT                   /db_xref="GO:0004146"
FT                   /db_xref="GO:0006545"
FT                   /db_xref="GO:0009165"
FT                   /db_xref="GO:0050661"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG129626"
FT                   /db_xref="HOGENOM:HBG665708"
FT                   /db_xref="InterPro:IPR001796"
FT                   /db_xref="InterPro:IPR012259"
FT                   /db_xref="InterPro:IPR017925"
FT                   /db_xref="PDB:3CSE"
FT                   /db_xref="PDB:3EEJ"
FT                   /db_xref="PDB:3EEK"
FT                   /db_xref="PDB:3EEL"
FT                   /db_xref="PDB:3EEM"
FT                   /db_xref="UniParc:UPI00003B6A2E"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPH0"
FT                   /transl_table=1
FT                   /translation="MSKVPVVGIVAALLPEMGIGFQGNLPWRLAKEMKYFREVTTLTND
FT                   NSKQNVVIMGRKTWESIPQKFRPLPKRINVVVSRSFDGELRKVEDGIYHSNSLRNCLTA
FT                   LQSSLANENKIERIYIIGGGEIYRQSMDLADHWLITKIMPLPETTIPQMDTFLQKQELE
FT                   QRFYDNSDKLVDFLPSSIQLEGRLTSQEWNGELVKGLPVQEKGYQFYFTLYTKK"
FT   CDS_pept        373116..374417
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000197950" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17438941"
FT                   /locus_tag="CAGL0J03916g"
FT                   /product="Strain CBS138 chromosome J complete sequence "
FT                   /biological_process="steroid metabolic process "
FT                   /protein_id="CAG60824.1"
FT                   /db_xref="GO:0008202"
FT                   /db_xref="HOGENOM:HBG053829"
FT                   /db_xref="HOGENOM:HBG677053"
FT                   /db_xref="InterPro:IPR000648"
FT                   /db_xref="InterPro:IPR018494"
FT                   /db_xref="UniParc:UPI00003B6A2F"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPG9"
FT                   /transl_table=1
FT                   /translation="MTQDRASSSTWTTFLKSLASFNGDLSALSAPPFILSPVSLVEFCQ
FT                   YWAEHPDLFLEPSFINETNYKERMGQCDPDIDSPEAARMLAVIKWFLSTLRSQYSSRSE
FT                   KSGSEKKPLNPFLGELFVGKWESKTYPHFGETILLSEQVSHHPPMSAYSIYNEKNNVKI
FT                   EGYNNIKSSISKTLTLNVKQYGHNLLTIGDKETYLVIPPPLHIEGILMASPFVELEGKS
FT                   YIQSTTGMCCQFEYSGRGYFSGQKNSFKAKVYKSGADLKNNGTPLYVISGQWSGSSKIV
FT                   KNLPNGKQSAPVLFHDTNITATESLQVKTIDKQHPLESRRAWKDVADAIRLGDYGLINK
FT                   TKSALENKQREMRKEEAANGTTWKRRWFNEVDYSQNMKDKDLFLTLANELGLSIKNVPS
FT                   GTLVNDREDQKANSSAKHWRFDHSKWVADDEITV"
FT   CDS_pept        374722..375609
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000246602" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20196057"
FT                   /locus_tag="CAGL0J03938g"
FT                   /product="Similar to uniprot|Q08634 Saccharomyces
FT                   cerevisiae YOR238w"
FT                   /protein_id="CAG60825.1"
FT                   /db_xref="HOGENOM:HBG061223"
FT                   /db_xref="HOGENOM:HBG595817"
FT                   /db_xref="UniParc:UPI00003B6A30"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPG8"
FT                   /transl_table=1
FT                   /translation="MSSLRKDHAIMVPCHSIWNYFTSCSDYIHLGQDPEQWFLAPFQYE
FT                   GRDHLSFIKHGLAGLDTLLSDFANSTLIFSGSQTKAEAGPVSEAQSYQLLMYRIIKQSI
FT                   DDINVVNGIFGNIDSEILKLIQSIISKMRDQEITLDQLFESHRITLEEYALDSFDNLLY
FT                   SLGQFQAVNGNYPKKMTIVGFGFKQSRYLDLHAKAIDFKNINYISIEPSPTGYNSEQLE
FT                   VYFSTLSAMEKKNAAALFQNDYYGRRSPLLDKKQSRNPFNKQPKYEILNILKGLENYSD
FT                   EEFLQKHIVGHTPW"
FT   CDS_pept        complement(375780..377087)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000795" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19349236"
FT                   /locus_tag="CAGL0J03960g"
FT                   /product="Strain CBS138 chromosome J complete sequence "
FT                   /protein_id="CAG60826.1"
FT                   /db_xref="HOGENOM:HBG058424"
FT                   /db_xref="HOGENOM:HBG203882"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="UniParc:UPI00003B6A31"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPG7"
FT                   /transl_table=1
FT                   /translation="MLHNRRPNLYQHISEFTPKFVNKLSAGHADRTLAWRHDVIPDKSN
FT                   KNFSTTLIYSQGSDIYEFKGVFPLDILPYTPVEEQASDESAKVEEGKYGIVQDADVVNS
FT                   AKWVYQGETVAKMTYLDDLNDNALIAMSKNGSLAWFKDDCKVPVHIVQEMMGPSTSFAS
FT                   MHSGQKPAELAVSDFSLSMDSETIVKSQSNGYEEESILKIIDNSGKPGEILRTMKVPGT
FT                   VVTHTVRFFDNHLFASCSDDNVIRFWDTRTDDKPIWILSEPQNGRLTTFDVSPITENLF
FT                   ATGFSTGLIKLWDARATYEATQDLSYRQNGEDPIQVEMAKVFHSGGDSVVDIKFSETSS
FT                   SEFVTVGGSGNIYHWDMEYLFSRNDDDNEDYLPSLEPEELQSHCLKFCQPSRVKSGSRN
FT                   TVALHPMVHDLSATISSKNSITVYKPFDGTEFSKND"
FT   CDS_pept        377534..377881
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18501411"
FT                   /locus_tag="CAGL0J03982g"
FT                   /product="Similarity"
FT                   /protein_id="CAG60827.1"
FT                   /db_xref="HOGENOM:HBG123610"
FT                   /db_xref="UniParc:UPI00003B6A32"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPG6"
FT                   /transl_table=1
FT                   /translation="MFYAAYRANISQPGPVQWNKYCRKWYKNGVWSLMVVVNSWTDRNT
FT                   STFEGYSIQRLPEGIIAGYSSLEEGVGTSRAIVYEPHIQYSYKQLVGTISNSIYPPKFG
FT                   ITCLSFDTRLP"
FT   CDS_pept        378245..379111
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000141922" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19349237"
FT                   /locus_tag="CAGL0J04004g"
FT                   /product="Similar to uniprot|Q12106 Saccharomyces
FT                   cerevisiae YOR228c"
FT                   /protein_id="CAG60828.1"
FT                   /db_xref="HOGENOM:HBG123611"
FT                   /db_xref="HOGENOM:HBG202889"
FT                   /db_xref="InterPro:IPR012472"
FT                   /db_xref="UniParc:UPI00003B6A33"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPG5"
FT                   /transl_table=1
FT                   /translation="MSKNLKEVSPTPLKPDERPISYNPRKILGIEVSTTTVVHALFKLQ
FT                   RLSIVPMALYFPVHAVNTMITPLVNPETAPDSFLTAVHKWVPQAASKILIASLLTHIAS
FT                   GVLLRGWKLYKSHVLKEKYHLHHQHKHTTSQDDIGLTGGISGYLFGIYKQFTLSPLSMS
FT                   GYVLTPLVLYHLLIMKWVPESLGEPATGFDFVKQLLRASEWWIRWFAGIIPLSALISAA
FT                   SYHIVAGACRLLDVKDMKKRKNASRIISGLSIAGFLSILRLSNAKSFSSDWSQFNDIFT
FT                   KLNFLRT"
FT   CDS_pept        complement(379502..383098)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000111153" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20196058"
FT                   /locus_tag="CAGL0J04026g"
FT                   /product="Strain CBS138 chromosome J complete sequence "
FT                   /protein_id="CAG60829.1"
FT                   /db_xref="HOGENOM:HBG058420"
FT                   /db_xref="HOGENOM:HBG203884"
FT                   /db_xref="UniParc:UPI00003B6A34"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPG4"
FT                   /transl_table=1
FT                   /translation="MASIEVLKNQVDVQIEWLYKGKKRKLPKAGSVDPMRSDPMDGNRL
FT                   GRRATISVRETMPEGVARRRPRSSSISNGDLSNDKSAQREAPATDYSRRHSVSHSEKEK
FT                   KKSIFGSLFGKKSDSTDKKPPQSSAKSPVSVKTSTSSASPTASVPININVNREKPKSHE
FT                   PKSPSSPLRLFHFGQSNSESHAAPISRGSPSPSMDPLDERIESSKHHHSHHDQGQSRDK
FT                   ESIEKLNKIDLKRVSFALDKFHHEPAQQLPSRKPKMGDIVVPEDMISEEPKISVGITTT
FT                   SDNKASSAPKRKYSKDSQEYKMVLENYKRLQKESERQQLEAHRVAERIANEVTGYRIRS
FT                   GSLFEAAHNAVVNKVLSPSSPTEASVIDSDPTVALDSRVAELTIDKPIHAHETFFETEG
FT                   YDSSTSQVNSNPDLHQHHHELPLDVVYTRCCHLREILPIPSTLRQVKGKTAPLQTLKFL
FT                   NPKPTLIDILSFCDFISITPIQVVVFDNVALNSDMIQIVLSSLINSKSIEKLGIRNVVL
FT                   SSKDWEMLCKFLLVNKSIIRLDLSQTKIKPDLPAECYRHNMNWKLFCNVLRERTGRPLE
FT                   ELLLNGVHFDEMSFDDYQDLLLTFASKNSSPNKRLGMAAASFSEKCMSFLFDVISQFSV
FT                   QGVDLGFNELEPYIHIIIDKLSTLPYNNLEYFTLNSSSFSCTQNIGSLLKYLSRLPNLR
FT                   FLDMSNIPEMFPSVFAYLYKYLPLFPSLQRIHFDSNCLTYKQCIMLCEILQKCPKLAHV
FT                   SMKNELTYPEAIKDQEKEDGSDDKSTKEFAARTLGATLYGFCRDRSTLLGLDVDYGDIS
FT                   DEIQSRIAVTLMINMKKTIDSNFSQDEVTSQDDLLFDGKVISENAEGILHRLTSNLGDQ
FT                   SDPTKMYLLKKFVEKIESLHYEVQKKIDIMFEKRETGTLPLKEKENLLRLVLLEKNLSN
FT                   IMQLFASTSSMKIMETPEAELIGKANFADDSNDSADEKNNSTNTSHIRPFLKHLDSDRI
FT                   FGFASHHSPKSPDVDASQIPHSMATESGKVVDATTGKALLYKTSSSTSLLVKKQEHEEG
FT                   EFHKWGFFVHQKGTTNPDTDDKKSGPEKTPNVSENTNAPERVTVPKIQTVPSGNELREA
FT                   IIKAKGIDSIEDLIKKVSKDDHGLKKIYGESLKPFPILGAQDVDYTSRNASEGNTEASG
FT                   RSTSTDSKTDELVTEKYDELLNSISQKRTSKQ"
FT   CDS_pept        383930..384367
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000069228" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17438942"
FT                   /locus_tag="CAGL0J04048g"
FT                   /product="Strain CBS138 chromosome J complete sequence "
FT                   /function="iron ion binding"
FT                   /function="iron-sulfur cluster binding"
FT                   /biological_process="iron-sulfur cluster assembly "
FT                   /protein_id="CAG60830.1"
FT                   /db_xref="GO:0005506"
FT                   /db_xref="GO:0016226"
FT                   /db_xref="GO:0051536"
FT                   /db_xref="HOGENOM:HBG281533"
FT                   /db_xref="HOGENOM:HBG584215"
FT                   /db_xref="InterPro:IPR002871"
FT                   /db_xref="InterPro:IPR011339"
FT                   /db_xref="UniParc:UPI00003B6A35"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPG3"
FT                   /transl_table=1
FT                   /translation="MFLRSTRLMRPFTRMYHPKVIEHYTNPRNVGSMDKTLRNVGTGVV
FT                   GAPACGDVIKLQIQVNDNTGVIEEAKFKTFGCGSAIASSSYLTELVQGITIEDAEKIKN
FT                   IEIAKELSLPPVKLHCSMLAEDAIKAAVRDYKTKRSSTTLH"
FT   CDS_pept        384719..385171
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000175572" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18501412"
FT                   /locus_tag="CAGL0J04070g"
FT                   /product="Similar to uniprot|P20436 Saccharomyces
FT                   cerevisiae YOR224c RPB8"
FT                   /biological_process="transcription"
FT                   /protein_id="CAG60831.1"
FT                   /db_xref="GO:0006350"
FT                   /db_xref="HOGENOM:HBG012564"
FT                   /db_xref="HOGENOM:HBG595341"
FT                   /db_xref="InterPro:IPR005570"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR016027"
FT                   /db_xref="UniParc:UPI00003B6A36"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPG2"
FT                   /transl_table=1
FT                   /translation="MSTTLFDDIFTISEVDPGRYNNVCRIEAGSTTQEQCKLTLDINTN
FT                   LFPVQVNEQLTVTVASSLDVDDDDKAKVNDSTGASRSWRPPQPGDRSLADDYDYVMHGT
FT                   AYKFEEVSKDVIAVYYSFGGLLMRLEGNYRNLNNLKQETAYLLIRR"
FT   CDS_pept        complement(385424..386329)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000794" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17438943"
FT                   /locus_tag="CAGL0J04092g"
FT                   /product="Similar to uniprot|Q12015 Saccharomyces
FT                   cerevisiae YOR223w"
FT                   /protein_id="CAG60832.1"
FT                   /db_xref="HOGENOM:HBG192264"
FT                   /db_xref="HOGENOM:HBG398047"
FT                   /db_xref="InterPro:IPR019413"
FT                   /db_xref="UniParc:UPI00003B6A37"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPG1"
FT                   /transl_table=1
FT                   /translation="MSSGLGTGSLDGMPGDNGGISRFIVVRFNDDTIPDLKLNITHVSM
FT                   DTINTQWLRRLCRELRGEQTHRRRLRFIRNGNILNSRANLGSEILQYFERLQAENTEGT
FT                   LNELLFYVHCIIGTEDLTDEQLASEDVMDTMGPSADSVTTQAIGFDRLASVGFSEEEIE
FT                   LLRQQFRSTYGDPEEEDDLLNGDESQSNIGSRGGNARRDIRQLEEMWMESGNDPMATAG
FT                   DGLQPGRDRNGEVEDRFNSIPVTDIRHNKDLLIGITTGFCLGIFALLLMKNEGLFNKRQ
FT                   RMSIIVGVATNVLFCLVRGF"
FT   CDS_pept        complement(386924..387835)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000168307" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17438944"
FT                   /locus_tag="CAGL0J04114g"
FT                   /product="Strain CBS138 chromosome J complete sequence "
FT                   /function="binding"
FT                   /function="transporter activity"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="mitochondrial inner membrane "
FT                   /protein_id="CAG60833.1"
FT                   /db_xref="GO:0005215"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0005743"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG541806"
FT                   /db_xref="HOGENOM:HBG735918"
FT                   /db_xref="InterPro:IPR001993"
FT                   /db_xref="InterPro:IPR002113"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="UniParc:UPI00003B6A38"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPG0"
FT                   /transl_table=1
FT                   /translation="MSEKPLPFIYQFVSGAAAGVSELLVMYPLDVVKTRMQLQVGSGTG
FT                   SGVAYNGVIDCLGQIVKREGFSRLYKGISSPMLMEAPKRATKFACNDSYQKMFKDLYGV
FT                   DKLTQQISILSGSLAGVTEACVIVPFELVKIRLQDVNSKFNGPMEVVFKTIRETGILSL
FT                   YNGLESTMWRNAFWNGGYFGVIFQIRALLPKAKTNTEKTTNDLIAGTIGGYCRYSTEHT
FT                   ILSVVKSRIQSGATTTLADGTVVPKYNWTWPSLFKIYSEEGFTALYKGFIPKILRLGPG
FT                   GGIMLVVFNGMMAFFQEMKYGK"
FT   CDS_pept        388375..389409
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000066003" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20196059"
FT                   /locus_tag="CAGL0J04136g"
FT                   /product="Strain CBS138 chromosome J complete sequence "
FT                   /function="transferase activity"
FT                   /protein_id="CAG60834.1"
FT                   /db_xref="GO:0016740"
FT                   /db_xref="HOGENOM:HBG058419"
FT                   /db_xref="HOGENOM:HBG202888"
FT                   /db_xref="InterPro:IPR001227"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="UniParc:UPI00003B6A39"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPF9"
FT                   /transl_table=1
FT                   /translation="MKLVTFPGQGTPIPVAVLKALIRNKDAQFNTILNRGLHRRDLLEY
FT                   IFRNPSSPGSIAVCSNFLYEMYGLISEDLRPHHRDSLILLGHSLGELTCLKVNELFTTK
FT                   ELFEIANYRNDLMVKYTEQYLRAYNRRGSKFEMWALSSPKATDLPYEIHKLLTESPTFP
FT                   GSHTISVANANSVKQCVVTGLVEDLEALRTELHLNIPRLRISELTNPHNLPFHNNTVLR
FT                   PIQEPLYDFIWKIMKNNGTHTWTTLNHPIVSNLDGKETKFIHHALDKFVKCSSTTVQFT
FT                   KCYDTINRIAEATKDQEDPLDAAICIGPGNVIYNLIRRNVPSLKCVEYSSMATIDSYHG
FT                   THDL"
FT   CDS_pept        complement(389834..390529)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000066002" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18501413"
FT                   /locus_tag="CAGL0J04158g"
FT                   /product="Similar to uniprot|Q12044 Saccharomyces
FT                   cerevisiae YOR220w"
FT                   /protein_id="CAG60835.1"
FT                   /db_xref="HOGENOM:HBG058416"
FT                   /db_xref="HOGENOM:HBG202887"
FT                   /db_xref="UniParc:UPI00003B6A3A"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPF8"
FT                   /transl_table=1
FT                   /translation="MKTQVLITDVPKNKFDSKWPDTLEKKLFKEKYPQYRKHLQYFTPL
FT                   PFLDRVIIILDDEAATMEIYEYLQKEEPSVVNDKSIKLYLTESLLSNRFRSRSMGESSP
FT                   EDSNAASNGSADSNSAIGDKPILSLDTNPVSTGINVQSLAMGSPSLSPDRRTSLESPTL
FT                   LKFANDEKAHLYREPLPTKSDSSKESSPGTTELHKSQKLTVSTDAVNKMASNTPPPLSP
FT                   SITVDEFFN"
FT   CDS_pept        391191..393203
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000066131" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17438945"
FT                   /locus_tag="CAGL0J04180g"
FT                   /product="Similar to uniprot|P43579 Saccharomyces
FT                   cerevisiae YFL013c"
FT                   /protein_id="CAG60836.1"
FT                   /db_xref="HOGENOM:HBG059870"
FT                   /db_xref="HOGENOM:HBG203595"
FT                   /db_xref="UniParc:UPI00003B6A3B"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPF7"
FT                   /transl_table=1
FT                   /translation="MAKRIYDPIHDVFQDTGDNEPKRSKVLSVSELNSSETSRRNVSSI
FT                   SSLLTSDDQTAEKAIPERAHRNSISNLLSNDPEEDNNAEKEKVVPVPHMTNTKYTRHLK
FT                   KPDGDFFSRKDIQYDMLKALLTDDRCLFTNHLKAQYTNSLAPMSLPNNKIPIITDKEYD
FT                   ARTFVFNDKLTFAQMYALTMATSSKCSKILRDKLLLDGQVAFSTCVLGFLVNIGRLNTT
FT                   INFYLEMTSQLRTYHSVPCLQAHTLDIKSLQDTPRIKSILRNLPTGNNPIHLSLIYKLL
FT                   GVISEEKFNEIGDSASQKLDKQVSSAEKFGLNGKFNCINMLFALCDNATIVRTQFLSKY
FT                   IQLIDPQDNNHRFDLDKDLTLFNILDNSKFDVIDRVNVVLWLLYIHTETDLTEAEVVES
FT                   LKLFIPPTSVPDLQHNKIPLRLTTNNYDVDTEEELKYGKEQKEKRLLFLQKLDKSDTRK
FT                   EEKTSTADSKDDDSITERATRRKRKKTLEKEILLESSKPNKKIKKEEETEDRVKVEPEQ
FT                   DQEALKTAKEKPEAPLLAAERTPDVKKSKESIHQDRADRLINFDQNKEVGILEKSRERK
FT                   TQRELLQDLSDAQEIVKRKRKQIGMLRLFNKYDDIPMGSVIGVRGKKRRKYKDDVLGYE
FT                   TSFLKTLSIAKQKFIKALRSADTKPQQSENNIFHL"
FT   CDS_pept        complement(393611..393922)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000202995" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17438946"
FT                   /locus_tag="CAGL0J04202g"
FT                   /product="Similar to uniprot|P22943 Saccharomyces
FT                   cerevisiae YFL014w HSP12 heat shock protein "
FT                   /biological_process="response to stress"
FT                   /protein_id="CAG60837.1"
FT                   /db_xref="GO:0006950"
FT                   /db_xref="HOGENOM:HBG051304"
FT                   /db_xref="HOGENOM:HBG736631"
FT                   /db_xref="InterPro:IPR007250"
FT                   /db_xref="InterPro:IPR016360"
FT                   /db_xref="UniParc:UPI00003B6A3C"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPF6"
FT                   /transl_table=1
FT                   /translation="MSDAGRKNFSDKLNEGLTPDSQKSTWDKGKEFVTDETDKLAGKFQ
FT                   GEENKGVAQGMHDSAQKGADEANAESYADTAREYMDAAKSKLNDAVEYVSKSVHGGEK"
FT   CDS_pept        395856..397424
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000226717" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18501414"
FT                   /locus_tag="CAGL0J04224g"
FT                   /product="Strain CBS138 chromosome J complete sequence "
FT                   /function="ATP binding"
FT                   /function="heat shock protein binding"
FT                   /function="unfolded protein binding"
FT                   /biological_process="protein folding"
FT                   /biological_process="response to heat"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAG60838.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="GO:0009408"
FT                   /db_xref="GO:0031072"
FT                   /db_xref="GO:0051082"
FT                   /db_xref="HOGENOM:HBG436112"
FT                   /db_xref="HOGENOM:HBG635315"
FT                   /db_xref="InterPro:IPR001305"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR003095"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR012724"
FT                   /db_xref="InterPro:IPR015609"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="UniParc:UPI00003B6A3D"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPF5"
FT                   /transl_table=1
FT                   /translation="MKSTRSLLLQRRYLSLTHRRVLSSSVRQPLLRRGFHSTSSVKQEF
FT                   KDPYETLGVKKSSSQSDIKKAYYKLAKKYHPDINKEAGAEKKFHDLQNAYEILSDESKR
FT                   KQYDQFGAAAFSGGAGAGPGGPGAGPGGFNPFGNGFGFDFSGGQAGGAGGFGGINFEDL
FT                   FGTAFGGGPFGSSSNSGRRSSSMFREYKGDTIEVIQNLDFKDAVFGKKNVSIKFRALDP
FT                   CGTCNGSGLKSGASKTTCPSCHGSGTTVHVRAGFQMMSTCQTCGGEGTTVNASDFCKSC
FT                   HGEGVNVNTQKTITVDLPHGLQDGDVVRIPGQGSYPDIAVDKEMAKSVKLSRGDILVRI
FT                   RVNKDPHFSIKNKYDIWYTKEIPITTAALGGTVSIPTIEGTKIRIKVPAGTAPEQVISI
FT                   PNMGVPKSSPYRNSAVQARGDMKIQYKVVIRKPQSKAEQCLWEALADVTNDTNAKRTME
FT                   SFASSVEKSVEDKLSDNDNKTSNNSKETYNTTEDNSMNPDAPSTLGRLEKFISNTFKKI
FT                   KGDKN"
FT   CDS_pept        398083..399294
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000066052" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19349238"
FT                   /locus_tag="CAGL0J04246g"
FT                   /product="Similar to uniprot|Q04740 Saccharomyces
FT                   cerevisiae YMR234w RNH1 ribonuclease H "
FT                   /function="nucleic acid binding"
FT                   /function="ribonuclease H activity"
FT                   /protein_id="CAG60839.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0004523"
FT                   /db_xref="HOGENOM:HBG542276"
FT                   /db_xref="HOGENOM:HBG742437"
FT                   /db_xref="InterPro:IPR002156"
FT                   /db_xref="InterPro:IPR009027"
FT                   /db_xref="InterPro:IPR011320"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniParc:UPI00003B6A3E"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPF4"
FT                   /transl_table=1
FT                   /translation="MAKKKGGFYAVQNGRSTGVFTDWNQCSSQVKGYQGAVYKKFDTYQ
FT                   EAQAFSESSSGYGASHSSSGSGSGNRVRGTGGYRGTGGYRDTGGYRDSSSSNHEPVHAY
FT                   FFGSGLTIDSTPNSSPSRSESYKSDNYKSSSSNTYKSPHSSNGKIKKKTYNTRSDKYYA
FT                   VKNSNHPWQNQVFTNWSECQDYVKGRKGVSFKKFESEQGAYDFLDGNTESTDSRILGMS
FT                   REDFKQQYRASDDHKPVQKVTTYCDGSSLGNGTHASKAGYGVYFPHNPSYNISKPLLIG
FT                   PQTNNRAEIMAVSEALDTIWNDLTCHGNKVEYTIKTDSEYVSKLLNDRYSSYTEKEMET
FT                   LPNKDLVKPLIEKYVKVKTYYDVNKDKFSNDKGLKIEWVKGHAGEPGNEMADLLARRGA
FT                   DQRN"
FT   CDS_pept        complement(399703..401283)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000172597" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17438947"
FT                   /gene_name="ACH1"
FT                   /locus_tag="CAGL0J04268g"
FT                   /product="Acetyl-CoA hydrolase "
FT                   /EC_number="3.1.2.1"
FT                   /function="acetyl-CoA hydrolase activity"
FT                   /biological_process="acetyl-CoA metabolic process "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAG60840.1"
FT                   /db_xref="GO:0003986"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006084"
FT                   /db_xref="HOGENOM:HBG001544"
FT                   /db_xref="HOGENOM:HBG289696"
FT                   /db_xref="InterPro:IPR003702"
FT                   /db_xref="UniParc:UPI00003B6A3F"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FPF3"
FT                   /transl_table=1
FT                   /translation="MTVSKLLKERVRYAPYLAKVKTPEELIPLFKNGQYLGWSGFTGVG
FT                   TPKAVPDALIKHVEDNNLQGKLRFNLFVGASAGPEENKWAEHDMIIRRAPHQVGKPIAK
FT                   AINNGKIQFFDKHLSMFPQDLTYGYYTRDRTDGKILDYMIIEATAIKEDGSIVPGPSVG
FT                   GSPEFISVSDKVIIEVNTATPSFEGVHDIDMPVNPPHRVPYPYTKVDQKIGVDSIPVDP
FT                   ERVIAIVESKTRDQVGPNTPSDDMSKAIAGNLIEFFRNEVKHGRLPENLLPLQSGIGNI
FT                   ANAVIEGLTDANFKHLNVWTEVLQDSFLDLFENGSLDYATATSIRLTEPGFERVFKNWD
FT                   FYKSRLCLRSQVVSNNPELIRRLGVIAMNTPVEADIYAHANSTNVNGSRMLNGLGGSAD
FT                   FLRNAKLSIMHCPAARPTKVDPTGISSIVPMVSHVDQTEHDLDVLVTDQGLADLRGLSP
FT                   RERAREIINKCAHPDYKPLLQDYLDRAEHYATKHGCLHEPHMLKNAFKFHTNLAEKGTM
FT                   KVESWDPVE"
FT   CDS_pept        complement(403542..404615)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000233024" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20196060"
FT                   /locus_tag="CAGL0J04290g"
FT                   /product="Strain CBS138 chromosome J complete sequence "
FT                   /function="ATP binding"
FT                   /function="MAP kinase activity"
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="CAG60841.1"
FT                   /db_xref="GO:0004707"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG537393"
FT                   /db_xref="HOGENOM:HBG755340"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR003527"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI00003B6A40"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPF2"
FT                   /transl_table=1
FT                   /translation="MGKKIVFNISSDFQLKSLLGEGAYGVVCSAVHKPTGEIVAIKKIV
FT                   PFDKPLFALRTLREIKILRRFQHENIISIFDIQKPESFEKFNEVYIIQELMQTDLHRVI
FT                   ATQTLTDDHIQYFIYQTLRAIKTLHGSNVIHRDLKPSNILINSNCDLKVCDFGLARIID
FT                   SGENGDNEVDKIGMTEYVATRWYRAPEVMLTNAKYSRAMDIWSCGCILGELFLKRPLFP
FT                   GKDYRHQLLLIFGLIGTPDSSDKSMECIESRRARQYIASLQKYPPVRPLQKAFPGVNPV
FT                   GVDLLSRMLVFDPRERISADDALAHPYLSTYHVPEDEPAGEPIPPDFFQFDQYKEVLTT
FT                   KDLKKLLWNEIFHEQAT"
FT   CDS_pept        406058..410602
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000169063" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20196061"
FT                   /locus_tag="CAGL0J04312g"
FT                   /product="Strain CBS138 chromosome J complete sequence "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAG60842.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG191502"
FT                   /db_xref="HOGENOM:HBG395571"
FT                   /db_xref="InterPro:IPR002860"
FT                   /db_xref="InterPro:IPR006581"
FT                   /db_xref="UniParc:UPI00003B6A41"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPF1"
FT                   /transl_table=1
FT                   /translation="MRLPSIFLVFFYLFARTLCWSPEVSLLHGVDSLASIIPFDDSSTI
FT                   LSVGRKGVNVSHDYGRTWETKLRNKGEYPVSVTLNTFRPNSRAFVFLNGKLYGTHNEGS
FT                   DWFESKFPSDRQLTKALTIDFSPFAKDVIIASFVAKDNQNDEKEFNYVSTDDGKSFRVL
FT                   DVGQEYESMRCRFLSISHESNFPHNDNIICMTKTSSPDQNKLLLSENRGKSFKELSIGE
FT                   DIAFDNFYLTNSYLVIRSIRDIHNKAAEVDLYVSSDAKDFKKAYLPTTLRRSDIRRIIE
FT                   LLGRKMFITLTRSSESNVQDDNGNTLFTDGLVSNSDGLKFTSFSTSASKSRTTITPVEF
FT                   LNGTFIQKQVGRNSGGYSISIDNGNTWRKLKYSDKGNKNPIKCQDENDCNLELLIPQIF
FT                   HGPTAGILVMLGHINDNFSDQQTFISRDGGLNWEMGLEFPGIYATGDLGNVIVACPVDP
FT                   SSDNDPQSEIYYSLDQGMTWSEYQLDEMFIPIDVINITPDGSGLSFILTGFSLDKPDDQ
FT                   RPNIDNRVTYLIDFNNVHDGKKCKAKDYEKFELAEGSCINGAKYTFNRRKQSAKCIGGE
FT                   VFKDLLFDMEVCTECQEQDYECSSEFIKDSKGVCVVDEKWLSATGNCPSTDIKKPAMRL
FT                   IADNMCKKELPIQSKSVSCKNKNPSDPKDIPKKPKEGDRPTFGTGDIQATFNTFKGKVR
FT                   FYQYFDTDEDESLILATSEGEAYISHDSGQTYTHFNYNKPKVHEIVFNEYFNSSAYIFD
FT                   IDGNLHVTHDRGYTFDTIRLPASLQLGLPLNFHSKDPNTFIYYGGKNCKSIFDTNCHIV
FT                   AFITRDGGKSFSELLPNAIHCEFVGSSLKLSDSDDLLFCQVKDETSSKTRQRSLVSTTD
FT                   YFETEPKVVFQKILGYMTNGEYVIIAVPGENHEITAYVTMDGDEFAETLLPYDLDIEQP
FT                   EAFTVLGSSTGSVFLHFTSFQENSVAFGSLLKSNTNGTSYVKLQSNVNRNEAGYVDFEK
FT                   VQGLDGIILTNVVTNADEIKDGSSQKHLRTKITFNDGVDWEYIKPPKKDSSGDSYHCKS
FT                   NKLEHCSLNLHSYTERKDFRDTFSSGSALGMMIGVGNVGDKLLPFEECSTFLTIDGGKS
FT                   WTEIKKGAYQWEFGDHGGILILSRDGEMTNSISYSTDFGKSWYDYQFSDEKVLVSDIVT
FT                   VPQDSALRFLLITADRIGRGFESGTVTVDFSGLFKRQCVLDFNNENHDDFDYFSIGNSE
FT                   NECIFGHKVKYLRKNSEECYVGAVSLSQFTRVMKNCTCTRADFECDYNFVRQYDGTCKL
FT                   VDGLQPGNEAAICKKDPDLVEYFQSTGYRKIPLSTCQGGLKLDGRTEPLPCPGKEKEFK
FT                   QKYGISGSSFFLLFFVPFLFFVSAGWFVYDRGIRRNGGFARFGEIRLGDDQLIEENTTD
FT                   KVVNTIIRFGVASFEVMAGGFGIIRRIANNSFNRITGRMNGRYRPSYSNLMHDDFLDEA
FT                   DDLLAGHDDDANDLASFMDDDSNFDIEDETTSVNDSGYRDQSPETENVVDSNN"
FT   CDS_pept        411050..411427
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000716" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17438948"
FT                   /locus_tag="CAGL0J04334g"
FT                   /product="Strain CBS138 chromosome J complete sequence "
FT                   /protein_id="CAG60843.1"
FT                   /db_xref="HOGENOM:HBG059348"
FT                   /db_xref="HOGENOM:HBG204263"
FT                   /db_xref="InterPro:IPR020347"
FT                   /db_xref="UniParc:UPI00003B6A42"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPF0"
FT                   /transl_table=1
FT                   /translation="MGSTKYKEWQYFLLSIRAESDVDHIDEVTWKQAVSNALRKSHGLF
FT                   GEQIELYWLKIDNKRAIIKCGFADKDILKTALATYISSTELVGSPLVITMEQEASQLNN
FT                   LFLPEDDKLWFNKIVEIENGD"
FT   CDS_pept        complement(411562..413079)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000246560" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17438949"
FT                   /locus_tag="CAGL0J04356g"
FT                   /product="Similar to uniprot|P38207 Saccharomyces
FT                   cerevisiae YBL019w APN2"
FT                   /function="DNA binding"
FT                   /function="endonuclease activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="DNA repair"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAG60844.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0004519"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0006281"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG302595"
FT                   /db_xref="HOGENOM:HBG395675"
FT                   /db_xref="InterPro:IPR004808"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR010666"
FT                   /db_xref="InterPro:IPR020848"
FT                   /db_xref="UniParc:UPI00003B6A43"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPE9"
FT                   /transl_table=1
FT                   /translation="MGAIDPLLPDNIRFVTFNVNGVRTFFHYAPFSEMRQSLRSVFDWF
FT                   ESDVITFQELKTEPLSLNKWGKVDGFYSFISIPQKRKGYSGVGCWVRIPPRDSPKYNAL
FT                   QVLRAEEGITGYLEVKNGKQSVSYRDDSEIGIGGYIPDDSLPDHISTSDALQLDSEGRC
FT                   VIVELKCGIVVISVYCPANSTCTDEGEVFRMRYLKLLFARIRNLQMMGKMVVLMGDLNI
FT                   CRDLIDHAVSLEEYHISIGNESTGTQIDEEYRDFAIKFIVNPEVPHRLLLNQILDDSMV
FT                   PNTDNEFCLIDTTRKVQGRDRLKMYTVWNTLKNTRPSNFGSRIDFILVSKDLGNNIEKA
FT                   DILPDINGSDHCPVFCDINLNNLTLTSNISVEEKIPKFEARYRYNMTNRNIFDMFAKKS
FT                   GKSSSSIGNKLKSEPIKDKVSKPIHKRSAEAITDKMGTTPNQTPKDKIALFFQGSFGPP
FT                   PLCKHKQHAILKTSKTSNNPGKKFWTCSKPRGHQNDENSSCGFFEWA"
FT   CDS_pept        complement(413393..415048)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000000715" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19349239"
FT                   /gene_name="RFT1"
FT                   /locus_tag="CAGL0J04378g"
FT                   /product="Oligosaccharide translocation protein RFT1 "
FT                   /function="lipid transporter activity"
FT                   /biological_process="carbohydrate transport"
FT                   /cellular_component="endoplasmic reticulum membrane "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAG60845.1"
FT                   /db_xref="GO:0005319"
FT                   /db_xref="GO:0005789"
FT                   /db_xref="GO:0008643"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG059346"
FT                   /db_xref="HOGENOM:HBG397989"
FT                   /db_xref="InterPro:IPR007594"
FT                   /db_xref="UniParc:UPI00003B6A44"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FPE8"
FT                   /transl_table=1
FT                   /translation="MSGADILEKTTRGATFLMMGQLFSKIVTFLLNNTLVRYLSPRIFG
FT                   ITAFLEFIVGTVLFFSREAIRLSTQRIADGNDADNDHDHDRDDSALQVCVNFAMIPLFI
FT                   GIPLSIGLIAWQYHNINGYFVTLPFFQWSVFAIWVGIILELVNEPLFVLNQHFLNYGAR
FT                   SRYESIAVTANCLVNFTVVYSYEKKLILTSYFDDSERFREGIAILAFALGKLAYAATLL
FT                   MCYYYNYLMNFKSNKPFKLSLQKIKSKVNEKQTYYFRSDILEHFKKVYFQLCFKHLLTE
FT                   GDKLIINTFCTVEEQGIYSLLSNYGSLITRLLFAPIEESLRLLLAVLLSKKDSKNLQLS
FT                   MKVLVNLTKFYLYLSLLVMIFGPNNSSYLLQFLIGSKWSTNSVLHAIRVYCVYIPFLSF
FT                   NGIFEAFLASVATGDQILRHSYFMMMCSFAFLINSWIFIEYLDLSVNGLIISNIINMSL
FT                   RIIYSFSFIVKFYRELHTESSIFMNFTNFKATLGAAALVAILNWQMVGYVSSFNGFITS
FT                   ATLALILLSVILIKERATLNELIINRRAANMKSV"
FT   CDS_pept        415482..415838
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000211832" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18501415"
FT                   /locus_tag="CAGL0J04400g"
FT                   /product="Strain CBS138 chromosome J complete sequence "
FT                   /function="sequence-specific DNA binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG60846.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0043565"
FT                   /db_xref="HOGENOM:HBG435328"
FT                   /db_xref="HOGENOM:HBG748799"
FT                   /db_xref="InterPro:IPR003956"
FT                   /db_xref="InterPro:IPR003957"
FT                   /db_xref="InterPro:IPR003958"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="UniParc:UPI00003B6A45"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPE7"
FT                   /transl_table=1
FT                   /translation="MGNTTEDDIDKQIELREQDRWLPINNVARLMKNTLPETAKVSKSA
FT                   KECMQECVSEFISFVTSEASDRCAQDRRKTINGEDILISLHALGFENYAEVLKIYLAKY
FT                   RQQQALKNNYEEDS"
FT   CDS_pept        416515..419595
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000261409" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17438950"
FT                   /gene_name="PIM1"
FT                   /locus_tag="CAGL0J04422g"
FT                   /product="Lon protease homolog, mitochondrial "
FT                   /EC_number="3.4.21.-"
FT                   /function="ATP binding"
FT                   /function="ATP-dependent peptidase activity"
FT                   /function="DNA binding"
FT                   /function="serine-type endopeptidase activity"
FT                   /biological_process="proteolysis"
FT                   /cellular_component="mitochondrial matrix"
FT                   /protein_id="CAG60847.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0004176"
FT                   /db_xref="GO:0004252"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005759"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="HOGENOM:HBG351191"
FT                   /db_xref="HOGENOM:HBG566281"
FT                   /db_xref="InterPro:IPR001984"
FT                   /db_xref="InterPro:IPR003111"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004815"
FT                   /db_xref="InterPro:IPR008268"
FT                   /db_xref="InterPro:IPR008269"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniParc:UPI00003B6A46"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FPE6"
FT                   /transl_table=1
FT                   /translation="MLGTRVTRAVYTRAPLKLQLRALGLHRRYVHNGSKNDEGSSTSTT
FT                   TNKEENDKKLPDVYPQMLALPISRRPLFPGFYKAVVISEPRVMKAITDMVERQQPYIGA
FT                   FMLKDSNNDTDIIHDISEVHELGVLAQVTSAFPSKDEKTGKETMTALLYPHKRIKIDQL
FT                   IPPKDVKIEDIVVEKVVDNEVASEETKDEETVDKTESATDKVSEEITEEIAKAPSTEVT
FT                   EDPDNYENPTDFLKDYNVTLVNVSNLEDEPFDIKSPIINALTSEILKVFKEISQLNSMF
FT                   REQIATFSASIQSATTNIFEEPAKLADFAAAVSAGEEEELQEVLESLNIEQRLEKSLLV
FT                   LKKELMNAELQNKISKDVETKIQKRQKEYYLMEQLKGIKRELGIDDGRDKLVDTYKKRV
FT                   EKLNLPENVQKTFDEEITKLATLETSMSEFGVIRNYLDWLTSLPWGINSKEQYSIPRAR
FT                   KILDEDHYGMKDVKDRILEFIAVGKLLGKVDGKIICFVGPPGVGKTSIGKSISRALNRQ
FT                   FFRFSVGGMTDVAEIKGHRRTYIGALPGRIIQALKKCQTQNPLILIDEIDKIGHGGIHG
FT                   DPSAALLEVLDPEQNNSFLDNYLDIPIDLSKVLFVCTANSLDTIPRPLLDRMEVIELTG
FT                   YVAEDKIKIAEQYLVPSAKKTAGLQNATVSMDEEAINALMKYYCRESGVRNLKKHIEKI
FT                   YRKAALEVVKKMSIEDTEPLVSTSEEPQLSQTNQNISSSSAEDSTTDLEDSVNPDTAKE
FT                   ASKPNNSQEGASVEETKKAVKTEEEEDTSMIVPEDIKVEITPEDLKKYVGPPIYTTDRL
FT                   YETTPPGVIMGLAWTNMGGCSLYVESVLEQPLHNCKHANLERTGQLGDVMKESSRLAYS
FT                   FSKMYLSKKFPENRFFEKAAIHLHCPEGATPKDGPSAGVTMATSFLSLALNKPVDPTVA
FT                   MTGELTLTGKVLRIGGLREKVVAAKRSGAKTVIFPKDNLNDWEELPENVKEGMEPLAAD
FT                   WYDDIYKRLFSGVKKSEGNNVWKSEFELIDKKKKEND"
FT   transit_peptide 416515..416601
FT                   /gene_name="PIM1"
FT                   /locus_tag="CAGL0J04422g"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FPE6 "
FT   mat_peptide     416602..419592
FT                   /gene_name="PIM1"
FT                   /locus_tag="CAGL0J04422g"
FT                   /product="Lon protease homolog, mitochondrial "
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FPE6 "
FT   CDS_pept        420259..422898
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000224124" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19349240"
FT                   /locus_tag="CAGL0J04444g"
FT                   /product="Similar to uniprot|P29469 Saccharomyces
FT                   cerevisiae YBL023c MCM2"
FT                   /function="ATP binding"
FT                   /function="DNA binding"
FT                   /biological_process="DNA-dependent DNA replication
FT                   initiation"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG60848.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006270"
FT                   /db_xref="HOGENOM:HBG409874"
FT                   /db_xref="HOGENOM:HBG546212"
FT                   /db_xref="InterPro:IPR001208"
FT                   /db_xref="InterPro:IPR008045"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR016027"
FT                   /db_xref="InterPro:IPR018525"
FT                   /db_xref="UniParc:UPI00003B6A47"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPE5"
FT                   /transl_table=1
FT                   /translation="MSDNRRRRRDPEDDEHDSDNENVGMPPSSPQHHGSRNLFGPGSSP
FT                   IGSPVRDEDQENDDELGMLNPEGDDNEIDDAPDIDEVEEQMNEVDLMDDDMYGDYRSDP
FT                   TKDRYEGLGVDDTEQKELSLSDRRRIDAQLNERDRLLKNVAYLDDDDEAMGNEQLDEMG
FT                   LPKQRRRRRRQYEDFEHSDDDLLSDLDADPLREELTLESLSNVKANSYSEWVVQPNVSR
FT                   TIARELKSFLLEYTDETGRSVYGARIRVLGEMNSESLEVNFRHLAESKAILALFLAKCP
FT                   EEMLKIFDLVAMEATELHYPDYSRIHSEIHVRISDFPTIHNLRELRQSNLSTLVRVTGV
FT                   VTRRTGVFPQLKYVKFNCLKCGSILGPFFQDSNEEIKISFCTNCKSKGPFSINGEKTVY
FT                   RNYQRITLQEAPGTVPAGRLPRHREVILLADLVDVSKPGEEIEVTGIYKNNYDGNLNAK
FT                   NGFPVFATIIEANAVRRREGNLANENEEGLNVFSWTEEEEREFRKLSKDRGIVDKIIAS
FT                   MAPSIYGHKDIKTAVACSLFSGVPKNINGKHAIRGDINVLVLGDPGTAKSQILKYVEKT
FT                   AHRAVFATGQGASAVGLTASVRKDPITKEWTLEGGALVLADKGVCLIDEFDKMNDQDRT
FT                   SIHEAMEQQSISISKAGIVTTLQARCSIIAAANPNGGRYNSTLPLSQNVSLTEPILSRF
FT                   DILCVVRDVVDEESDERLASFVVDSHVRSHPGYDSIDDEEGKDGEQKNDDDIQLSNRQK
FT                   RAERQRKKEEEISPIPQELLIKYIHYARTKVYPRLHQMDMDKVSKVYADLRRESITTGS
FT                   FPITVRHLESILRIAESFAKMRLSEFVSSWDLDRAIKVVVDSFVDAQKISVRRQLRRSF
FT                   AIYTLGQN"
FT   CDS_pept        complement(423298..424083)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000001145" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18501416"
FT                   /locus_tag="CAGL0J04466g"
FT                   /product="Similar to uniprot|Q06991 Saccharomyces
FT                   cerevisiae YLR414c"
FT                   /function="structural molecule activity"
FT                   /cellular_component="tight junction"
FT                   /protein_id="CAG60849.1"
FT                   /db_xref="GO:0005198"
FT                   /db_xref="GO:0005923"
FT                   /db_xref="HOGENOM:HBG123612"
FT                   /db_xref="HOGENOM:HBG202583"
FT                   /db_xref="InterPro:IPR009571"
FT                   /db_xref="InterPro:IPR017974"
FT                   /db_xref="UniParc:UPI00003B6A48"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPE4"
FT                   /transl_table=1
FT                   /translation="MRNFVALILALFFALASLVLACIACAGSTKNYYPINQIFCAQLDL
FT                   SNLDIATVIPAASSFSISDLGLPKFINIGLWSYCVASSSTDVTSCTSPNGIQTFNLKNL
FT                   LKDNIENNQVLQLVDDVAKIVLPQQLQDKLVYYNNLVKCMFITLIIGIVLTFLNLVINV
FT                   LRWFLHFSFVNFVGGFVCFLSFASLLISVGTNMGTYIYIRHILNKNYSDYGIHLSLGRK
FT                   FLALLWAAVVAALLNLFCWMTVRQRKKVVYVHQPYNDKY"
FT   CDS_pept        426177..427742
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000067728" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17438951"
FT                   /locus_tag="CAGL0J04488g"
FT                   /product="Strain CBS138 chromosome J complete sequence "
FT                   /function="zinc ion binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAG60850.1"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG059077"
FT                   /db_xref="HOGENOM:HBG202585"
FT                   /db_xref="InterPro:IPR001876"
FT                   /db_xref="InterPro:IPR007286"
FT                   /db_xref="InterPro:IPR021648"
FT                   /db_xref="UniParc:UPI00003B6A49"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPE3"
FT                   /transl_table=1
FT                   /translation="MEYWHYVETTESGQPLLRESEKDILIDHNVGLYQGKERIRNRQNG
FT                   RIFLTSQRIIYVDSKEPTKYSLGIELDDIDHLDYSSSFLRRSARLIIFMDVHSASSGLH
FT                   NINNKLTEEVHTTTWVCPICMVTNETEGEFKANTQPPPVCVNCGVPADYELTKNSITIQ
FT                   GNSTDSNSHSDKKENKNSCPACTFINHPQVRNCEICGTRLNNTKIRNRLALSRRKQDSR
FT                   LTIELDSISSVKSSRSAEECFIQVSFRKSDGILFSDAVEKTITDLKASTKFNRNTIEKT
FT                   NKSEENGELNLLETKLSKIGITSLEHSRENQILNNDIIFTSALTDLDKLISLADSIERL
FT                   YRKESIDNQSVKKPNLILDRDTFYNKEQFLSEVSREIYDFVKNGFKNNYVMITLVDLYA
FT                   LYNKSMRIGTGLISPAEMREACEKFGSFGLSDLYLKKINGCVLCVCTDDAFDYIRQKII
FT                   DIIDRSPGADLLTLTQKFNDEPNNNWGIGVIQEVLKSCIDEGQLLIDKQISGIYYYCNN
FT                   AWKL"
FT   CDS_pept        complement(427882..428994)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000163861" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21044863"
FT                   /locus_tag="CAGL0J04510g"
FT                   /product="Strain CBS138 chromosome J complete sequence "
FT                   /protein_id="CAG60851.1"
FT                   /db_xref="HOGENOM:HBG176749"
FT                   /db_xref="HOGENOM:HBG395398"
FT                   /db_xref="InterPro:IPR007852"
FT                   /db_xref="UniParc:UPI00003B6A4A"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPE2"
FT                   /transl_table=1
FT                   /translation="MSVLVQLKKQLSSASEFTLVDGTGSTTADITNAEFIQFKEDKLPL
FT                   DEATEFIVDEQPAKLRVIIQCWLHKDDSAAEYLADCQEKKITNISFLQRNDLLKWLSGE
FT                   SETSEYLDVKNIKTDNSEADVNTKTDVSESQKIIDDPVLQEATQKERILIDHNSMLHGS
FT                   KPVDFGYLIKDAELKLVHSIKATLRSKQGSGKPGAVSKHGSQNQKTQKKDPIILIPSAA
FT                   SSLFAISNIKQFLESSQYINPRDATANTGSDVITVEKKFDRISRPIKFIVVNNTRMFTK
FT                   PEYWDRVVAVFTTGHTWQFNNYQWNTPQELFQHCKGYYFHFTGDSVPQNVQQWNVDKVE
FT                   LDKTKRFKDVEVVRYFWNTIEKELMARGFR"
FT   CDS_pept        429277..433539
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000167651" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17438952"
FT                   /locus_tag="CAGL0J04532g"
FT                   /product="Similar to uniprot|Q06698 Saccharomyces
FT                   cerevisiae YLR419w"
FT                   /function="ATP binding"
FT                   /function="ATP-dependent helicase activity"
FT                   /function="nucleic acid binding"
FT                   /protein_id="CAG60852.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0008026"
FT                   /db_xref="HOGENOM:HBG525455"
FT                   /db_xref="HOGENOM:HBG735166"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR006575"
FT                   /db_xref="InterPro:IPR007502"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR011709"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="InterPro:IPR016135"
FT                   /db_xref="UniParc:UPI00003B6A4B"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPE1"
FT                   /transl_table=1
FT                   /translation="MAKKKGKNETPALEKAANKSNSGPTGGKRGKRVLTEEQKAQQQSN
FT                   RAKVTSTSSWTGKLPHTLLHEFCQKRKWGKVEYDMKKIGSKGFIGIAIISSVDPKTRET
FT                   LLVRLNDPTYDKAVGQGALEPQETTMEARHYAATVALYRLAYNTNTHMMLPPNHKSIWY
FT                   KLDDFRKSLKKDDRAQRYFCDDPFKQLIEERKEKAIKDKQNESRMQQAAKNESTPVIIN
FT                   SVNNNMKDNDGSLTKKVNKPVRKSTKEVTFSRNVWESANFIDLNESSRQQIENCIKRNA
FT                   DWESEMLKSSNNTPERQELKSKLINLGFREAHVNEAMLYKDPLSFLLFNLPEDDFPRYF
FT                   QKRKEDSKNIIEISTLPLQKQITLERLQEFPVSKDEALFALDLYNGSEALAAGYLTQSM
FT                   IPDLPILGTEEIDNPESKEMWIQELESLKCIFEDKIEVIDEPNCYVISLMEKYSLKLKV
FT                   YRTPNYPQHIPGIVVSTFSKKIKLPNYIKKQVMIKLLHHVKESGIIGGEMIYEIYQWLL
FT                   DNIKSIIDNPGKLLNIDDMKSSSNFEIIEARKSKMKLNKKNQEASLTKDELSALLDEYK
FT                   KRILTNNYKLMQDQRMQLPAWKKKDHIVDLIMKNQIVLITGETGSGKSTQVCQFVLDAL
FT                   FTSNNSNELQKKILVTQPRRISAIGLAERVAAERCVPCGEEVGYTIRGVNKSSKFSKIR
FT                   FMTTGVLVRILQSSMKSLENCIIIIDEVHERSIDTDLLVALLKQIMEKVKTLKIVLMSA
FT                   TVNVNLFHNYFPGLVSSHIEGRTFPIKDYFLEDILDQLDFKIKRNKYHEYDDDDDDDSI
FT                   SSHDNQFLRPTADSKFFRTGQINYDLLCQLVLHVNDKLTSENNSGSIIVFLPGVAEINR
FT                   LCRMLENNNLVVLPLHSALSAEDQKQVFKKFSKRKVVVSTNIAETSITIDDCVATIDTG
FT                   KAKIMMYNAKDNSTRLIERFISRAESKQRRGRAGRVREGLSYKLYSKRLYEEDMVEMPT
FT                   SEINRVALDSLYLSVKAMGIRNVKSFLAKGLEPPPLNALEMAEIQLSMIGLLDRKNEEL
FT                   TQLGKYVSMMPLVDPKYGKLLLFGIIFGCVSKCVLIASILSLSNSPFIGGTENRDNIKQ
FT                   MLKEHGDDGDILAIVDIVEKCLSKTNSSDRGKYMKQHYLSFNKLREIESSISQYYSILS
FT                   DLGFLPIKYRQSEGSELERNGKSKSILKAILAGTLYPNIARVQLPDMKYLSTSMGSIEK
FT                   DLEAKQIKYWIRNEELQTELQKLKDEGKEINWRNNDLPPSTKRAFLHPSSVLFQGNEMS
FT                   VVELQALQDDLHRISKKTSPTSLTSPFVAYVSTQLTSKQFINGLTPVSTLVLLLFGGVL
FT                   RYDIDSESLSPGIIMDDWIPIRTWCKNGILLNELRLTLDKAIQTVLEKPQYVSGTQNTS
FT                   KNLEHVFQLVHNLIEIES"
FT   CDS_pept        complement(433719..434978)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000185898" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21044864"
FT                   /locus_tag="CAGL0J04554g"
FT                   /product="Strain CBS138 chromosome J complete sequence "
FT                   /function="pyridoxal phosphate binding"
FT                   /function="transaminase activity"
FT                   /biological_process="biosynthetic process"
FT                   /biological_process="cellular amino acid metabolic process "
FT                   /protein_id="CAG60853.1"
FT                   /db_xref="GO:0006520"
FT                   /db_xref="GO:0008483"
FT                   /db_xref="GO:0009058"
FT                   /db_xref="GO:0030170"
FT                   /db_xref="HOGENOM:HBG122224"
FT                   /db_xref="HOGENOM:HBG446828"
FT                   /db_xref="InterPro:IPR000796"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniParc:UPI00003B6A4C"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPE0"
FT                   /transl_table=1
FT                   /translation="MVKISATVYNDVEPIKTDILFATKQRYLKDTRGFKVDLGVGAYRA
FT                   DNGKPWILPSVRKAERLVQEEDDYDHEYLNICGLDSLTNSAAKVILGEDCPALRESRVI
FT                   SVQSLSGAGALHVAAKFIKKYTPEKKIYLSNPTWPIHQSIFENVDLETDSYPYWDATNK
FT                   SLDFEGFIKAIDHAPRGSIFVLHACAHNPTGLDPTQEQWHQIIESIQKGDHIPLFDSAY
FT                   QGFASGDLERDAYAIRYTINQLRDCAPIFVAQSFAKNVGMYGERVGCLHLVLPAQKEDI
FT                   VPIKDAITSQLSRIIRSEISTPPAYGAKVVSKIFTTPELKEQWYQDLVTMSSRIISVRT
FT                   RLRDLLAEYNTPGNWDHIVQQCGMFSFTGLTPEMTKRLETEHAVYMVPTGRASVAGLNT
FT                   GNVQHVAKAINEVVNHFMKD"
FT   CDS_pept        complement(435699..437354)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000182223" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17438953"
FT                   /gene_name="DPH2"
FT                   /locus_tag="CAGL0J04576g"
FT                   /product="Diphthamide biosynthesis protein 2 "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAG60854.1"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="HOGENOM:HBG059079"
FT                   /db_xref="HOGENOM:HBG446814"
FT                   /db_xref="InterPro:IPR002728"
FT                   /db_xref="InterPro:IPR010014"
FT                   /db_xref="UniParc:UPI00003B6A4D"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FPD9"
FT                   /transl_table=1
FT                   /translation="MSNEDILVPAALSTHQDESDFTFQKFDSDSMERSFYLGPLSSQDE
FT                   LWDKLMQYYSIDKLIAYLQRNPEYVQITLQFPDTLVKDSSFIIRALQDKLDGDGAGRKF
FT                   WALADTAYSACCVDEVAAEHVKGDLVIHFGDACLNAIQKLPVVYDFGKPFLDTDVLLAC
FT                   FTEEFKDKDQKICLMSNASYTHHIPDLYSRLKSNGYTNVVYSVVNTGLLTETAEIIDNT
FT                   TPLSDTDELFTLGNRVLMGARQEEDIDEETLRNEYALFHITMPHDPHLLYLTTVFESIH
FT                   TYDVADQVISNGPYPSLTRRYKNMHKARTAGCIGILVNTLSIRGTRETVNKLIKLIREN
FT                   GKKHYLFVVGKPNVPKLANFEPVDIWCILGCGQSGIIVDEFGEFYKPIITPYELTLALN
FT                   FEVTWTGKWIIDFQKAITEIDNSLAELGIDDSKHGNDSDHDLDAPEFDAVTGKYVSSSR
FT                   PLRALNHLQLDAPSNEDKQVMARVNGGTVIKGTVSTAVEHLANRAWTGLGSDYKDDEGY
FT                   EEDGATVEEGISGIARGYEFDQEDAARKSQNQSQ"
FT   CDS_pept        437730..438806
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000256259" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19349241"
FT                   /locus_tag="CAGL0J04598g"
FT                   /product="Similar to uniprot|P20051 Saccharomyces
FT                   cerevisiae YLR420w URA4 dihydroorotase "
FT                   /function="dihydroorotase activity"
FT                   /biological_process="pyrimidine base biosynthetic process "
FT                   /protein_id="CAG60855.1"
FT                   /db_xref="GO:0004151"
FT                   /db_xref="GO:0019856"
FT                   /db_xref="HOGENOM:HBG001203"
FT                   /db_xref="HOGENOM:HBG628648"
FT                   /db_xref="InterPro:IPR002195"
FT                   /db_xref="InterPro:IPR004721"
FT                   /db_xref="UniParc:UPI00003B6A4E"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPD8"
FT                   /transl_table=1
FT                   /translation="MSEIDLGITCDMHVHVREGDMCELVTPSIRDGGVSVCYVMPNLQP
FT                   PITTLDRVVAYKKKLQELAPETTFLMSFYLSRDLTPELIHEAARAKAIQGVKCYPAGVT
FT                   TNSSAGVDPNDFTAFYPIFKAMEEEHLVLNLHGEKPSVAKEDIHVLNAEESFLPALKKL
FT                   HTDFPNLKIILEHCTTEAAVNAIEEINKNVTNISDVKVAATLTAHHLYLTIDDWAGNPI
FT                   NFCKPVAKLPRDRRALVAAATSGKPYFFFGSDSAPHPLEMKGRHIGVCAGVYTQSLAIP
FT                   YVAQVFHEANAMDKLKGFVSDFGLAFYDVPQSEIRSTQHAILYKQEQTVQDTIQGKNNL
FT                   KVALFKPGEKLDFSVKWQ"
FT   CDS_pept        complement(438990..439445)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248563" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17438954"
FT                   /locus_tag="CAGL0J04620g"
FT                   /product="Similar to uniprot|O13563 Saccharomyces
FT                   cerevisiae YLR421c RPN13"
FT                   /cellular_component="cytoplasm"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG60856.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="HOGENOM:HBG059081"
FT                   /db_xref="HOGENOM:HBG626713"
FT                   /db_xref="InterPro:IPR006773"
FT                   /db_xref="UniParc:UPI00003B6A4F"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPD7"
FT                   /transl_table=1
FT                   /translation="MSEVVVRAGICEFDESSKLCDPLPVQGSIKMAPHEEGIELGFWSF
FT                   EWSPVEKTAKPMEPISLILIPGETKCVRLSSKNGRVFSLVFSSDQKYFFWLQEKNAGSL
FT                   KLDQFSENDLKFLEKLDSILKGPEEEEEEEAEDLTEKLKHEDVEMKD"
FT   CDS_pept        439679..445423
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000141938" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20196062"
FT                   /locus_tag="CAGL0J04642g"
FT                   /product="Similar to uniprot|Q06409 Saccharomyces
FT                   cerevisiae YLR422w"
FT                   /function="GTP binding"
FT                   /function="GTPase binding"
FT                   /function="guanyl-nucleotide exchange factor activity "
FT                   /protein_id="CAG60857.1"
FT                   /db_xref="GO:0005085"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0051020"
FT                   /db_xref="HOGENOM:HBG059082"
FT                   /db_xref="HOGENOM:HBG202586"
FT                   /db_xref="InterPro:IPR010703"
FT                   /db_xref="UniParc:UPI00003B6A50"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPD6"
FT                   /transl_table=1
FT                   /translation="MVEVKRRWVPLNGLQFGVMVRSYLPLKRHPSLFYHNHQFMNVYAG
FT                   AEVYVFEESEDGKWCRAYFCCRPFPEEFIASSSSTNEKLPDVKPVVCVFPKCYVALDPN
FT                   RFVHIISFFKAPDRSDFENEQLAECKSPSLYDTLSESQDHEVAKLANSKPTRPPFPYFR
FT                   YQKRPFVDEMGPVLSLLCSHIYWMYSLGEFEIHTKLVGLYYELDNIRLRLRLQLTTEIE
FT                   RIKLIRAANSLLAKISKFISSKGRTNRFLIQSKSSNPDPYGFEGIFARDIITGELLSYH
FT                   DTELRTLMLSSMLYGLTNNFPNTESSILQFEAPKCEVYDRAKSHILIDFKSITSDPSVL
FT                   NPNLENATAITYLMTPNERLTDPIEFQIPNGKRDTSFVTLLFESLFHSVIKKNKIYLVL
FT                   IITETVDINTNTMKSKAALSSFKEPFIPFKENDESLLHKLKRGIVAGVIDISPVFSKQK
FT                   GIAHADTPHRFVINLFGSRFKSGFCPSSASQNSYDDQETLLGWGALVNNILSDSTMGIA
FT                   INPRALSVPVTVKEILDEPFADKVRSSNIISVLSVPMKVNRNKIEKKESLYLTLGCVCL
FT                   CDIGQKETNIKNIAVQVNSKNDKVKFSYSDLGVKRNNWNFISVRPGESIGETVRIDGLE
FT                   HMAEDESIRVLVFLNGFLMAKSNICIKKNGVFLEYKKFTGFHLMSSIGQKLVNLQLKLK
FT                   YNGANYNIHPSISKFLVFRDYSDMLAECKKQSVDCIISGLQDAPLPQLIVHFHSLLRKL
FT                   LQYFKDVKELNHDKEGKKNRLTVFANLVGLLNSLVVDDVNDICFFEEFYENLPLHEPEL
FT                   SMTGIEIVNCMSDVFEPGFECWHKIGRQACKAFVHLLLLSTISCLDYMNEWKQAVKSLF
FT                   VNITKFLSLTEESIYYDQILILRAYPLCISALHQYFEPYELLIVTDRLFGSCQEKDNKL
FT                   NFTQKCISPEEEKYLGEKFSSLLSVITHKSLQTYLFDCNDNSNMKLEFFSRCIEWVQQP
FT                   YFYYSDNNDVISYTRVANTVMMTLLENITNVQILRNLIRLIPRYCEYFILIRKYCKKAN
FT                   FFRTRRIFTKLFPTQTAPFSIPMDSIVNDEVVIEILLEIATIICKITKMATTLYGKNPS
FT                   FLEIINECKNDTHFQSSAYIKHCSKETVLLITKTQKYFLKGDFFPCKKWLGVTALFARS
FT                   CLIMLTMCKQFMIKEFSPYPITRGNDMHFDEQLWADYFSALFMIANHKVSTLTRLAIIP
FT                   RKAVYLISGNLKKQVSSVLSECWTGLANESFDHDFLCKYGTGDVSSYQLQLLTNHPNIV
FT                   REIFRFGLNRHLQAVKTSTNIIWTMVLLFWNHYESLQPAINLCIPELFNAYQSGKFYMY
FT                   DDELERFMICLFYRIHIDEHDVMYNPLIDFLEKIMGFFHIVSETYKIPTQQEFDDDRTA
FT                   HRIEMFSYLLEADRPELFHKMVYDLFIHFIQKRDNVQAGLCLELLANTYEWDPNDFLSA
FT                   IAYPPLPEQSSFERKEYLFKEAARNFAKGLKLEKALSIYKDLTKAYDEINYDLNGLAFV
FT                   HDQIAAIYTELQSVDRLVPTYFRVALLGFGFPNSLRNRMFIFEGLPFEHITSMHDRLLK
FT                   IYHGSSIVQTLDEVDELLMHPPMGKFIHVCTVEPRFALSEQYSTSRKSELNNKIRMYIE
FT                   NRNLRTFSHFRRLAGSKSVTDLWVEEYTYGTVNTFPTLMNRSEIIEVSRRKLSPLENAL
FT                   RTLQMKIQELYGLENMCYKVIKEQSDYINVLNELSRSITGTISAPINGGISQYKVFLEE
FT                   ANRDKFDKNDLKLLMSSFDELVHALSKCLVLQSELSGTGSTNKSGHNLLVELFEENFAE
FT                   EIKRNRIDISTMSVDSIMKDSNKPVHNKSVVHKWHINSHWDRPNFGKSQRVKSDTNDNG
FT                   VPFGTSMLGRYLSSTRSQSRNASERNTAASSPMPYAIPDF"
FT   CDS_pept        445793..446146
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000178184" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17438955"
FT                   /locus_tag="CAGL0J04664g"
FT                   /product="Similar to uniprot|P32463 Saccharomyces
FT                   cerevisiae YKL192c ACP1"
FT                   /function="acyl carrier activity"
FT                   /function="cofactor binding"
FT                   /function="phosphopantetheine binding"
FT                   /biological_process="fatty acid biosynthetic process "
FT                   /protein_id="CAG60858.1"
FT                   /db_xref="GO:0000036"
FT                   /db_xref="GO:0006633"
FT                   /db_xref="GO:0031177"
FT                   /db_xref="GO:0048037"
FT                   /db_xref="HOGENOM:HBG505479"
FT                   /db_xref="HOGENOM:HBG755218"
FT                   /db_xref="InterPro:IPR003231"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR006163"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="UniParc:UPI00003B6A51"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPD5"
FT                   /transl_table=1
FT                   /translation="MFSRLVPRLATRALIPSTVIARPMLVTPMLMRQYSVKSKDEISQK
FT                   LIEVVKNFVKGESSQNVTADSKFHKDLGLDSLDTVELIVSIEEEFDTEIPDDVADRLTS
FT                   IRETIDYLASQKN"
FT   CDS_pept        complement(446347..447576)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000034136" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20196063"
FT                   /gene_name="ATG17"
FT                   /locus_tag="CAGL0J04686g"
FT                   /product="Autophagy-related protein 17 "
FT                   /biological_process="autophagy"
FT                   /cellular_component="cytoplasm"
FT                   /cellular_component="membrane"
FT                   /protein_id="CAG60859.1"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006914"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG059083"
FT                   /db_xref="HOGENOM:HBG202587"
FT                   /db_xref="InterPro:IPR007240"
FT                   /db_xref="UniParc:UPI00003B6A52"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FPD4"
FT                   /transl_table=1
FT                   /translation="MPESLAERARSTLLKAQVLCREVESRIAEVKDRLSQWEKNRHTLR
FT                   FLVSCLEHQLGFLEQCALRQGIGRALIETEWSQVVLVDLVNEMKLWYDKIQLRLERLDQ
FT                   VENILVADNKHLSHYISQEQALVLKKRLDEVPIIRPQIENIQTQYDTMCKRVRQKLINK
FT                   RLTEIKTIFDSQFGDELTETAELTEVKPRDLDSIELELVDYINSLTDHFDKCQALEKGL
FT                   FNDSNEYDELLKIVSADDSQLDDIMKHLLNTIDSTNHQIDKVYEILDIKTKQKTILHGK
FT                   INELIANCTKYSEYLAIFKGIATSIEKFKEGCMQDIQLTKELYKFYDEFENSYNKLLQE
FT                   VQRRRALSQKMLGIIKNCENELKTLHDEDQKLRTHFLSENGAFLPETIWPGEIDDLSPL
FT                   YALDYHIKEI"
FT   CDS_pept        447836..449728
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17438956"
FT                   /locus_tag="CAGL0J04708g"
FT                   /product="Similar to uniprot|Q06411 Saccharomyces
FT                   cerevisiae YLR424w"
FT                   /function="nucleic acid binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAG60860.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="HOGENOM:HBG252814"
FT                   /db_xref="InterPro:IPR000467"
FT                   /db_xref="InterPro:IPR022783"
FT                   /db_xref="UniParc:UPI00003B6A53"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPD3"
FT                   /transl_table=1
FT                   /translation="MGLEEQYGFGARLLKKLGYVEGQGLGSDGRGRASPIEVNAEQHGT
FT                   HAGLGMLSKRATAEDIDMHITSSSDEGREVNENARARPLQFKKTDATKPSSDIIYQIEA
FT                   LGLPVDANVLARHPNASTIVEELVTKQRTLDAIVRKVEVVKQELDDVETQLNTLRNLQH
FT                   SEMSLLDKISEVLKLNNETIIDELAAKILKDELQKYNNLSLKDDRITNTLEPVVELLQY
FT                   ALESDPGALNKNQTQLYQWLCPRIEAAITEIDFKNSDSVDSIIYILVEYELILKYIMMY
FT                   DKLIDKFLMPRLLGLIKEWAPERNGIDHHFYDFYILLNQEQRKKLQDALKVIFSDYCSG
FT                   WYHKDAFHFDCHYFKLIFGETVFYSITEKKLLPIMVKQLYEEHFTLVDDLEDWSDINHD
FT                   REGPAYCFKKVKEFANFLTNTQITTIMKGMFNDIRKLVFQWYLFSEPNDWQNCQNLIHD
FT                   FFNIVYAEESKISDFEITELREILRMGTEVGKLSTVCYDREFDILKELHLKKREFIDLE
FT                   RDENDHPNVIQIDDSDEDMRDSDGYTVQDIPIRRVDATFKEILQRYCEENGYEMIRDTT
FT                   NYTQLPYGINGTSLVPIITIRKGTKARKVAIKDDILWIEGLSGYRPEFLYNLTL"
FT   tRNA            complement(449942..450015)
FT                   /gene_name="tRNA-Asn (GTT)"
FT   CDS_pept        450562..454479
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000141939" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17438957"
FT                   /locus_tag="CAGL0J04752g"
FT                   /product="Similar to uniprot|Q06412 Saccharomyces
FT                   cerevisiae YLR425w TUS1"
FT                   /function="Rho guanyl-nucleotide exchange factor activity "
FT                   /biological_process="regulation of Rho protein signal
FT                   transduction"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAG60861.1"
FT                   /db_xref="GO:0005089"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0035023"
FT                   /db_xref="HOGENOM:HBG059085"
FT                   /db_xref="HOGENOM:HBG202589"
FT                   /db_xref="InterPro:IPR000219"
FT                   /db_xref="InterPro:IPR001180"
FT                   /db_xref="InterPro:IPR001849"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="UniParc:UPI00003B6A54"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPD2"
FT                   /transl_table=1
FT                   /translation="MYRYNTPNTPERSKGGNTRSRDSPGVQGDVILPKLPPLNTRSSFL
FT                   ESDMMQSDVSIGWTPLTENTISTSGQFADEHIGYGNSPQLRSPKSPANRRNSLIYENFN
FT                   GDSPMSVKSVGNGKSRRRPPPPSLQHSISQLDSYQSSPGSPATPFITKRRTNDFITPTK
FT                   TKPYKSPFVGEQDIEDSMLQQSTHFAGKVYKSPFVGDLDSDIIISPSNANETTKTRKES
FT                   SRVQSKTISNTELNFYSKPQIPLTSSRNITGISRFSDQVESFYSDSNYTFNNSSARNSS
FT                   FNSFLGAKPLQYAPSVTAPTQAFSIDLIDEHKLYQCYSIYRLSDIYEWLLKVYFEWFNE
FT                   YIFEKLDLFQIVQLLLEFQSPKTYEQEVIDSNVDRIMSSLINQGAIKFEVDNEQEIAVI
FT                   VAGLTISSIFTDLLPCYSFIDSTFNEFDHSTICYSTTCCNRLSNESRQEIKVSEIINKS
FT                   VGLWTDYWQLSAEELSEINPKEIQRQSFIFDLIILEERSLSMANAAVEIYGKRFDPDLL
FT                   PDETNFASLAFDIFLPIIEIHKEFILKPLFWKIKTRGKFIDGIGKIYLKWCHEVRDAYL
FT                   NYANAMATVHEVISWEKTHHTKFAEWLLETDNLPEITRSKMYHDVIFFGGYFKSLQNMP
FT                   VTLSSILKNTSPSSEDYGALQLVIKEVTQLSADVDKVHGMAIDRRKLIRFSKQLVYSSG
FT                   NKGSTTGYINIGNPEKMVKGDKLSLGLADPKRVMINCDTVLKKSDHWLEPYPVFLALLD
FT                   NFLLITELVSKGLEKKYKLIDRPIPIEYLNLEIKRAPEEFNKDLPLGDSRPTSQIVSDL
FT                   DNKSSLNSRSSVVGDLNYGHTGISNNLPSSTEFAFKVRNTATNDSYTFYVPNSIEWNNW
FT                   MNAFKCCFKNRNNDDNRHPINLSIITAEFSYQDRNAPVNLPVAPEGSEIDSALKTYKRY
FT                   LKDEFENIATTVFCSTEFDNEDTKFNLIATNSGVFLRRKNDYTTKFVKVLQNISVSRLQ
FT                   AVPKLGLLFVLDGQKLCYFSISSILAVYYNPERFLNANFVVGIVLKDKVSFFKFADDFG
FT                   NSKQLFYERKGKIVVSTPEFHSIMNNFNCFKIYKKYYLPSSSKMLASHSISDIVIFKKS
FT                   FMVFTKKNVFLFNDAFNELGASLPGFYNDKEMIAYIKHPHLNSGRFSSSSSKLDANLSM
FT                   VTDVKKDIASGKTKPITAFRLQSGDGFLMVYDEAIVKINSSGMIPNWKNDILILDFYCT
FT                   GASYHNGYLFLIGENLILVYQLSYEGTPISELTPVQIINSKKIELLNSGGMDYPTVTSS
FT                   HPKIPNRQLLFSCIPANYQVK"
FT   CDS_pept        join(454697..454782,454862..455792)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000141940" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19349242"
FT                   /locus_tag="CAGL0J04774g"
FT                   /product="Similar to uniprot|Q06417 Saccharomyces
FT                   cerevisiae YLR426w"
FT                   /function="binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAG60862.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG059086"
FT                   /db_xref="HOGENOM:HBG512074"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI00003B6A55"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPD1"
FT                   /transl_table=1
FT                   /translation="MGFDIDFILSYVVFPLLRFPVPIAFACSKLYAIVVFSIWTLIING
FT                   FYWLELWFRSRGEQTWKSLNELHDPIVLITGGSNGLGRCIIHKLLRSYNNIKVINLDLD
FT                   VQYWSEEARVINIECDLVNADGLELALKKIKLEYEDKINLLICNAGVRSRFNWFEDTPI
FT                   DEMQRIMNINTWSTARILQAIIPRDNQRQLYIVTISSVLGILAPSKVASYAASKAAITA
FT                   LHNSMTNDFLVRGIGNIRTLLVLPGQIDTQMFDGFPPPRKFWAPIVCPAALAEAIIDHC
FT                   ENGLRGTLRTPLYSYFPEFLMGIPYLLQRFARNFSKMDNCLPIETISSKRSLASVDL"
FT   CDS_pept        456300..458099
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000113458" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18501417"
FT                   /locus_tag="CAGL0J04796g"
FT                   /product="Similar to uniprot|Q06436 Saccharomyces
FT                   cerevisiae YLR427w"
FT                   /function="zinc ion binding"
FT                   /protein_id="CAG60863.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG059088"
FT                   /db_xref="HOGENOM:HBG202590"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR017907"
FT                   /db_xref="InterPro:IPR018957"
FT                   /db_xref="UniParc:UPI00003B6A56"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPD0"
FT                   /transl_table=1
FT                   /translation="MSSSTNSNSSTRKSRNQGNGKTDTGRPRRRQNNGGSKFTKYDLDK
FT                   QERFDASIEQELNQGNFKMRGRKTKVSIDHLLDFQLPEVQRENHTHRKVNKRRIDSHTY
FT                   LHGESFINVNYRLLVSDRYDYKDQENDPNKFVDKEKIVRVIVPRGQNCPICLNEIPVAP
FT                   RMVTCGHIFCMSCLENFFEIEEVVKNPETGIKQKKKFKECPLCGSIVKPNNVKEVLFEE
FT                   DYSFNKQAFQEGSDHRPEPGHEASLVLMCKPHGSILALPISLDIDPKKVGDIPPANIEE
FT                   ISEYSHIMKCGDDYALKYYQLDMDAIENQYEIDKALYSDSGKYVKVALDKIRQNISTIL
FT                   SKDDFNSSINHITEDFMNKLHFDGNQSYDDTSAYFFYQTNFQSPIKYYLSPLDIKILLT
FT                   IFGHYSKFPELLEVKIENIHYGNIVTEALIKRYKYLGHLPYGTEIALLDLDWRSVPFIE
FT                   KDVYNRFASELKQRRRKLIIRKQREDQEKKKYEERLEQEQREFYQRENSNFTGWEPQIN
FT                   KKDIQLTSLPAPVKPPQNTEAKLSKYNEKTIWGTSIEITEDEKTTKENKEFEDMLLQKM
FT                   RQEKSNKKKKGKIMLFSNTQQHL"
FT   CDS_pept        458449..460413
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000166356" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17438958"
FT                   /locus_tag="CAGL0J04818g"
FT                   /product="Similar to uniprot|Q06440 Saccharomyces
FT                   cerevisiae YLR429w CRN1"
FT                   /protein_id="CAG60864.1"
FT                   /db_xref="HOGENOM:HBG266556"
FT                   /db_xref="HOGENOM:HBG735393"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015048"
FT                   /db_xref="InterPro:IPR015049"
FT                   /db_xref="InterPro:IPR015505"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="UniParc:UPI00003B6A57"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPC9"
FT                   /transl_table=1
FT                   /translation="MSGKFVRASKYRHVFGQAAKKELQYENVRVTNNAWDSNLIKSNGK
FT                   YLSVNWNSSGGGAFAIVPVSEPGKLPDQVPLFRGHTAQVLDTDFDPFDDNRVASSSDDG
FT                   KIGIWDIPQDYSILKSGDNEEIKDIEPTKFLTGHSRKVGHILYHPTAKDVLASSSLDYT
FT                   VRIWNVETGEDIYKLKHPDMVTSMSFSYDGTHLATVARDKKLRVWNVREEKVVSEGAAH
FT                   AGAKNQRVVWLGNSERLATTGFSKLSDRQIGIWDAFNLEKGDLGGFYTVDQSSGILMPF
FT                   YDDGNKILYLAGKGDGNIRYYEFQNDELFELSEFQSIEAQRGFAVTPKRLVNIRENEVM
FT                   KCYKTVGDQRIEPVSFYVPRRSEEFQEDIYPDAPSNKPALSADEWFSGKTTEGPILVSM
FT                   KSLYDGAEPELHQSHKAEATVKVVPEPAIKIEKKKPAEKPVEKEPTPEPEKPKTVGNAN
FT                   EVLKSDNSIDKLLQKSSDLDMTNNVEDPSKDTSGWDEEDDKPISVNVDSTASSTVDKVD
FT                   VNIQKEQEPKKSEESSKVPTPVKSSTPEPVKTEMPVSKITPTKENKTMEPVRESTPVTE
FT                   KASTEKESVSTPRSTSSKDEAATPGKSAKSLGLKQSVEKLSELVLKLQQTVDDLRESNL
FT                   QKDDRLKALEEKIDSLLKK"
FT   CDS_pept        complement(460655..461893)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000113349" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18501677"
FT                   /locus_tag="CAGL0J04840g"
FT                   /product="Similar to uniprot|P47051 Saccharomyces
FT                   cerevisiae YJL046w"
FT                   /function="transferase activity"
FT                   /biological_process="protein lipoylation"
FT                   /protein_id="CAG60865.1"
FT                   /db_xref="GO:0009249"
FT                   /db_xref="GO:0016740"
FT                   /db_xref="HOGENOM:HBG059655"
FT                   /db_xref="HOGENOM:HBG202206"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR004562"
FT                   /db_xref="UniParc:UPI00003B6A58"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPC8"
FT                   /transl_table=1
FT                   /translation="MLKLGTRLLPALPARRTSMVRYMATNTPFDLDESDPKYKELNTMY
FT                   EEMFSGETVPYMSNDATDEVSEVDLLNEEIDSLYNVGMNNPRHIKINTSTELNKLIKGE
FT                   GPFVLRSISHNPYFNLALEDYLFRNTPIDKNSKSFDSHRLVFYINNKCAVIGKNQNIWE
FT                   ELHLQKLKEKGYEVLRRLSGGGAVLHDLGNVNYSYICSRDEFDTKYFNGRIVSWLKQYN
FT                   HALPVSLNQRGDILSNGFKISGSAYKVALGKAYHHGTMLIKSNLSDFKGLLKPDIIEGI
FT                   NWETNSVVSVRSPIENLPLPSPDTFIDLCTSQFNKMFHLNNNSYVCNESVMENNDDIKE
FT                   TMQKLQSNDWKYHSGPKFKVHIRDSKTGKEHSIAVEKGFIVDSTLKGVEAQDFNNFLHN
FT                   VDKYITVNKANIL"
FT   CDS_pept        462163..464562
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21045111"
FT                   /locus_tag="CAGL0J04862g"
FT                   /product="Similar to uniprot|P47050 Saccharomyces
FT                   cerevisiae YJL047c RTT101"
FT                   /function="ubiquitin protein ligase binding"
FT                   /biological_process="ubiquitin-dependent protein catabolic
FT                   process"
FT                   /cellular_component="cullin-RING ubiquitin ligase complex "
FT                   /protein_id="CAG60866.1"
FT                   /db_xref="GO:0006511"
FT                   /db_xref="GO:0031461"
FT                   /db_xref="GO:0031625"
FT                   /db_xref="HOGENOM:HBG123613"
FT                   /db_xref="InterPro:IPR001373"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR016158"
FT                   /db_xref="UniParc:UPI00003B6A59"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPC7"
FT                   /transl_table=1
FT                   /translation="MNVEASLRELGELFDTAGSIAQSNIHLVSIPDKDRDFLVWRANML
FT                   RFQCQYLTQRRDFDINELDNGDSHSSGRKRLKTDSSARLYTAISEFWKFISSRIETLAD
FT                   QYALMVVDHYNLNQDLDWYAEQHNGVFRYFNVSMEMLLDTFERFISLLAPITEYSFLNY
FT                   TKIMRDLCCFHSAFDFAFVSLIKKLKLYMGSNFKLILKDSFEVLKDKNYQQEGKVQYSL
FT                   ISLFHYYKIEVDENVTVSEFVNELINHDISELTSRDISDDYFERISSGATAEMLLIKCC
FT                   GFPEQTESRYVSLVLDKQVFFKILACQLDKLDKILKSGNCNIKLRKNDVQYSLCAYYTR
FT                   HGKKDDYYRLVSVFFNDRFKNCPLERNISEVIFIECTKLMLLFYFDNQILQILMSSLCE
FT                   KFGGVLKMYENYEKLLEYKIRKYNRSHELWNKNNSDIEKPYRLSDDIKKHQYYERFLIM
FT                   LPSRLKFDSSFLRLHQQKLFRRAVLQGPSIYESISDFSYLEMNILFSLISEYETSDEFH
FT                   YLYDLYTSLRKSYVFYQQYSKDHGDQVVPLVIDKKSVPTAFQKEENENVILPEILQRQW
FT                   GKLVEYYNSTLKTSASRTLVPAYALQHCDVETEFLVEGTRDKYVTFNISVYQTCVLNLF
FT                   NDHDKLDIAKIMQLTGLSERMSKAVITSYLSAGIFKEDKGTYTIDSSFKADPRKLKDGK
FT                   LRIPMAPGPPSRLRRDTSSSSSTASATVSTSASHNEGYSSLWIQEVIKAAIVRTLKANG
FT                   KPMNFDTLFEQIKTGINGVSVGECKESINRLVSEKIISQTAEGYTY"
FT   CDS_pept        465532..466518
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18501678"
FT                   /locus_tag="CAGL0J04884g"
FT                   /product="Strain CBS138 chromosome J complete sequence "
FT                   /protein_id="CAG60867.1"
FT                   /db_xref="HOGENOM:HBG123614"
FT                   /db_xref="InterPro:IPR001012"
FT                   /db_xref="UniParc:UPI00003B6A5A"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPC6"
FT                   /transl_table=1
FT                   /translation="MDVESLLWLSIRDSRRIIVTVTDEPMGELADECQIVRLSRDSGSF
FT                   QRFVSVFNSSKTALYYYIEGPTVVEARSLDELKARFPNKNSTRPYESERQRIIDLINAD
FT                   KLERNSRSRQLSGYTALSSEVVLKDNIKNNKSDICTLKIRMTNGDYVQYDFDSNTSLGS
FT                   VRRWLKDYRTDGDFPYLFHQNISRKSIRITEEYKTLAELDLTPRSILMLKQYDLRPRTR
FT                   VPKPRKRSWYWQFLTVRIKRQLLEGLSEILASHRTTSNIMRSSSMSYLQADDSNMTKIT
FT                   NSLPPNDDNSEDIVKIKQKYNQNTGSIMNTPLEIARPDSPSVLQINT"
FT   CDS_pept        complement(466782..468128)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17440023"
FT                   /locus_tag="CAGL0J04906g"
FT                   /product="Similar to uniprot|P47048 Saccharomyces
FT                   cerevisiae YJL049w"
FT                   /biological_process="protein transport"
FT                   /protein_id="CAG60868.1"
FT                   /db_xref="GO:0015031"
FT                   /db_xref="HOGENOM:HBG058946"
FT                   /db_xref="InterPro:IPR005024"
FT                   /db_xref="UniParc:UPI00003B6A5B"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPC5"
FT                   /transl_table=1
FT                   /translation="MDKLVSQSRLNSLYKDFRPLKELNFDGYVANVNDWQNYLLKKYFP
FT                   KQDKICVTIGTRFLQDISDKKYGAPASIDVVIDNLIQENILIKLDEFKNSATKRDEKTI
FT                   TRIFSWIHASSIGKLNRYQSRKNDNATNYLKQDTFVIRPLLEEKFTKIYDIIRNNILAK
FT                   ATTVCDLIFPLEDFIDFSGISYTLPSDSLIEWEVMLNYLEYHKNTITRKENIVKIIDPL
FT                   VESIYKQFGVEITETDQSIAEIKQCFTNIENAIEKYEIEVYEYKMKLKGDDFKKLTKIA
FT                   QTEYKRGYFLAQKMLLKLFKFRNNLVEVKYQLDMSVSNLVLYKTLQSSNKIITTINGKI
FT                   GPAEKVHDLLEEIRERSTDNEEITKVLSMEISKFDDDELDEELKEMEKELAGQEISKTQ
FT                   SEKNKEDDESKILEQLENLNIKDEQSLNVVNNNSNKKHNEKFMLREEAA"
FT   CDS_pept        complement(468765..471962)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000163047" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21045112"
FT                   /locus_tag="CAGL0J04928g"
FT                   /product="Similar to uniprot|P47047 Saccharomyces
FT                   cerevisiae YJL050w MTR4"
FT                   /function="ATP binding"
FT                   /function="ATP-dependent helicase activity"
FT                   /function="nucleic acid binding"
FT                   /protein_id="CAG60869.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0008026"
FT                   /db_xref="HOGENOM:HBG346461"
FT                   /db_xref="HOGENOM:HBG610926"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011254"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR012961"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="InterPro:IPR016438"
FT                   /db_xref="UniParc:UPI00003B6A5C"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPC4"
FT                   /transl_table=1
FT                   /translation="MDSNDLFDVFSAVPEEVPDVSDEEIENDSAKVPKSNEKHTLTSDE
FT                   EDGESNKKVKPNKTSGSKKETSKIIPIVADDFEQEASREVDASAGLSTQATTEVEEDGK
FT                   VKLSHQVRHQVALPPFYDYKPIGQHKRTNEARTYPFTLDPFQDTAISCIDRGESVLVSA
FT                   HTSAGKTVVAEYAIAQSLREKQRVIYTSPIKALSNQKYRELLAEFGDVGLMTGDITINP
FT                   DAGCLVMTTEILRSMLYRGSEVMREVAWVIFDEVHYMRDKERGVVWEETIILLPDKVRY
FT                   VFLSATIPNAMEFAEWICKIHSQPCHIVYTNFRPTPLQHYLFPAHGDGIYLVVDEKSTF
FT                   REENFQKAMTSIGNQAGDDPNSTESRGKKGQTFKGGAAKGDAKGDIYKIVKMIWKKKYN
FT                   PVIVFSFSKRDCEELALKMSKLDFNSDDEKDALTKIFNNAIALLPENDRELPQIKHILP
FT                   LLRRGIGIHHSGLLPILKEVIEILFQEGFLKVLFATETFSIGLNMPAKTVVFTSVRKWD
FT                   GQQFRWVSGGEYIQMSGRAGRRGLDDRGIVIMMIDEKMEPQVAKGMVKGQADRLDSAFH
FT                   LGYNMILNLMRVEGISPEFMLENSFFQFQNVIAVPVMEKKLIEYQQQYDNIHIEDESGI
FT                   KEYYEVKQTLKGYYEDVRKVMTHPAHLLSFLQPGRLIEVVVDGNQRYGWGAVVDFAKRV
FT                   NKRNPTAVYSDYDSYIVNVVVSSMYVDSPINLIKPFNPAFPEGIRPAQEGEKSLCAIIP
FT                   ITISSITNVGNLRLFMPKDVKASGQVDIVGKSLKEVGRRFPDGIPLIDPVKHMKITDDD
FT                   FMKLQKKIQVLEEKLKTNPLHGSVKLNELYEAYNSKHELSDAMKKLRAKITDSQAVIQL
FT                   DDLRKRKRVLRRLEFCTPNDIIELKGRVACEISSGDELLLTELIFNGNFTELKPEQAAA
FT                   LLSCFAFQERCKEAPKLKPELSEPLKDLRELAAKIAKIMKDSKIEVVEKDYVESFRHEL
FT                   MEVVYEWCRGASFTQICKMTDVYEGSLIRMFKRLEELVKELVDVANTIGNQALREKMEA
FT                   VLKLIHRDIVSAGSLYL"
FT   CDS_pept        complement(472406..474844)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18501679"
FT                   /locus_tag="CAGL0J04950g"
FT                   /product="Similar to uniprot|P47046 Saccharomyces
FT                   cerevisiae YJL051w"
FT                   /protein_id="CAG60870.1"
FT                   /db_xref="HOGENOM:HBG123615"
FT                   /db_xref="UniParc:UPI00003B6A5D"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPC3"
FT                   /transl_table=1
FT                   /translation="MQGSRMLLMLASAVSFACGSMVIALLAQIRSITGALTVIVCATYL
FT                   YGIAAFLSAVCGAKLAALNGSGLLVSFSLEMITLWASVYVFHRTNQASFMAAINHSSQR
FT                   VLTSFQSLLVLKLLVSGLSIGAQINKQQPPIGDQENLPLEDSTKLVSDPEKFIPMKNSA
FT                   QTLTPGMEITTNVPTRDANQNLDGRNALNSVTVVTDPNVTRTRYDSSALSGGSVIRHPL
FT                   VNIANLNNTSETQMTKRRRKRLLRQFKTLHVRFKGRKTVPKALPLQVENDSQTDLHTTN
FT                   KRGTILSDISGLSKGLIPFVGNNSDKESKHENSSYSLILDLAHNRNEQLSIQNSPQMEV
FT                   ERSAIGRFDNMLLPPYLRINPSAPKTPEVNSDHVNLLDIPHPQEEMLMKTSSNHSNVLD
FT                   EFDLHTIEGPNDNVFAHDDYPTTEHVNYPSHISLEMWEKNKEDYLNTSRTKSKSLLLPI
FT                   FTQDSFMDSSNINLKKLETLQESENNSQLVGLGINTSSGFSFPSKDTVESEDKLYMAPI
FT                   SGSNEESIVETPISPNKVSNEFYNNDDAISALDEYLKEEEHQENIDDSIMEESLNQNLS
FT                   SSFILDSYGNNEVLARHSPTKSVISIMSGNTSLNHKRSYSKIASFLGHSRGNSLVTQTR
FT                   LPNNSIHSSPTKSERRQRLSQKLSFSNLSDFGSPTKWENKNSNQKYNNSIGHKLNKSID
FT                   FSYIHSLQGNDGNSPTKNNIRRHSTIWDQMTQDQRRHSVATDVMYDFPSNQNSKSSFQV
FT                   HNINTTRFEVNIPNPELREVSGGTIETSLSDETERYPEQAMSEYDKEKWNTLNEPVPNI
FT                   "
FT   CDS_pept        475587..476606
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000141793" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21045113"
FT                   /locus_tag="CAGL0J04972g"
FT                   /product="Similarities with uniprot|Q12100 Saccharomyces
FT                   cerevisiae YDL025c"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="CAG60871.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG104444"
FT                   /db_xref="HOGENOM:HBG537393"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="InterPro:IPR020636"
FT                   /db_xref="UniParc:UPI00003B6A5E"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPC2"
FT                   /transl_table=1
FT                   /translation="MVIAVADQRPRGFRSAFSGIFSKTDKRATGKKLAADALSLNSKAI
FT                   KFAKGTTCDVVVSLDKKTGQTVAKKVYNTDRDPSKDYRDYMVTVLRNEYDILVTLRKSK
FT                   YVVNVYDLDISKRTIKMEFLPFSLSRVLSMDLSPSLQEKKCYFLQICEAVQYLHSRGIV
FT                   HRDLKLENIMLCADACQIKLIDFGVAVNRQDPQSLTTACKGMCGTEALMAPEVLGSISY
FT                   VGEYADCWSVGIIMFQIFNISNDSVRWKPRYPWESARFSNSIYKIYSEEADTSVVLTNL
FT                   EDDEDLKELILLFLHIDSLKRLTMKKALESKFLASIKGVKHSHDRTLRVCNKVFQLKH"
FT   CDS_pept        complement(476763..477782)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000191799" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17440024"
FT                   /locus_tag="CAGL0J04994g"
FT                   /product="Similar to uniprot|P40335 Saccharomyces
FT                   cerevisiae YJL053w PEP8"
FT                   /biological_process="vacuolar transport"
FT                   /cellular_component="retromer complex"
FT                   /protein_id="CAG60872.1"
FT                   /db_xref="GO:0007034"
FT                   /db_xref="GO:0030904"
FT                   /db_xref="HOGENOM:HBG020982"
FT                   /db_xref="HOGENOM:HBG525567"
FT                   /db_xref="InterPro:IPR005377"
FT                   /db_xref="UniParc:UPI00003B6A5F"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPC1"
FT                   /transl_table=1
FT                   /translation="MFFKSPVDIEIQLDGEETRKHVDVTNTSNSKTLKESYPLFEDGES
FT                   ISGNITMRVRDGRRVEHLGVKVSVIGSIDMVNGVGSGKSNSQSSFGTSTDVNKKCVDQF
FT                   LTLSYDLCPPGELQHTKTFPFLFKDINKQYESYTGKNVDVTYAVKVTVIRKSADVSKMK
FT                   RLWVYLYNDLSKPIIENTNLINTDTSEGENSDKNKVEAFKKPVKLDIGIENCLHIEFEY
FT                   SKAEFSLKDVIVGRIYFLLTRLKIKHMEISLITRESAGIHTGNTLTDTTAVRYEIMDGS
FT                   PVKGETIPIRLFLGGYSLTPTMSNNQFNVKNYLSLVIIDEDGRRYFKQSEIILYRTRQ"
FT   CDS_pept        complement(478312..479670)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000248043" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19349510"
FT                   /gene_name="TIM54"
FT                   /locus_tag="CAGL0J05016g"
FT                   /product="Mitochondrial import inner membrane translocase
FT                   subunit TIM54"
FT                   /biological_process="protein transport"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="mitochondrial inner membrane "
FT                   /protein_id="CAG60873.1"
FT                   /db_xref="GO:0005743"
FT                   /db_xref="GO:0015031"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG058949"
FT                   /db_xref="HOGENOM:HBG397749"
FT                   /db_xref="InterPro:IPR021056"
FT                   /db_xref="UniParc:UPI00003B6A60"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FPC0"
FT                   /transl_table=1
FT                   /translation="MNPALKALGLGNFKLPSRNWTIFWTVLAGSLGGVGYDKYQQRQII
FT                   SRYCDEVKPLSLQHCDVNKSPRKITVFIAPPPNDYLETSLKIWRRYIKPVLYYAGLDYE
FT                   VIEEDRQGIIRSEVASRIRQLRRELLEADNEQQGNSGDSLLSIFKKPHAKDPEEEQKFD
FT                   PEQARQFKADFDFRNVMGIYTKVPKLDTIVQTDSLVADPVLAGGVVCVGRGAYKEYITG
FT                   LHEGLLGPLDPPEETTQEVEMGSKLKSMNDGDNVETTVETAVETMVETTLESADKVEVE
FT                   GKDTENEEGKDEPDEEKSRVLKPYLLRTAFHDTPIPPEVEPVLEKDALLKDPKTNVPSL
FT                   LHQPVLVIPVPNLIGFLTIPERIYRFYQRRFFVDEVCREASNLVKQEHIVKYEPDKHIN
FT                   LALEEESDWPKQWVKTGIEKNSEWTQELVQDQRVVSKMHVFELPKHTTKDTKE"
FT   CDS_pept        complement(479913..480581)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000156894" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17440025"
FT                   /locus_tag="CAGL0J05038g"
FT                   /product="Similar to uniprot|P47044 Saccharomyces
FT                   cerevisiae YJL055w"
FT                   /protein_id="CAG60874.1"
FT                   /db_xref="HOGENOM:HBG388166"
FT                   /db_xref="HOGENOM:HBG437583"
FT                   /db_xref="InterPro:IPR005269"
FT                   /db_xref="UniParc:UPI00003B6A61"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPB9"
FT                   /transl_table=1
FT                   /translation="MKSVCVYCGSASGDKSFVAAAEELGALIHARRWSLVYGGGTTGLM
FT                   GGVARGAMGPSKDGSVHGIIPDALVAKERSDGGGAGQEQEQEQEEYSEPVNGTTVVSSD
FT                   YGETTVVPDMHTRKRLMASMSDAFVALPGGFGTLEELLECVTWSQLGIHNKPVVVLNTN
FT                   GYFDALLRFFRDAIAAGFISEANGSILQVASTPQEAIDLIVNYKVPEGRFNLKWSDEGL
FT                   "
FT   CDS_pept        481253..483394
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17440026"
FT                   /locus_tag="CAGL0J05060g"
FT                   /product="Strain CBS138 chromosome J complete sequence "
FT                   /function="nucleic acid binding"
FT                   /function="zinc ion binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAG60875.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG123616"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="UniParc:UPI00003B6A62"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPB8"
FT                   /transl_table=1
FT                   /translation="MVEGVVHGHIHNSERYTYVHGHVHHDSEECEGFEDCRVPGMNMLN
FT                   LNMGMNMGMNMSTNMDLQAMQVQANPHAHPHAHAQAQMFHEYNSASSSGASSPVQCCNP
FT                   NILEICCDLDHPVSNQIGATGGSAGSAGSTGSTGSTGSAGSAGSAGHSGPGSASMTNNA
FT                   MSLNTASSVFTNDFSKDMMIFTDNALTQLANTGTATATNTTTTASTSPIGTRNDTAAGN
FT                   EDEDMKILQDLCNISQLYELPMAKHINHHHHNHGNVVNLLEDTHLCGGGDANQNANSGD
FT                   GHACDGSHQTDAPCTGNCTSGKPHHHHRIQVHPHDMKEYKPHRKRRKLVESPMFGSRKL
FT                   VMSPQPLTSHDRHIPADFNDLNTNTINFNWNFRDDDDIHCQWDDCGETYTTLFDLQRHM
FT                   LKDHITNEDKHNIFNGESEHLSHCQWKDCEFKGGDICSLVNHINDEHGIHFEINVLEND
FT                   TSVSNSSAPSCASSIKSSLHFDSPHPDIRSMSSPVMIKAEQENDLNNSNSTRTRARQRV
FT                   SRSKKLPEPTKPDETEFCCKWAGCNERFKSAGDLNDHLEEMHLTKGKSQYTCEWEGCNK
FT                   TFSQRQKLVRHLKVHSKYKPYQCPQCQKCFSTEDTLNQHKRVHSGEKPYECHICHKRFA
FT                   ISNSLKIHIRTHTGEKPLKCKVCGRCFNESSNLSKHMKTHMKKYFCSQCSRSFDTLEKY
FT                   KAHELRSHPKTIKDQQIAT"
FT   CDS_pept        483782..485743
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000113025" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18501680"
FT                   /locus_tag="CAGL0J05082g"
FT                   /product="Similar to uniprot|P47042 Saccharomyces
FT                   cerevisiae YJL057c IKS1"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="CAG60876.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG123617"
FT                   /db_xref="HOGENOM:HBG202197"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI00003B6A63"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPB7"
FT                   /transl_table=1
FT                   /translation="MSLVPYKEGSIILNDPSSRSLAIVDPKIGSVAIYKQINARVEHLR
FT                   SDRRSSVESIASYMCPHCGTEVHLSNDEGYGSSARKARKENTNRRNVSPDFDPDDLSNY
FT                   NMLSTTTGSSAYFRLLQRNHQFYAIQDGEQTENSHIPDDMFIPGYFHKFFDILEPLGNG
FT                   ARGSVYKVVHKLGSTPLGTYALKKIPIGNDDEWFKKCIREVKILSSLKHTSENLITYNH
FT                   VWMEMDASVGHVQSLDGSSTGMVGDVPCMFILQQYCAGGNLEDCINNVVFEKNPELISI
FT                   EERKKRFRERHGQKSSGSAKAGLSTLQILSILHDIASGLKELHNSGLIHRDLKPSNCLL
FT                   LSPYKHNDEERVFPTVVIGDFGESQMKGEYRTATGCTGTMEFTAPELIIENCDSNSNSQ
FT                   YHEFSFQSDMYSLGMIGYFVIFGELPFGSELDIPEIKNCIKALNIDKTYMVKKHREMRL
FT                   KDIDYRIFDVLQLLLSSKESIRPSAIEVESIFEKLIGLNIKHDDNEKLAYDYSSKDKLE
FT                   KSDVLYEQPDGINIGKLEEFQSSDKGSASTNEAYFQIASLPATPRLALPNLIDRQQVSD
FT                   STKINLTNITLRGLIFVFAALAYYRYALTVNAINPQVMHSFFWSSTFMALSFVDNQRFL
FT                   FCIFIIQFIISLRAMFLY"
FT   CDS_pept        complement(485863..487098)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000164765" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17440027"
FT                   /gene_name="BTN1"
FT                   /locus_tag="CAGL0J05104g"
FT                   /product="Protein BTN1"
FT                   /biological_process="amino acid transport"
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="vacuolar membrane"
FT                   /protein_id="CAG60877.1"
FT                   /db_xref="GO:0005774"
FT                   /db_xref="GO:0006865"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG020954"
FT                   /db_xref="HOGENOM:HBG330840"
FT                   /db_xref="InterPro:IPR003492"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR018460"
FT                   /db_xref="UniParc:UPI00003B6A64"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FPB6"
FT                   /transl_table=1
FT                   /translation="MNSKQRVYAFFWIFGLVNNVLYVVILSAAVDIVGPKVPKTLVLLM
FT                   DITPSLLIKVTAPFFIKSIPYTMRIYALIALSCIGMIFVSGKSLLLCMIGIAMASVSSG
FT                   FGEVSFLQLSHFFEENALNGWSSGTGGAGIVGSSVYMLLTSIFKLPIRLSLLSFTILPF
FT                   AFLLYFKLDTTQIEYDSISSSGEETLIRNSNSNALQTDTFNESIRLSKTEEQNIFVSSI
FT                   DHFKSTCVNLKALVVPYMLPLSSVYLFEYLINQAVSPTLLFPLDSRGLPPFFNKYRDMY
FT                   VTYGTLYQLGVFISRSLAHKFRMHNLYFLSALQGLNLVLTILQAWIYIVHTPWPIMILI
FT                   FYEGLLGGSSYVNTFLNVLEEVDMDKREFSLGAVSIADSLGVFIAALVGLGLEPTICNH
FT                   QVSTGRPWCRME"
FT   mat_peptide     complement(485866..487011)
FT                   /gene_name="BTN1"
FT                   /locus_tag="CAGL0J05104g"
FT                   /product="Protein BTN1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FPB6 "
FT   sig_peptide     complement(487012..487098)
FT                   /gene_name="BTN1"
FT                   /locus_tag="CAGL0J05104g"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FPB6 "
FT   CDS_pept        complement(487452..488753)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000223045" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20196331"
FT                   /locus_tag="CAGL0J05126g"
FT                   /product="Similar to uniprot|P47039 Saccharomyces
FT                   cerevisiae YJL060w"
FT                   /function="1-aminocyclopropane-1-carboxylate synthase
FT                   activity"
FT                   /function="pyridoxal phosphate binding"
FT                   /function="transferase activity, transferring nitrogenous
FT                   groups"
FT                   /protein_id="CAG60878.1"
FT                   /db_xref="GO:0016769"
FT                   /db_xref="GO:0016847"
FT                   /db_xref="GO:0030170"
FT                   /db_xref="HOGENOM:HBG502043"
FT                   /db_xref="HOGENOM:HBG645860"
FT                   /db_xref="InterPro:IPR001176"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniParc:UPI00003B6A65"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPB5"
FT                   /transl_table=1
FT                   /translation="MKRTLNRMTKITPNKYFQKNTSKDVWTLTNEFAASAVGKSEGREL
FT                   INLGQGFFSYSPPQFAINAAKSALDVPLVNQYSPTRGRPSLIKSLVELYKPVFGDFIDN
FT                   QNVLVTTGANEGILSCLMGILNAGDEVIVFEPFFDQYIPNIELCGGVVRYVPIHPPKEM
FT                   KTRNTTGDEWQIDWDALEKTFNNKTKAVIINTPHNPIGKVFTEQELTKLAQLCVEHNTV
FT                   VISDEVYEHLYFTESFPRIANINEDIANLTLTVGSAGKSFAATGWRIGWIISKNDQLLN
FT                   YVSKAHTRICFASPSPLQEACAGSIEHALKIDYFPKMREEYRKKFEILTTAFDKLGLNY
FT                   TQPEGTYFILVDFSKVKIPEDYVYPEELLEKAKDFRISYWLINEIGIVAIPPTEFYIKE
FT                   HEKDAETLLRFAVCKEDEYLAKAAERFQLLKDYL"
FT   CDS_pept        complement(489747..494336)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17440028"
FT                   /locus_tag="CAGL0J05159g"
FT                   /product="Similarity"
FT                   /protein_id="CAR58044.1"
FT                   /db_xref="UniParc:UPI00017BD8E9"
FT                   /db_xref="UniProtKB/TrEMBL:B4UN28"
FT                   /transl_table=1
FT                   /translation="MLLNWTITLLWTLLLSRVTAQLVVTTTIPIPQAVTFPTPVAVGTG
FT                   GDVTFEGSGPYTFNDKVYIMKNGKLTIHNPQSGSLLNISITGDTINNGQVSVLNDGTTN
FT                   ARIKITGDSILNTGTLLLQNNDAAAIVNHDLSIVLSPKDSILNTGTLTLYQAGGVDITT
FT                   GDITNNGVLNVYGTALRIHQPIVGNGNINLFSGFLILGFDQTESNILQNITIGFGSLML
FT                   FDTRGNTTPRLVTINLASFDPNNFLGFTDPNFTYTYDGNVLNLVSNQVTVKVYIGPGYD
FT                   INSFIKLDSTQQEYLGTNYIISAIYYGAQPPTTRTFQPLPSPYNTTIYTLDVTEEFTVS
FT                   YIATSDKGGFPTTIRTSIPWSTPISSPYTTFTIHDSTTESYVVSYFSTVNAKGGPLISS
FT                   TTYPVLHAPYTTTITEKGVTHEVYYSFTDILKGNSHSTSTFISTIIPPFPKPTTFTSFS
FT                   GNYEYIGVVTYYSTVNAQGGTYTASSTKTISTITLTQYKVPPVTTVTISNSQYSEVDVI
FT                   SYYLTQDSNRKVFTASTTISSSRAYITPPPLTSKTVDSNGVTIWAIISYYTSAKDGQII
FT                   FTSGSSVYSPPPLKTITVLGDHYVEEDVYSYFITVNGQGQIITDSTEISSSVSHDPAPS
FT                   GSTITKDLGNGITEYDVVSYWTTVDENGKFITTSSVAVYSPPPISTVTIKSDHYEEEDV
FT                   YSYFITVDSEGNIITDSKLISSSVSHDPAPSGSTITKDLGNGITEYDVVSYWTTVDENG
FT                   KFITTSSVAVYSPPPISTVTIKSDHYEEEDVYSYFITVDSEGNIITDSKLISSSVSHDP
FT                   APSGSTITKDLGNGITEYDVVSYWTTVDENGKFITTSSVAVYSPPPISTVTIKSDHYEE
FT                   EDVYSYFITVDSEGNIITDSKLISSSVSHDPAPSGSTITKDLGNGITEYDVVSYWTTVD
FT                   ENGKFITTSSVAVYSPPPISTVTIKSDHYEEEDVYSYFITVDSEGNIITDSRVISSSII
FT                   DDGKDKTTVTTDKDGVVHTDIISHITTTDSDGKPTTILTTYPSPSDDGKDKTTVTTDKD
FT                   GVVHTDIISHITTTDSDGKPTTILTTYPSPSDDGKDKTTVTTDKDGVVHTDIISHITTT
FT                   DSDGKPTTILTTYPSPSDDGKDKTTVTTDKDGVVHTDIISHITTTDSDGKPTTILTTYP
FT                   SPSDDGKDKTTVTTDKDGVVHTDIISHITTTDSDGKPTTILTTYPSPSDDGKDKTTVTT
FT                   DKDGVVHTDIISHITTTDSDGKPTTILTTYPSPSDDGKDKTTVTTDKDGVVHTDIISHI
FT                   TTTDSNGNPTTVATTLALPSSGNNSGNNSGNNSGNNSVNNSGDNNGNSAGNNAGESDHT
FT                   TVITSNGTPTSVFVSHITTTDSNGNPSTIATTLALPSSGNNSGNNSGNNSGNNSGNNNG
FT                   NSAGNNAGESDHTTVITSNGTPTSVFVSHITTTDGNGSPTTIRTLIPSSSEFLSQNIIS
FT                   NTPINSQANISSPTNKSSRTTLQGTHTVPTVSPSSVSSATFTGAGEKLNVSKLYAAVVL
FT                   SGIVLCIIV"
FT   CDS_pept        complement(501919..504069)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17440029"
FT                   /locus_tag="CAGL0J05214g"
FT                   /product="Strain CBS138 chromosome J complete sequence "
FT                   /protein_id="CAG60882.1"
FT                   /db_xref="HOGENOM:HBG123621"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="UniParc:UPI00003B6A67"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPB3"
FT                   /transl_table=1
FT                   /translation="MSIPNILKNSEAFTGNAAQRFLFSSSDGTKIVSIADRGHLRWCHS
FT                   TSTTYKSLDFDLQFEGKVEGAVSSTTADYVCIYNRDELHVLEVPWMYSGEENGLKHLCH
FT                   IYSHKFDENHSIKQVLFHPKSYLDSTILVLTNDDSIFMINTDDNRSDKNMINLNSKNSA
FT                   LGLYDRINDIQKIIFSQDGLSLLILSAEEGCDIFTIYPCLPRRWDISLHEVDTLFAKSL
FT                   LLYNNMNVNTTPQEKRNIVKQLNFMEKIRGQKTAFRNDKKPLILEDAYLNAQPQGPFSM
FT                   TPYPNELYDFMATDINIIQITQNISLLAIAFSNGTVLLFLSDLEPIMSWDISRFPGSNS
FT                   LALLEQIKLEITDNAKFLSIPGTYGKFVVTDNVKSNFFVNTCDWSTILAQIIDDSDIKL
FT                   LANLKVKSNIENLQQLATTFKSIIYWKNENISCNYIISDKKIEELDMLDGISSTTKHKL
FT                   IDQSNSQVESKLDLPELKNGLYEVKFARPLTEIQHYEQIYYKNLQNQNFTKIPLEIRSA
FT                   PLKNSSNENQLESLTKISESYMKMISMAQTLGYIYRKRMIDSIEEFSRQIETTYQINKF
FT                   WDNFEQIREVQNTKIDKVKEKQQKLMERLSSLYDKVEGQKEMGSMNNSNISAAESEWFA
FT                   EIKRSVIEFNSYVRKASTNHQELEFIKEQQAQIANQKPDISSENGKEWNDLQQLLRTDL
FT                   KIISEFEKKCDTAVNGINQLKI"
FT   CDS_pept        complement(504544..507072)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000200459" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17440030"
FT                   /gene_name="LAS21"
FT                   /gene_synonym="GPI7"
FT                   /locus_tag="CAGL0J05236g"
FT                   /product="GPI ethanolamine phosphate transferase 2 "
FT                   /EC_number="2.-.-.-"
FT                   /function="transferase activity"
FT                   /biological_process="GPI anchor biosynthetic process "
FT                   /cellular_component="endoplasmic reticulum membrane "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAG60883.1"
FT                   /db_xref="GO:0005789"
FT                   /db_xref="GO:0006506"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0016740"
FT                   /db_xref="HOGENOM:HBG114816"
FT                   /db_xref="HOGENOM:HBG328034"
FT                   /db_xref="InterPro:IPR002591"
FT                   /db_xref="InterPro:IPR017849"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniParc:UPI00003B6A68"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FPB2"
FT                   /transl_table=1
FT                   /translation="MLFLLVVAHAIAVLIFGCGFFPQKKVLDGHAALDGTHARDPVFDK
FT                   LVVVVVDAMRSDFLFDASISKFHFIHEKLADGSAWGFTAHSNPPTVTLPRLKGITTGST
FT                   PNFLDAILNVAEDDTSSSLLAQDSWLWQFRNNAGKRIRFFGDDTWLKLFPPVEANEDSQ
FT                   TMFDEYEGTNSFFVSDFTQVDLNVTRHIDRQLRETSEWDVLILHYLGLDHIGHKDGPYS
FT                   RFMGPKHEEMDSIIRKLYDELDMQSTLLVLMGDHGMNDLGNHGGSSAGETSAGMVFLSD
FT                   KLAAYKPSKEQSSAKEFPMKIPSLNAGEEKTFHYLKKIQQIDVVPTISSLFNVAIPKNN
FT                   VGVIIPEFLQLFKDVSLQKAIVKENWNQLSGLTKGKTQIMEETKNFVIEDVIKNMKDVQ
FT                   ENLAKTATDYNYPLLFIGCFLSIVITGTIYYRYARHVAININTSILIAIAALMGISVFG
FT                   SSFIEEEHQFWWWIITGLVLLSMVNLNFSSWKSHIIVLFCLRLIRGWNNSGQKYTYDNV
FT                   IANLLKGNIDALWWLNLITVTVVGLNLKSLRFGNHTVSLLGFSDLLSMGLLSMITFLYK
FT                   VNWSIVNGERVPDLFYKWVLETASLIVEDATLYREEDLIHTALIPLARIFFKLFFAVLV
FT                   SRLMIQKFFQVSDISKSLAVVSRYVTIFLVFQTPSHNIGLFLFFEIINEITVHIIRERY
FT                   QSDYLLAVIFGIILQFFTFFQSGGTNSIATVDLSNAYNGVSENYNIYVVGLMMCISNFA
FT                   PTIYWSFYNWRITYANANSSRWQTLVAAKYPFIIIQSTIGCCLLLACIILRYHLFIWSV
FT                   FSPKLCYYMVWTIFVGIIVHWIPEILLLLT"
FT   CDS_pept        507849..508583
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000141790" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21045114"
FT                   /locus_tag="CAGL0J05258g"
FT                   /product="Similar to uniprot|P22353 Saccharomyces
FT                   cerevisiae YJL063c MRPL8"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="CAG60884.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG058957"
FT                   /db_xref="HOGENOM:HBG202194"
FT                   /db_xref="InterPro:IPR000456"
FT                   /db_xref="UniParc:UPI00003B6A69"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPB1"
FT                   /transl_table=1
FT                   /translation="MTAGIARRLSRDKPHREMMLRNLVTSLLEHGSVVSTHEKCMEASR
FT                   LADRVIHWSKSAGHSSKYVSLIQSKLFLSGNNSGLLRKLCGEIAPRYVERPGGYTRVMK
FT                   LEPRLGDRARQSVLELVDTPVVTAGDVAHPQPSIQRGNMKLWLLARATLTDESLARAHN
FT                   PQTLLNLKKMLKFRDAGDVARDLLVVRSLLREDMGLEPVDKEQDHAAVTTLIQAAQAAT
FT                   PVSKKKVRNDYKFETARPNGPQ"
FT   CDS_pept        508860..509747
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18501681"
FT                   /locus_tag="CAGL0J05280g"
FT                   /product="Similarities with uniprot|P40366 Saccharomyces
FT                   cerevisiae YJL065c"
FT                   /function="DNA binding"
FT                   /protein_id="CAG60885.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="HOGENOM:HBG123622"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="UniParc:UPI00003B6A6A"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPB0"
FT                   /transl_table=1
FT                   /translation="MEQPADKPVEMETRNEGAEAVEPAVEAVEAVEVEAAEAAEAAEQK
FT                   DAEAMNETVDGDTDQGDESRSNAQVIEIEDSDSSPEGDTEMDIDEDQEMKHDDRDETRP
FT                   TTQSSAKEESRSSSRVVKSEMDESIAQSRREMEELESELGEEARKEKQRVVDELKKQYK
FT                   LINREYIRRCSRFPISKMRMIAKNDPEYLECTKDALIATAFATELFVQTLTYETLIVNG
FT                   SVPYGDGNFQQEPKPEPSTPINSDELLLDYKSLSESIALVDHFQFLADIVPRTKNLREL
FT                   VKENKVRYTATQKN"
FT   CDS_pept        510020..510943
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17440031"
FT                   /locus_tag="CAGL0J05302g"
FT                   /product="Similar to uniprot|P40364 Saccharomyces
FT                   cerevisiae YJL066c"
FT                   /protein_id="CAG60886.1"
FT                   /db_xref="HOGENOM:HBG123623"
FT                   /db_xref="UniParc:UPI00003B6A6B"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPA9"
FT                   /transl_table=1
FT                   /translation="MGLFNGDDEKLKELCDSGVKDELNRESLFDDGLIPHGLKDSALEL
FT                   YDKAGLKDIFESGYGSLWDTLKEIGNYNTNLGSLVSRPQGNDVIQQGITGLYHYGTPNM
FT                   SQYKECADVDGLSVWDTQGWWRCLFPQGVIRDKLKVDDLSSKEQDSVMSKILTKEAVVN
FT                   DKDNKYGVFFPEWSLYMKWRVHMNHLIQQRKEEEITKRKNNDLKDWAYGFYDSDDKTPE
FT                   DIMMKKSLQDFDHKDGPEIIGKSEYVTIQSTNDGKEEVKQLKTFYNNGTTSIESIKKVY
FT                   PKDGGKPRIERTVRTVPSSRDKGNGF"
FT   CDS_pept        511210..512100
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000263929" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21045115"
FT                   /locus_tag="CAGL0J05324g"
FT                   /product="Similar to uniprot|P40363 Saccharomyces
FT                   cerevisiae YJL068c"
FT                   /function="S-formylglutathione hydrolase activity "
FT                   /function="carboxylesterase activity"
FT                   /cellular_component="cytoplasmic membrane-bounded vesicle "
FT                   /protein_id="CAG60887.1"
FT                   /db_xref="GO:0004091"
FT                   /db_xref="GO:0016023"
FT                   /db_xref="GO:0018738"
FT                   /db_xref="HOGENOM:HBG000461"
FT                   /db_xref="HOGENOM:HBG286713"
FT                   /db_xref="InterPro:IPR000801"
FT                   /db_xref="InterPro:IPR014186"
FT                   /db_xref="UniParc:UPI00003B6A6C"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPA8"
FT                   /transl_table=1
FT                   /translation="MKQVKSIAVCGGKLLQLKHASEVLHCEMDVNVYLPKQYNTNSQGK
FT                   KIPTIYYLSGLTCTPQNASEKAFWQAQADKYGFAMVYPDTSPRGDDVAGDPEGSWDFGK
FT                   GAGFYINATKEPFQKHYHMFDYVHKELPSELAKFFEEQGQSKIDFLDNVSITGHSMGGF
FT                   GALSGYLLHYSDNKYKSCSAFAPIVNPSVVPWGQKAFKGYFNDPKEGEHYDPCNLVKQV
FT                   KNTNNSSILIHVGTNDPFLKEQLQPHLLKEAATGTTWENKIDINLVDGFDHSYYFISTF
FT                   VPEHAAFHAKHLGLA"
FT   CDS_pept        complement(513918..515351)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000170207" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17440032"
FT                   /locus_tag="CAGL0J05346g"
FT                   /product="Strain CBS138 chromosome J complete sequence "
FT                   /protein_id="CAG60888.1"
FT                   /db_xref="HOGENOM:HBG352103"
FT                   /db_xref="HOGENOM:HBG593714"
FT                   /db_xref="InterPro:IPR000408"
FT                   /db_xref="InterPro:IPR009091"
FT                   /db_xref="UniParc:UPI00003B6A6D"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPA7"
FT                   /transl_table=1
FT                   /translation="MVKRSASDEAPTAKRVSTKKVLNQLDDYTHRYISVRPLDVFVWGT
FT                   GSMCELGLGPLAKNKEVKRPRLNPFLPQDKVGIVSIAVGGMHTLALDKDNNIWSWGCND
FT                   YGALGRDTSGAKEKLKDANDSSDDEDGDLNELESTPTKLPFKFEGTSEKDAKIVQLVAT
FT                   DNLSSVLLSDGTIYAWGTFRCNEGILGFYQDEIEVQREPWVVPKFAKGKIVQMAGGKDH
FT                   ILFLDEAGIVYAWGNGQQYQLGRKILDRFRLKTLYPLPFGLKKVKYIASGENHCFALTE
FT                   TGKVVSWGLNQFGQCGIGESIEDGGIVAVPSQVMNLPLDNDSIRTISAGEHHSLFLMES
FT                   GALYTCGRIDMNEIGLLKKELPTYAYKDEHERVRAVPLPTKVVKTLEELDPEDDEDDRE
FT                   YKEMKFKNIAAGSHHSIAISQDGKLYTWGFGETYAVGQGPAGDDIEVPVKITNTATKEV
FT                   DMVLAGSGGQFSVSAGYKQ"
FT   CDS_pept        complement(515847..516515)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000925" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20196332"
FT                   /locus_tag="CAGL0J05368g"
FT                   /product="Similar to uniprot|P53146 Saccharomyces
FT                   cerevisiae YGL098w"
FT                   /protein_id="CAG60889.1"
FT                   /db_xref="HOGENOM:HBG059320"
FT                   /db_xref="HOGENOM:HBG204291"
FT                   /db_xref="InterPro:IPR019150"
FT                   /db_xref="UniParc:UPI00003B6A6E"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPA6"
FT                   /transl_table=1
FT                   /translation="MSSTLIDFLVTSKEACNNKCRREAAIRDGTVEQYEQQYSKTSFEY
FT                   DSKCYSLLKDMEKEYNKYESSIKHRRYSEDFDGTHGDEDDSKELKINTEDESVAELRKR
FT                   LLGRLSDKAEQDAGQSVETQIQNHEDMQQNLYEDMSKLVGSLKQGAVAFQNALEEDQKV
FT                   LGAAEIGIQVASRGIVDISGKLKTYDKAKLGYLFYILTFLFMFIGLCVTFIIIKIFPAM
FT                   "
FT   CDS_pept        complement(516870..517202)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17440033"
FT                   /locus_tag="CAGL0J05390g"
FT                   /product="Similarity"
FT                   /protein_id="CAG60890.1"
FT                   /db_xref="HOGENOM:HBG123624"
FT                   /db_xref="UniParc:UPI00003B6A6F"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPA5"
FT                   /transl_table=1
FT                   /translation="MKNYIKSRINCSLFYNHLLLCVFGDFVLNIEISMGSYTHFEVLNP
FT                   MLSVTPSVQVIYFQKFRFLLVFLFLFEVMRMLGTASVLLVERLLENLPMDLMDGGALNP
FT                   HAPYMK"
FT   CDS_pept        complement(517428..519347)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000172552" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18501682"
FT                   /locus_tag="CAGL0J05412g"
FT                   /product="Similar to uniprot|P53145 Saccharomyces
FT                   cerevisiae YGL099w"
FT                   /function="GTP binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAG60891.1"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="HOGENOM:HBG064217"
FT                   /db_xref="HOGENOM:HBG610636"
FT                   /db_xref="InterPro:IPR002917"
FT                   /db_xref="UniParc:UPI00003B6A70"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPA4"
FT                   /transl_table=1
FT                   /translation="MPPKTEPKKWKPPKGPKPIQRKNKNPIGLGRAIMHQRSKENTIEY
FT                   LPDGEMRFTTDKHEANWVKLRSVTQESALDEFLNTAALADKDFTADRHSNVKIIRIDNG
FT                   DGSATSQGFSLTNEQKSTIDAKQRALANDLIVPRRPYWDESMTKYQLERQENDAFLEWR
FT                   RKLAHLQENNEDLLLTPFERNIEVWKQLWRVVERSDLVVQIVDARDPLLFRSVDLERYV
FT                   TEVDDRKQNLLLINKADLLTRNQRITWAKYFAKKNNSYAFYSALRANQLLEKQKELGDD
FT                   YSEEHIEEESDDSEETLEESVREGIKILTIDQLEELFLSRAPSEPLTEPLPGQESLLQI
FT                   GLVGYPNVGKSSTINSLVGAKKVSVSSTPGKTKHFQTIKLSDHVMLCDCPGLVFANFAY
FT                   NKGELVCNGVLPIDQLRDYVGPCALVAERIPKYYLEAVYGIHIQTRSREESGDIEPENP
FT                   TAQELLVAYARARGYMTQGFGSADESRASRYILKDYVNGKLLYVNPPPHLEDDTPYTRE
FT                   ECKEFNKELYVFDKLPETRQEQLREAAKAKGIEVLDLARDLSKLTFSAHTAAEANKKAS
FT                   SVTHGGKQAALYNAADDLDREFFNMNKVEGKLTTPFHKQQSQSGSKKHNKKNKKGKVRN
FT                   LNFE"
FT   CDS_pept        520083..520682
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000180129" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21045116"
FT                   /locus_tag="CAGL0J05434g"
FT                   /product="Strain CBS138 chromosome J complete sequence "
FT                   /protein_id="CAG60892.1"
FT                   /db_xref="HOGENOM:HBG323802"
FT                   /db_xref="HOGENOM:HBG501769"
FT                   /db_xref="UniParc:UPI00003B6A71"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPA3"
FT                   /transl_table=1
FT                   /translation="MDKVREKLNNLKLEAESWQEKYEELKEKNKELEQEKTDLENQAKA
FT                   LTVKNQSLEEEVEKLESGADQSRGLEQEKTDLENQVKALTVKNQTLEEEVEKLESELSE
FT                   LKQTSEESTTLRSNNENFTKKNQQLEEELEESDAKLKETTEKLRESDLKVDQLERRVTA
FT                   LEEERDEAEKKNEELTAKYEEAKKELDEIAASLENL"
FT   CDS_pept        521362..522477
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248035" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18501683"
FT                   /locus_tag="CAGL0J05456g"
FT                   /product="Similar to uniprot|P53938 Saccharomyces
FT                   cerevisiae YNL080c"
FT                   /protein_id="CAG60893.1"
FT                   /db_xref="HOGENOM:HBG059245"
FT                   /db_xref="HOGENOM:HBG202689"
FT                   /db_xref="InterPro:IPR021100"
FT                   /db_xref="UniParc:UPI00003B6A72"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPA2"
FT                   /transl_table=1
FT                   /translation="MATEAGTGQMTKESLRDAYRSIKKMSLNHLSAKQHLLMALCRDVS
FT                   MLPPVYYTFMSLKKAWQISIQTTIKLYEPQSLRESLIAFWQTYMVANISDSVQFSNLRT
FT                   MENVTQHNVNNTSAENWESVLFTALTKARASEHLFCALWCLVSLYLTYAILDSLMVRWI
FT                   VKYSTLAAILRMFSMSMIIITFELMLLASLSPEKNYFLHTWITISCILTAVYIWQSYLT
FT                   SDLNYVRNKKLDINDIDVDDEIEGINGQFSYSTTIEATPDNNSEYEVISNEDSPSQINQ
FT                   RRLNTIGSQQSRSSTPTSATSQRRSQKRNTVKSIDFTTKRYIDLYNITVFCVVPVGIAS
FT                   FITMVGLLRNLFIQRLDVEQLGRMLHESYNP"
FT   CDS_pept        523169..523549
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000039878" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17440034"
FT                   /locus_tag="CAGL0J05478g"
FT                   /product="Similar to uniprot|P53937 Saccharomyces
FT                   cerevisiae YNL081c"
FT                   /function="RNA binding"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="CAG60894.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG381711"
FT                   /db_xref="HOGENOM:HBG737405"
FT                   /db_xref="InterPro:IPR001892"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR018269"
FT                   /db_xref="UniParc:UPI00003B6A73"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPA1"
FT                   /transl_table=1
FT                   /translation="MVVHILGKAFKGKEVIRIALASKFYGVGKSTAERLCSKLGFYPWM
FT                   RMHQLSEPQILNITSELSNMTIEGDARAIVRENIALKKKIGSYEGMRHALGLPVRGQRT
FT                   RNNAKTARKINRIGVRAFHTAQ"
FT   CDS_pept        complement(523770..526493)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000165474" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20196333"
FT                   /locus_tag="CAGL0J05500g"
FT                   /product="Strain CBS138 chromosome J complete sequence "
FT                   /function="ATP binding"
FT                   /function="mismatched DNA binding"
FT                   /biological_process="mismatch repair"
FT                   /protein_id="CAG60895.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006298"
FT                   /db_xref="GO:0030983"
FT                   /db_xref="HOGENOM:HBG052105"
FT                   /db_xref="HOGENOM:HBG202688"
FT                   /db_xref="InterPro:IPR002099"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR013507"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR014762"
FT                   /db_xref="InterPro:IPR014763"
FT                   /db_xref="InterPro:IPR014790"
FT                   /db_xref="InterPro:IPR015434"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniParc:UPI00003B6A74"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FPA0"
FT                   /transl_table=1
FT                   /translation="MPISQISEQDVHRITSGQVIIDLASAVKELVENSLDAQATQIDIT
FT                   FRKYGIDGLEVSDNGTGISKDDYESLALKHHTSKIKNFDDVLTNINTLGFRGEALSSLC
FT                   GIARMAVITTTQPPRADRLEYDMAGHLSSKSTTTRNKGTTVIISDLFHNLPVRQKDFER
FT                   TAKRHFTKCITLLQSYAIINESVRITVTNITSTGKKNNILSTAANQNLNKRIISIFGST
FT                   SLRGLSPISLTLDMNPFKKNIKSRYVDDPDFDNMDYKVKVTGLFSQNSFGCGRTSKDRQ
FT                   FIFMNKRPIDYPAVVKCCNEVYRTYNNVQYPMFILNFELTPDLIDVNITPDKRTVVLHN
FT                   EQSVIDVLYENLSDYFDTQDMALPKEEPQDHISKRRRLLDHPSDSADDGSSSQLEISST
FT                   NESSFVTPIEMDITELVETNSFEYDGKESLPASEPDFRNDIEDDNMQCNSSPSKEPHSP
FT                   DDNYNEIHKEQELSEVYAPQRNLRRPKVVNIEEFANPIHEPESYIAKNGSPKKSQESLI
FT                   LQIDDKVYKQTVTVNNNSDIVSIENITPSKEYDSQHSTARENDSKTESQETDSCESCKD
FT                   DSNIPGLRSNDELLEYDDDKDEDLASFHPTDYNIRSPIKSVTSRTSKRDTFRSMTDNVL
FT                   SKNNIQLLSQHLVVHNIDDIVNISNLKEIITNNTYMNERQGTSKIIRNSALNDLDKGAQ
FT                   YLSLSVKKSDFKDMKVVGQFNLGFILVTRNMGSNYDLFIVDQHASDEKFNFENLQQTTR
FT                   FKSQKLISPETIELSVIDELIVMDNLSVFERNGFKIEIDEDAMAGHKVKLISIPVSKRT
FT                   IFGVADFQELVYLIKEDGGTNKSNIKCSKIRAMFAMRACRSSIMVGKPLNMRTMTRVVQ
FT                   NLSTLDKPWNCPHGRPTMRHLMELQNWKSFSEDYKL"
FT   CDS_pept        complement(527054..528613)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000165729" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17440035"
FT                   /locus_tag="CAGL0J05522g"
FT                   /product="Similar to uniprot|P48233 Saccharomyces
FT                   cerevisiae YNL083w"
FT                   /function="calcium ion binding"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="mitochondrial inner membrane "
FT                   /protein_id="CAG60896.1"
FT                   /db_xref="GO:0005509"
FT                   /db_xref="GO:0005743"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG541806"
FT                   /db_xref="HOGENOM:HBG735918"
FT                   /db_xref="InterPro:IPR001993"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR002067"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="InterPro:IPR018249"
FT                   /db_xref="UniParc:UPI00003B6A75"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FP99"
FT                   /transl_table=1
FT                   /translation="MAGSNADDSRYERLFKDLDVDGNGRIDLRALKRAFKEKDHPLSKS
FT                   DDALHLLFNAMDSNHDSVIDIEDFKKYARKAEEQIELGFQRIDADNDGKIKTSELTEYL
FT                   HSLSTSADNGVRPEDKQVMKPRFNSFIKWAFLRRKAKSSSDPEYITYDQWRDFLLMMPR
FT                   EQGSRLHTAYSYFYLFNEDVDLSSEGDMTLINDFIKGFGFFIAGGISGVISRTCTAPFD
FT                   RLKVFLIARTDLSSTLLNSTEDVLAKNPHAKPNKLRSPLVKAIISLYRQGGIKSFYVGN
FT                   GLNALKVFPESSIKFGSFEITKKLMTKVENCKDTKDLSKLSTFIAGGLAGVCAQFSVYP
FT                   IDTLKFRMQCAPLNAELKGRKLMIQTAKEMYTEGGLKLFYRGVTVGVLGIFPYAALDLG
FT                   TFSMLKKWYISSKAKKLNKKEEDVELSNLVVLPMGAFSGTFGATVVYPINLLRTRLQAQ
FT                   GTFAHPYRYDGFRDVLLKTIQREGYPGLFKGLVPTLAKVCPAVSISYLCYENLKKLMKL
FT                   QS"
FT   CDS_pept        528997..530043
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000076607" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21045117"
FT                   /gene_name="END3"
FT                   /locus_tag="CAGL0J05544g"
FT                   /product="Actin cytoskeleton-regulatory complex protein
FT                   END3"
FT                   /function="actin binding"
FT                   /function="calcium ion binding"
FT                   /biological_process="endocytosis"
FT                   /cellular_component="actin cortical patch"
FT                   /cellular_component="endosome membrane"
FT                   /cellular_component="plasma membrane"
FT                   /protein_id="CAG60897.1"
FT                   /db_xref="GO:0003779"
FT                   /db_xref="GO:0005509"
FT                   /db_xref="GO:0005886"
FT                   /db_xref="GO:0006897"
FT                   /db_xref="GO:0010008"
FT                   /db_xref="GO:0030479"
FT                   /db_xref="HOGENOM:HBG050986"
FT                   /db_xref="HOGENOM:HBG333510"
FT                   /db_xref="HSSP:1EH2"
FT                   /db_xref="InterPro:IPR000261"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="InterPro:IPR018249"
FT                   /db_xref="UniParc:UPI00003B6A76"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FP98"
FT                   /transl_table=1
FT                   /translation="MPKLEQFEIKKYWQIFSGLKPVENKVSHDQVLPILYNSKLDSSIL
FT                   NKIWFLADIDDDDNLDFEEFVICMRLIFDMVNKNIDSVPDELPEWLVPGSKAKLIKERQ
FT                   KAKQQENAEIPRQEVPDVDWYISPEDKTYYEKILSTCGPMADGTVTFAELSLALKSKFF
FT                   NIGVSDMERTWKLINPRDLPSIDRDPAMYFIHCLRQRNDIGTSIPSELPPALAEVCNKQ
FT                   RVEYDLSSKQADLKRLDTKEPTKNDVTKLGDELDRLEHSLENLTTGSTSSTLQGTIKMS
FT                   KESLNQFKGLLAFMENDLNHPNPDSNANVKYVTDDLDNIDQQVQMLETYLQQKRQELGS
FT                   LKAEVGST"
FT   CDS_pept        complement(530428..532869)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000113598" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17440036"
FT                   /locus_tag="CAGL0J05566g"
FT                   /product="Similar to uniprot|P40850 Saccharomyces
FT                   cerevisiae YNL085w MKT1"
FT                   /function="nuclease activity"
FT                   /biological_process="DNA repair"
FT                   /protein_id="CAG60898.1"
FT                   /db_xref="GO:0004518"
FT                   /db_xref="GO:0006281"
FT                   /db_xref="HOGENOM:HBG059240"
FT                   /db_xref="HOGENOM:HBG202687"
FT                   /db_xref="InterPro:IPR006085"
FT                   /db_xref="InterPro:IPR006086"
FT                   /db_xref="InterPro:IPR022039"
FT                   /db_xref="InterPro:IPR022040"
FT                   /db_xref="UniParc:UPI00003B6A77"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FP97"
FT                   /transl_table=1
FT                   /translation="MPIKSLESYLFERSLVGSYSIESLANCTLGIDVNHYVSRLLTSKR
FT                   EQYLDAIGGFPTSLKLYLESDLKVYNEYNITPIFIFNGSLTHDQLENEGYFSAASKESA
FT                   KAASNGATTSGPNAATNPTMRSNKETVLAQRHRAWTQWNNLVTSNQESYIDQPIQPQEP
FT                   FRYTTTIDPKAYQADLISYFIEHDIMYQVAPYTSWIQLAYLFENEFIDAIYGPTDCLML
FT                   PKVDKFILGMEFPNKEFRFIEKSRVLKEFGITHEELVDISMAVGNDLQPVTLPPLQIYP
FT                   VPQLFDIALEMVLNAGTNFYTYELTNPIKSEKDQYLIKYQKGYAALKFMPVLKANGRVE
FT                   LLSENENSDEAQKENSATHTSPGESDNEKKKSIPSASFDDPDAIPADVHDFIAQRLPHE
FT                   YYFYRSIGLVTGKLFDAITTGVYPEEPPLDGGSSNSYRKLVEKSVDAFKNQEVNLLTQP
FT                   INRYYQIKQIKHVKWFAPEESVQLTNRMTPSAFEKINRIIVKTDSEAPFSLLSFLQLLS
FT                   TSDNLGDKFISNEVIFPASVNHEKKLHSAFDLLATCFLRTLVVLGFFDCNISKKELTPT
FT                   KWGEVLMKLPELQVSKDYIEPIFILMVFLKLDVLELGKDTVPSTTSALSEATLRSYPDA
FT                   SQHILIIARILTLFQIKQKPSNYHGPIDKKTLVFRDHLAFVKENLNELFEAITVSSLTS
FT                   GEFDRLNLDNFNWKKSVVRSMPFKLDTPNTIMAMMWEFFLQKYLHNGNAKADALSLVAT
FT                   DFSTYKSTPDLDEKFQESLEFLQQVKAVAKELANNNLIKASDASLLSAATDFAISAYSS
FT                   S"
FT   CDS_pept        complement(533614..533919)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000858" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21045118"
FT                   /locus_tag="CAGL0J05588g"
FT                   /product="Similar to uniprot|P48232 Saccharomyces
FT                   cerevisiae YNL086w"
FT                   /protein_id="CAG60899.1"
FT                   /db_xref="HOGENOM:HBG059239"
FT                   /db_xref="HOGENOM:HBG202686"
FT                   /db_xref="InterPro:IPR020515"
FT                   /db_xref="UniParc:UPI00003B6A78"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FP96"
FT                   /transl_table=1
FT                   /translation="MSDNSEVQGIHPVELSVYSLVSSDLDNLYQAINELRESQALLILK
FT                   LRTVRDSLRLENELLFDSNEYKAQFKEVNNLQKRLQKITLRLKDLERRSSQLTTSS"
FT   CDS_pept        complement(534283..538503)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000216693" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17440037"
FT                   /gene_name="TOP2"
FT                   /locus_tag="CAGL0J05610g"
FT                   /product="DNA topoisomerase 2 "
FT                   /EC_number="5.99.1.3"
FT                   /function="ATP binding"
FT                   /function="DNA topoisomerase (ATP-hydrolyzing) activity "
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /biological_process="DNA topological change"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="chromosome"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG60900.1"
FT                   /db_xref="EMBL:BAA33955.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0003918"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0005694"
FT                   /db_xref="GO:0006265"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="HOGENOM:HBG114708"
FT                   /db_xref="HOGENOM:HBG521093"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020899"
FT                   /db_xref="UniParc:UPI00003B6A79"
FT                   /db_xref="UniProtKB/Swiss-Prot:O93794"
FT                   /transl_table=1
FT                   /translation="MSEPKTASERYQKISQLEHILKRPDTYIGSVEIQEQEQWIYDEET
FT                   DCMIDKTVNIVPGLFKIFDEILVNAADNKVRDPSMKRIDVTINPEENFIEVRNDGKGIP
FT                   IEIHEKEKIYIPELIFGHLLTSSNYDDDEKKVTGGRNGYGAKLCNIFSTEFTLETADPK
FT                   NGRKYVQTWENNMNVCHPPKITSYKKGPSYTKVAFKPDLSRFGMESLDSDILGVMRRRV
FT                   YDINGSVRDVNVYLNGKPLKIRNFKNYVELYLKSLEKMRKMDNGESDTTPSNIPTILYE
FT                   RVSDRWEIAFAVSDISFKQVSFVNSIATTTGGTHVNYIADQIVRKVSDILKKKKKNIKP
FT                   YQIKNNMFIFINCLIENPAFTSQTKEQLTTRVKDFGSRCDISSDYINKIMKTDLATKIF
FT                   EIADENANNALKKSDGSRKSRITDYPKLEDANKAGTKDGYKCTLILTEGDSALSLAVAG
FT                   LAVVGRDYYGCYPLRGKMLNVREATADQILKNAEIQAIKKIMGLQHRKKYEDTKSLRYG
FT                   HLMIMTDQDHDGSHIKGLIINFIETSFPGLLDIPGFLIEFITPIVKVTITKPIKKVISF
FT                   FNLPDYEKWREEESHKYSWKQKYYKGLGTSTSPEIIEYFSNLDTHLKKFHALQGDDKDL
FT                   IDLAFSKKKADDRKEWLRQYEPGTVLDPTLNEIPISDFINKELILFSLADNVRSIPSVL
FT                   DGFKPGQRKVLYTCFKKNLTTEKKVANLAPAVSDYTAYHHGEQALVQTIIGMAQNFVGT
FT                   NNIYFLKPNGAFGTRATGGKDAAAARYIYTELNKIARKVFHPADDPLFRYVQEDEKTVE
FT                   PEWYLPVVPMVLINGAEGIGTGWSTSIPPFNPLDVVNNIRHLLNDEEMDDMHPWFRGWT
FT                   GTMEKIESQRYRMYGRIEQVGPNTLEITELPARTWTSTIKEHLLLGLGGSEKVKPWIKD
FT                   MEEQHAETIKFIIKLTDEEMTKTRKLGFYERFKLISPISLQNMVAFDYRGKIKKYDHVH
FT                   EILKDFYEVRLEYYQKRKDYMTGRLQWEAEKLSFQVKFIKMIIDKSLIVTNKPKKQLIS
FT                   ELEELGFPRINKEGKPHFGKIDEEVEAIISEDEDEDLEESEEATRKKDKDDESTVNGPE
FT                   ELFGTYEYLLGLKIWSLTKERYEKLLKQKQEKETELENLLKLSAKDLWNNDLDDFLTAY
FT                   EDFQKMDLFLRNSAVPKTKGGKRKRKGGDDDDYDPSGKKKPARRIKKIKKEDDFDRILI
FT                   KPQAKIKAKRPVKVKVEPPSSAASTPSVKEELGVSDVTSNASTPSTTIFDQKVKQENSD
FT                   ESGISAFSSKFNKIASAFDEDAPLDQITSEDTSVKESSAPAAKKKAPPKRKAKVVESSE
FT                   DELSDANLSEQDDEEVVPVRRQRSSRQTAKKSYAEPIEISDEEDFIDDDEDEEVDSDES
FT                   FNDE"
FT   CDS_pept        complement(539466..540032)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000233974" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20196334"
FT                   /locus_tag="CAGL0J05632g"
FT                   /product="Similar to uniprot|P06781 Saccharomyces
FT                   cerevisiae YNL090w RHO2"
FT                   /function="GTP binding"
FT                   /biological_process="small GTPase mediated signal
FT                   transduction"
FT                   /cellular_component="intracellular"
FT                   /cellular_component="membrane"
FT                   /protein_id="CAG60901.1"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0007264"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG527536"
FT                   /db_xref="HOGENOM:HBG745225"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR003578"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR013753"
FT                   /db_xref="UniParc:UPI00003B6A7A"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FP94"
FT                   /transl_table=1
FT                   /translation="MSEKAIRRKLVIIGDGACGKTSLLYVFTLGKFPEQYHPTVFENYV
FT                   TDCRVDGIKVSLALWDTAGQEEYERLRPFSYSGADVILIAFSVDNVESLHNARTKWAEE
FT                   AFRYCPDAPVILVGLKEDLRKSKQEGIVFVNREDAEQVAKAIGAKKYLECSALTGEGVD
FT                   DVFELATRSSLLMHKEPDHFCCSIS"
FT   CDS_pept        540710..545416
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000142048" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20196335"
FT                   /locus_tag="CAGL0J05654g"
FT                   /product="Similar to uniprot|P53552 Saccharomyces
FT                   cerevisiae YNL139c RLR1"
FT                   /protein_id="CAG60902.1"
FT                   /db_xref="HOGENOM:HBG059369"
FT                   /db_xref="HOGENOM:HBG202670"
FT                   /db_xref="InterPro:IPR021418"
FT                   /db_xref="InterPro:IPR021726"
FT                   /db_xref="UniParc:UPI00003B6A7B"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FP93"
FT                   /transl_table=1
FT                   /translation="MTNVLGRLKRLSGQVNDNYFTTRTILTDEFASSWNSKREELIDNY
FT                   KKLDNDSERKEWLRSFFMDVIRLLKLSEDNNSLQIDTLSELIKLVYNATPSFKQTIGEV
FT                   FAAVVNTYCPKSVIDKVLRLITLTPILRTEVYKYSWLSTKLMTNDQKILTKHLLKKNRY
FT                   EIKKYNLIYENPIGFTQITSLLNVLVLDPYAHQKIPYFVSQLYQIMGKYSLDPLRTLDV
FT                   MITFFAEHVTLHYKLILDFLKCTNYWPRDTQLANPDNIMSLNHGGNKTAAKLITVRLNS
FT                   FFQSAVEGKSISSFEDNYLNLSCLLIKEGFVNFSNIWSNLSPLSEEFKSTLDDYMKKLE
FT                   LESTKGLDNPLAMASALTNEDDEADNKELDNKDSDTTMTGTEEEDKELEEAQKRNFEAA
FT                   VLNHGKLKLLIKLLAHGTYAPTLWAISEFPEISHLDTDIPILFSKLFEIQIENLYESMS
FT                   FRWRNTPAIISGLKKLENGLLSSKPRLYETIYSDDTNECVELNTKRKFYYQDWSSGLPR
FT                   IADINELVDVCHQYFKYFDVSLGCNSSLIIKLCRIVSAKLRGTEVDGTDQSQTLELAIN
FT                   YTRKFLLPIVGVMSENSTLGSEIFNLLKEFPLEKRYFMYNEMLTKTSQDNLLVKIGFNK
FT                   AEREAKSILKSLSTDNIETGSRKFARLLSSNPLATLLPTIKQIENYDKVSELIIFTTKF
FT                   LNQFGYDVLQYILLLRLTYSRPIMQDDGINQSMWVQRLAVFIAGLVKSCPQMDISELIT
FT                   YIIKQLHVGSSIAITIMKELISTVAGIRDLNHVSRERLILINSSRPLQKYGHKLIFDVR
FT                   NENKSLGMKLMTLFQNQDAVSEIIVLLYNLNLNINQQDLHYKILSSKCDEMNTLLWSYI
FT                   ELVKYSNTHDNFPKYVYPFERLINEFHISTPWAFHIWRDYFKEEDEISGDLSNFSSYEK
FT                   IDFPELSASNFDRSFFLTFWRLSLLHVQFDKNLYNTRKKEIESEIVPGLTNRQKNQKVG
FT                   EKKEIMSSCITHEHIFIKTKKYLCENSSSWGNSLDLDNQHIFIKFCIVPRILFSPSDAL
FT                   FTSRFLIETFGNELLFSLMDTFIKSRMMHALIFCSTISEAANLGIFFADLFEYLEKARI
FT                   SGKLTDDLTATLYNWHDVLVEESIILLKERNYMSIRNGIEFLRNVSDIFPVVDIHIKLC
FT                   CQALRDILEAETREDIKLPTNALLGHLNSKLKSSIRKSEYCQLTEDEKLLEEKYNEELN
FT                   EIKDYETSLENEKKQAELRAKIEENKQKRLEAEKQKAELQKQQQVESSRETRVSEAKLK
FT                   QKGQSHTWRLTKLFRVMDDVCYFISRNELNRAINLVEDDSEVWNIKHAIKNKGSLGSFR
FT                   NNIFEIFGRYFKSLILYPQNSDFQVRMDELKAATKYLDRKSNDVEPEKSSRYGGSVKVP
FT                   PGASAKSEDLRGRSTTPSGPASDKNKQSSNQFRQAPGRNTYNNDRQHSGHSYKTGKDDK
FT                   EKTPQQRSQLQFPDRPTQGRNDHQIAGQKRGYQSQQKDSHDDHASKRFRKEDSSRMSYT
FT                   DRNNRSFNQNLASRFGGPTNKNSNASSDHKPTALPQGPKGSSGSRYQR"
FT   CDS_pept        545919..547193
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000142049" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20196336"
FT                   /locus_tag="CAGL0J05676g"
FT                   /product="Similar to uniprot|P53901 Saccharomyces
FT                   cerevisiae YNL152w"
FT                   /protein_id="CAG60903.1"
FT                   /db_xref="HOGENOM:HBG059368"
FT                   /db_xref="HOGENOM:HBG202666"
FT                   /db_xref="InterPro:IPR000008"
FT                   /db_xref="InterPro:IPR008973"
FT                   /db_xref="UniParc:UPI00003B6A7C"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FP92"
FT                   /transl_table=1
FT                   /translation="MSEEVWDGNQGTLSVYVSKAKDLPNLDKLDKQDVLLRLRIAHMTR
FT                   ESDTIIRAGQTPIFKYYEKFEITPELRPLMYVEIYSDRRKKAPILIGRCEVDLLNGIRA
FT                   DPKEGYCTWYELKKPNNDFAGTVFIELTFKPTYPTFRRDGESYNSRNQDKSMAARPIPP
FT                   LPDDMSQFENEPESFRPNHYNSHFSSSSSSRTQSRFGGSESDYLHASAVRQVTPAIVDD
FT                   NHHRVAQRFATSDNYGNENGPANFMSSVGTSSTVTTQDSSTTTITNNSDTKFHFANLRK
FT                   LKEKINIFKNPNNSEEPETKNSNVDIEALQKAIGINNDAQSDDVSSTESFHERYQASRD
FT                   ISKSSSRGHNDALFKYSGGQNNEPPLPPLPKSPSRSPTRDRSPHRTPHSHHYHQHQEMV
FT                   SPKLPPLPTSRNNSTSPTRRRPPPI"
FT   CDS_pept        complement(547495..548199)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000247872" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17440038"
FT                   /locus_tag="CAGL0J05698g"
FT                   /product="Strain CBS138 chromosome J complete sequence "
FT                   /protein_id="CAG60904.1"
FT                   /db_xref="HOGENOM:HBG059367"
FT                   /db_xref="HOGENOM:HBG397902"
FT                   /db_xref="InterPro:IPR016264"
FT                   /db_xref="UniParc:UPI00003B6A7D"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FP91"
FT                   /transl_table=1
FT                   /translation="MSGRRGAGSGGGARSLPFGLGYQDIGPNNIAEFPSLSLPVNGNVS
FT                   SRDRSIALKYINFNAALRESPFFTGTLEAAEEGDNKNKKKGKRELVNNEGPSDGIARYS
FT                   DKYLKKRKLGVSIDEHPFHLELFPKDLYAVMGINKKKLMTLSKFNNEDDIFTGSEQDEA
FT                   LGLSMLEKYKELAEEVDEEDENKKEEDGTEEPVDDEFDDEDDDDDYNAEKYFSGGDDDD
FT                   IGEDDYGDEPAF"
FT   CDS_pept        complement(548712..549125)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000854" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20196337"
FT                   /locus_tag="CAGL0J05720g"
FT                   /product="Similar to uniprot|P53903 Saccharomyces
FT                   cerevisiae YNL149c"
FT                   /protein_id="CAG60905.1"
FT                   /db_xref="HOGENOM:HBG059366"
FT                   /db_xref="InterPro:IPR011431"
FT                   /db_xref="InterPro:IPR016809"
FT                   /db_xref="UniParc:UPI00003B6A7E"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FP90"
FT                   /transl_table=1
FT                   /translation="MERISKIFENSIDNILSIEPRKALRIVIIVGAYMLFRNLVTRDQN
FT                   RRQLARQVRQEEERKKEEREKTLLERPEDFEVETIAKSSTTEYGWGKKTRQRVKRQQEV
FT                   LERAVDDLKRHEQLKLSGTGYDSDEEIEELLED"
FT   CDS_pept        complement(549568..550329)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000209180" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21045119"
FT                   /locus_tag="CAGL0J05742g"
FT                   /product="Similar to uniprot|P53904 Saccharomyces
FT                   cerevisiae YNL148c ALF1"
FT                   /protein_id="CAG60906.1"
FT                   /db_xref="HOGENOM:HBG059365"
FT                   /db_xref="HOGENOM:HBG385175"
FT                   /db_xref="InterPro:IPR000938"
FT                   /db_xref="UniParc:UPI00003B6A7F"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FP89"
FT                   /transl_table=1
FT                   /translation="MTSDKKIPVTVRLFNGQEPTKMYSDSITVSELREQIYAFSGVDPQ
FT                   DMKLYVAFNRTPMGRASSDERQWDLEVTKETNGDQRILEGHSSCYIIVQDTNKDSLIYQ
FT                   LMKQDEQDEGPLFEYSQKDYENRDNTVLRWKQQEQLGRFDSEYNANMAKDLEQQELKAS
FT                   QLQLGERCTVKGVSERRGWLRYVGPVEGLTGLWCGVEFDKAEGKNNGVFKEHTYFGPVS
FT                   DNHGGFVRPQQVETGTQYAPFETSGSDSDEI"
FT   CDS_pept        join(550672..550683,550851..551192)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000223548" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20196338"
FT                   /locus_tag="CAGL0J05764g"
FT                   /product="Similar to uniprot|P53905 Saccharomyces
FT                   cerevisiae YNL147w LSM7 Sm-like"
FT                   /protein_id="CAG60907.1"
FT                   /db_xref="HOGENOM:HBG353275"
FT                   /db_xref="HOGENOM:HBG749684"
FT                   /db_xref="InterPro:IPR001163"
FT                   /db_xref="InterPro:IPR006649"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR017132"
FT                   /db_xref="UniParc:UPI00003B6A80"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FP88"
FT                   /transl_table=1
FT                   /translation="MSEQNTQQAEQNNNNRGQQKKKFEAPKREAIVDLGKYKDSKVSVK
FT                   LMGGRIVTGILKGYDQLMNLVLEETEETLKPEVETGATQQVTRQLGLTVIRGTILISLS
FT                   PLDGSEVLYIQTN"
FT   CDS_pept        complement(551562..553406)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000260888" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19349511"
FT                   /locus_tag="CAGL0J05786g"
FT                   /product="Similar to KLLA0E23034g Kluyveromyces lactis and
FT                   YALI0E27720g Yarrowia lipolytica"
FT                   /function="zinc ion binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAG60908.1"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG270065"
FT                   /db_xref="HOGENOM:HBG525581"
FT                   /db_xref="InterPro:IPR000315"
FT                   /db_xref="InterPro:IPR018553"
FT                   /db_xref="UniParc:UPI00003B6A81"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FP87"
FT                   /transl_table=1
FT                   /translation="MGTANKRSLKEILDSEYVENSDDEVQHGDSDHDVSDNEEAPLDPS
FT                   ICEECRDMKFEIICKDCQENFCVICYEMIHRGGKRRKHEFTKVSIDNPGEATETTLQQL
FT                   PADSSEQKELQDTINNYDGSEIPAQKQESVEDTNSIDNKLMSILFETSHYIPMRLTYEE
FT                   RHLLRLLEAALQVSEYTDRVDILSNKSKSRRIVEQLKEICSVLSGLVVASNMKLGQKLL
FT                   DMKNFSDNAKWFQDIFEIGRRYKIMNPERMRDTYGKLCYMVMDSRLPQICEHMEFHLYK
FT                   PILTVQSFLTTKTEDNGKAMGIFKDKLILAATSHISPVGRTRNQINRSIKQKETAIETL
FT                   ASKYSSKHYSKEDIRQALYSIGDYNAYVNMNRKPVLRMLSRLEIFRQPEVAAKYNIGIQ
FT                   YGRNGARLTHDHERQWHYVQQSLTLWSIIQREMVKLWYIADLDLFDGSNYRLASTGHGL
FT                   NRIKPCPRIYKEMHRIIGECRSKTEAWVGSSVVHLGDDAVPNALFFLDKYTQVPSILIP
FT                   FDQTLIQINDLVKNDEYLLDYIKKEYGSVEDLKMTILQDAFAHMFDGSGADNFYMSGSC
FT                   IDGRLTSAWNHCNEISKKKYYNIFLLTSFTGFNGSEGF"
FT   CDS_pept        553745..554044
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20196339"
FT                   /locus_tag="CAGL0J05808g"
FT                   /product="Similar to uniprot|P53906 Saccharomyces
FT                   cerevisiae YNL146w"
FT                   /protein_id="CAG60909.1"
FT                   /db_xref="HOGENOM:HBG123625"
FT                   /db_xref="UniParc:UPI00003B6A82"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FP86"
FT                   /transl_table=1
FT                   /translation="MKTTKSSNGSYYHDLRRALRIGVLFILISLLFTSRLRNIVQQFLN
FT                   MFGRVRSGYSIEDVNHVPIFSEPDFDGVDVHTVDIKRLIMFLVVFFSLAIPFVF"
FT   CDS_pept        complement(554231..556054)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20196340"
FT                   /locus_tag="CAGL0J05830g"
FT                   /product="Strain CBS138 chromosome J complete sequence "
FT                   /protein_id="CAG60910.1"
FT                   /db_xref="HOGENOM:HBG123626"
FT                   /db_xref="UniParc:UPI00003B6A83"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FP85"
FT                   /transl_table=1
FT                   /translation="MDTEMDMGIELPAYSVHSVDSVHSVHSVDSADSLECAEELPGYSP
FT                   AVEKFVRAKFKLEWESPTQVSRDPCWYDVVLHINSTQLNLYLPRCPKSRPASKSLSYVS
FT                   AKPSVSGVRRLSERFTRFKKNYLPAFEPLDFHPTPAGFTNSYQNMPQDALGARKKRSNQ
FT                   YDFIYDTNYEEYCSETCDSMDVSTGFVPFKSYSLQGAKVGMPTSESRKKVYIDEENVYK
FT                   DAYLVCLRLRMEDQQFLVQFEHIDDMIMWSMYLSMGINVSKDLYDREYPNYRIVPRRRR
FT                   RRHSGHSRRRFSSRRRHSSGRTPVRNTEGPSSSTRRRANSFLKHFTGAKSASEPLQIDF
FT                   KNPFTSEQQPDAALVRQKSHHEPPERTPASDQSRSESSAHGDITPNNSISRSTTTSLHD
FT                   NESDVMDGLNNLTRSPSECLSLYETLTANSSFCEYDLDKPHAKLARINYNFDYWSPLQF
FT                   GSSLSSTSSLGLSNSMDCSFDSNESTYPDGMIPELIELEEEIEEDDEDDIDIEDYGLEE
FT                   FEIFEEGEELETDDMNDCDTKWNPVKKEQTRKRYIRHSLRCIRPLAPDAKWEGETIYVK
FT                   AGLRNKMYNPSLLKDIKPYLMETKIVGAMST"
FT   CDS_pept        complement(556527..557558)
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI21045120"
FT                   /locus_tag="CAGL0J05852g"
FT                   /product="Similar to uniprot|P40580 Saccharomyces
FT                   cerevisiae YIR036c"
FT                   /function="binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAG60911.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG533752"
FT                   /db_xref="HOGENOM:HBG750976"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI00003B6A84"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FP84"
FT                   /transl_table=1
FT                   /translation="MPAPTQPAPSYSKCYALKEIIYGFWATKVTYTPDKYPDLTGKTAV
FT                   VTGCNTGVGKEAAKLLYQKNCNVIGVCRTESKGLEAAESIKQEIGNSKGSISVVSGCDF
FT                   LDFTTVPQAGKRIQEILAGKPLNIIIHNAGLMSSSNAGTSKQGLEAMFQTNVMGPQLLQ
FT                   HYLDPVFLKEDDTSLKRIVWVSSGAHLLGPSQYGIFWENPGFDGVAIEKRPAATTLYGA
FT                   TKAANILQAKAWATRNKEMVDKIGCVSVSCYPGNLRTDLQRDWHPWTRATVGRLFYPAE
FT                   YGAYTELYSVLSPSLTTSDQGKYICPFDQVHEPREDVKEGLQNGTDLALWDWIESEIKE
FT                   YIS"
FT   CDS_pept        complement(558678..559628)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000852" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17440039"
FT                   /locus_tag="CAGL0J05874g"
FT                   /product="Similar to uniprot|P53895 Saccharomyces
FT                   cerevisiae YNL159c"
FT                   /protein_id="CAG60912.1"
FT                   /db_xref="HOGENOM:HBG123627"
FT                   /db_xref="HOGENOM:HBG202664"
FT                   /db_xref="UniParc:UPI00003B6A85"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FP83"
FT                   /transl_table=1
FT                   /translation="MNDQEGDSDSELYEQYLEDRRRLQSREDAHEIQTSEEVLQRNLDE
FT                   TLSRVLRNWSQEIDNHHVRIRITGRRHENTNSNSHTNNSYNNGAATENRNNNYGNMLGI
FT                   NLPSHNSIGSNSNGVNQRTPFAQRPSFFRTLVRNLLVLNYLVLSLLFPFSLYNVLRSGF
FT                   STMTFSERDFTREILTYWYAIDTVDVISLIKPSTPETSDSGPGLGLLGKFHNIIVYYSL
FT                   PIGEALLRRILNIDRSYTDTEEYPVSVGIYRMILGFFFRWYKKSIKIVTILVYLLYGIG
FT                   GTTYLMIAGFFFSLCVGLTIVRRYKSTQQILSGLF"
FT   CDS_pept        559944..560519
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18501684"
FT                   /locus_tag="CAGL0J05896g"
FT                   /product="Similar to uniprot|P53896 Saccharomyces
FT                   cerevisiae YNL158w"
FT                   /protein_id="CAG60913.1"
FT                   /db_xref="HOGENOM:HBG123628"
FT                   /db_xref="InterPro:IPR019433"
FT                   /db_xref="UniParc:UPI00003B6A86"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FP82"
FT                   /transl_table=1
FT                   /translation="MLLYYTVLPVLWLCAIVSANTETLRIRIPRQFKTSELTRQVHDSY
FT                   SILKNLEDTAIVSGNINSTSPFHVIEVRSNWSGTTLDVRVSWTAADGYSINDLGYLLIT
FT                   KEHEVVTPWSNETFEGLHEKLYVYFKVVPDSYPLLEDGQVFNVAINIKETFLGLTSDLY
FT                   VMIAYLIVLASISRLVVVHGWKLLSPLL"
FT   CDS_pept        complement(560739..561710)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000113862" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20196341"
FT                   /locus_tag="CAGL0J05918g"
FT                   /product="Strain CBS138 chromosome J complete sequence "
FT                   /protein_id="CAG60914.1"
FT                   /db_xref="HOGENOM:HBG123629"
FT                   /db_xref="HOGENOM:HBG203786"
FT                   /db_xref="UniParc:UPI00003B6A87"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FP81"
FT                   /transl_table=1
FT                   /translation="MVKGRKKKAVKTVESSESISSLTTPQLYSIYDQDIVKSEDAEIYE
FT                   ELKRSRSKSSSLDTPLYAIDEIIHLKKDNDKVNESPLIDVSEGSHIRPLSQHKKLINET
FT                   LLTPSMSAGGNLGLDATMANTMSFHVTPFQRFTNFVFAIVVLSISGVAYHQLSRNLHDN
FT                   HLLHEDFASRPLLWGVTIQQKLSCGILPDWFGYALEGIIFGSIIPLMDHITKVKLRPTS
FT                   YSLSSVIRSINAMLGVTFGIRKIQWASSGQAAGAWGLLNVILWLFFDGTLSMFSNCSVL
FT                   GLLCCASCFHEITDVSQFLYFMDFYFLGSLMFGKIGRYLYHL"
FT   CDS_pept        562687..564147
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000182055" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19349512"
FT                   /locus_tag="CAGL0J05940g"
FT                   /product="Strain CBS138 chromosome J complete sequence "
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="CAG60915.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG537393"
FT                   /db_xref="HOGENOM:HBG755340"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI00003B6A88"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FP80"
FT                   /transl_table=1
FT                   /translation="MPHSLTGTPSPGMITSNSSTQGSMSSSKDNGNGGTIAGLHYQIGK
FT                   KIGEGSFGVLFEGTNIINGMPVAVKFEPRKTEAPQLKDEYRTYKILAGTPGVPQAYYFG
FT                   QEGLHNILVMDLLGPSLEDLFDWCGRQFSPKTVVQVAVQMITLIEDLHAHDLIYRDIKP
FT                   DNFLVGRPGQPDENNIHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYMSINTHLGR
FT                   EQSRRDDMEALGHVFFYFLRGQLPWQGLKAPNNKQKYERIGEKKRTTDVYDLANGYPVQ
FT                   FARYLEIVRNLGFDETPDYEGYRKLLASALDDIGETMDGKYDWMELNGGRGWDLTINKK
FT                   PNLHGYGHPNPPGDKSHRNRNAAKGGNHANDANHGGLDPTSYEAYQQQTQQKMLQQQQK
FT                   QSQRNQNTAVDQQNYRLNNNPINNTSQPNNYKGNGGKDTNMMNGNGNGNRYNFQEQPTT
FT                   THGQTKNTQQDMHSSSSEKGFFSKLGCC"
FT   CDS_pept        complement(564491..565372)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248569" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18501685"
FT                   /locus_tag="CAGL0J05962g"
FT                   /product="Similar to uniprot|P53899 Saccharomyces
FT                   cerevisiae YNL155w"
FT                   /function="zinc ion binding"
FT                   /protein_id="CAG60916.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG059360"
FT                   /db_xref="HOGENOM:HBG396034"
FT                   /db_xref="InterPro:IPR000058"
FT                   /db_xref="UniParc:UPI00003B6A89"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FP79"
FT                   /transl_table=1
FT                   /translation="MFAKRAPQSVVNDMNNKEKETGMLDVGTHCQYCRQLDFLPFHCKL
FT                   CDGDFCSEHRSKESHHCKWLLDHPEELENNGARSPPSSSKSNGGKFFQSLLPEKAHIRV
FT                   KSPSPSSTTSQSPVKLGSSGVTTKNKPSETTKIRSTLNPAALNKLLNFFKRTKSDPKTK
FT                   KKVSTSSNRLVELSTLKKTAKGDSKIPVQNRIYIYCQVILGEDETSDTLGLTKVPLYIN
FT                   KIWPVGRALDYLSQQLHVTNVNGNVDTTKGEKLFLYKYDEKLNEYVGIETSGRVNVLVK
FT                   DLDTLYLVRGQI"
FT   CDS_pept        complement(565921..566964)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000218813" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17440040"
FT                   /gene_name="AAH1"
FT                   /locus_tag="CAGL0J05984g"
FT                   /product="Adenosine deaminase "
FT                   /EC_number="3.5.4.4"
FT                   /function="adenosine deaminase activity"
FT                   /function="metal ion binding"
FT                   /biological_process="purine ribonucleoside monophosphate
FT                   biosynthetic process"
FT                   /cellular_component="cytoplasm"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG60917.1"
FT                   /db_xref="GO:0004000"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0009168"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="HOGENOM:HBG223667"
FT                   /db_xref="HOGENOM:HBG630382"
FT                   /db_xref="HSSP:2AMX"
FT                   /db_xref="InterPro:IPR001365"
FT                   /db_xref="InterPro:IPR006330"
FT                   /db_xref="InterPro:IPR006650"
FT                   /db_xref="UniParc:UPI00003B6A8A"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FP78"
FT                   /transl_table=1
FT                   /translation="MVPESFLLELPKCEHHLHLEGTLEPDLLFPLAKRNNIQLPDHFPQ
FT                   TPEELAVRYTQFKDLQDFLDYYYIGTNVLLKEEDFFDLAWAYFTKVSKQGLVHAELFYD
FT                   PQSHTTRGVSLETVTRGFERACKKAHEELGITSKLIMCLLRHLPPQDCLQTIEEAEQLI
FT                   KSGVIHGLGLDSAEKPFPPSLFVECYERAAKINPELRLTAHAGEEGTHQFVSDALDLLN
FT                   VTRIDHGVNSKQSEELMARLAEQQTLLTVCPLSNVKLQVVQSVKEIPLQLFLDKNIAFS
FT                   LNSDDPAYFGGYILDNYYQVNKDFPDWDFKVWERIAKNGINGSWCEQKRKEELLAKVDA
FT                   VVAKYTN"
FT   CDS_pept        567376..567765
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000204477" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18501686"
FT                   /locus_tag="CAGL0J06006g"
FT                   /product="Strain CBS138 chromosome J complete sequence "
FT                   /function="unfolded protein binding"
FT                   /biological_process="protein folding"
FT                   /cellular_component="prefoldin complex"
FT                   /protein_id="CAG60918.1"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="GO:0016272"
FT                   /db_xref="GO:0051082"
FT                   /db_xref="HOGENOM:HBG329661"
FT                   /db_xref="HOGENOM:HBG398530"
FT                   /db_xref="InterPro:IPR002777"
FT                   /db_xref="InterPro:IPR009053"
FT                   /db_xref="InterPro:IPR016661"
FT                   /db_xref="UniParc:UPI00003B6A8B"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FP77"
FT                   /transl_table=1
FT                   /translation="MELLPEGKKNNIEVTFADQQKINEFSKLIMRKDALEAELKKERQE
FT                   KEYLEDVSLEIELIDEDEEVQYKMGEVFVFLKQSKVVEQLEKDTEIIDEKISQLESKQD
FT                   DLEDRIKELKTSLYAKFGDNINLER"
FT   CDS_pept        complement(568124..569638)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000017736" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17440041"
FT                   /locus_tag="CAGL0J06028g"
FT                   /product="Strain CBS138 chromosome J complete sequence "
FT                   /function="ammonium transmembrane transporter activity "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAG60919.1"
FT                   /db_xref="GO:0008519"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG380231"
FT                   /db_xref="HOGENOM:HBG677626"
FT                   /db_xref="InterPro:IPR001905"
FT                   /db_xref="InterPro:IPR018047"
FT                   /db_xref="UniParc:UPI00003B6A8C"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FP76"
FT                   /transl_table=1
FT                   /translation="MSYNFTGTPTGHGTGGDSLTTDLNTQFDLVNMTWLGVCTSGVWLM
FT                   VPGIGLLYSGLSRKKHALSLLWASLMAACLVIFQWFFWGYSLSFSHETRGNGFLGTLEF
FT                   FGFRNVLGAPSVVTSVPDIVFAIFQGMFAAVTGALMLGGACERARLMPMMIFLFLWMTI
FT                   VYCPIACWTWNAEGWLAKLGALDYAGSGPVHTASGHGALVYALILGKRNDPVAKKGMPK
FT                   YKPHSVTSVVLGTVFLWFGWQFFNPGSAGNASIRAWYSAMNTNLAAASGGLTWLFIDYF
FT                   RTGGKWTTVGMCSGIISGLVGITPGAGFVPIWSSFIIGVLSAAGCNLAVDLKNVLHIDD
FT                   GLDVYALHGVGGCIGSVLTGIFAADYVNATAGSYIAPIAGGWLNHHWKQVGYQLAAICA
FT                   TIAWTVTITAILLLAMDQIPFLRLRLRPEEEEQGTDEAEIGEFTYQEEQEYIPEPVRSR
FT                   SPGMQPKMSSIDDKITGPQQVIDSKLSESESGSNEAGSNMGEKQTV"
FT   CDS_pept        complement(571225..572331)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000066113" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20196342"
FT                   /locus_tag="CAGL0J06050g"
FT                   /product="Strain CBS138 chromosome J complete sequence "
FT                   /biological_process="cellular amino acid metabolic process "
FT                   /protein_id="CAG60920.1"
FT                   /db_xref="GO:0006520"
FT                   /db_xref="HOGENOM:HBG123630"
FT                   /db_xref="HOGENOM:HBG203788"
FT                   /db_xref="InterPro:IPR006034"
FT                   /db_xref="UniParc:UPI00003B6A8D"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FP75"
FT                   /transl_table=1
FT                   /translation="MKFQVALTSLLAAAAVASPVEDLFKHKAKKSSTSSVHPSSTTKGK
FT                   PTSSAHAKALPSSLASLLANTTGNASNMTNSTVAPQKQQLQVIYTGGQVAIPSTNATNT
FT                   TAFSTNSTALFNTTSALNITELYSVAATINQTLADNSTKGAVVVANAKSLESLGFLTSI
FT                   VLDSKKPIVISADEKMALAVANETAAWNRGPLVVSKEGLVYAGIFTPSSANAVGLPVAV
FT                   IDDAKKVQWFFSPAPPALINSNSTIRVNYTNFTNTDIEFAATPLVPIVYDGGYSSSLIS
FT                   SLASTVQGLVVVSSGSSNSTTSTIESAQIPVVYANSGAPLTPVSSKDVPQNALSAGYLT
FT                   PVKAQLLLSIAAINGVNSDEALMSIFPN"
FT   CDS_pept        complement(574501..576822)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000233033" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18501687"
FT                   /gene_name="CBK1"
FT                   /locus_tag="CAGL0J06072g"
FT                   /product="Serine/threonine-protein kinase CBK1 "
FT                   /EC_number="2.7.11.1"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="CAG60921.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG537393"
FT                   /db_xref="HOGENOM:HBG755340"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR000961"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="InterPro:IPR017892"
FT                   /db_xref="UniParc:UPI00003B6A8E"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FP74"
FT                   /transl_table=1
FT                   /translation="MFGGEYDHAYDANNGQRFQPPVLDAMEFEKPGSPSVGDHFLRQQI
FT                   SNQSLHDQYSSHMEQQQQQQQQQHNAAYGAGFTDIPQLHPSTPPHGLVQKISNGNFHPA
FT                   MNQGGNIPSTSNMNNMFNTPPPTMGNNPLYSHDNNSTNLLQDNLNQARSQFSPDRYSVD
FT                   SDFNNGAGNHVMANGNYNINGSQSSSPYHQPQTFYTNSNLSSGQLSAHRSSPQRQPAQP
FT                   LQQTTFTQLPQPSLPPQQQQQQQQQQQQQQQQQPKFQSMVPPQQTQLQQQQQQELQNAG
FT                   SYMYFERRPDLLSKSTQDKAAAVKLKVENYYQQSVKYAIERNERRVELETELGSHNWSE
FT                   ERNARQLASLGKKESQFLRLRRTRLSLEDFHTVQVIGKGAFGEVRLVQKKDTGKIYAMK
FT                   TLLKSEMYKKDQLAHVKAERDVLAGTDSPWIVSLYYSFQDAQYLYLIMEFLPGGDLMTM
FT                   LIRWQLFTEDVTRFYMAECILAIETIHKLGFIHRDIKPDNILIDIRGHIKLSDFGLSTG
FT                   FHKTHDSNYYKKLLQQDEATTKNGAPNDAGDGSNNRQTMIVDSINLTMSNRQQIQTWRK
FT                   SRRLMAYSTVGTPDYIAPEIFLYQGYGQDCDWWSLGAIMYECLIGWPPFCSETPQETYR
FT                   KIMNFEQTLQFPEDVHISYEAEDLIRRLLTHSNQRLGRQGGADEIKSHPFFRGVDWNTI
FT                   RQVEAPYIPKLSSITDTRFFPTDELENVPDSPAMAQAAKQREQMMKNGVNPNQNQVKED
FT                   LPFIGYTYSRFDYLTRKNAL"
FT   CDS_pept        complement(577278..577484)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21045121"
FT                   /locus_tag="CAGL0J06088g"
FT                   /product="Similar to uniprot|Q3E7A8 Saccharomyces
FT                   cerevisiae YNL162wa"
FT                   /protein_id="CAR58045.1"
FT                   /db_xref="UniParc:UPI00017BD8A8"
FT                   /db_xref="UniProtKB/TrEMBL:B4UN29"
FT                   /transl_table=1
FT                   /translation="MDARVCPQCGELLHRFMIRMKHAVVMCANDKCMYPFNTPGGIESN
FT                   LVYVEGSELLEASTKIEKPPSRH"
FT   CDS_pept        577719..581045
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000231586" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21045122"
FT                   /locus_tag="CAGL0J06094g"
FT                   /product="Strain CBS138 chromosome J complete sequence "
FT                   /function="GTP binding"
FT                   /function="GTPase activity"
FT                   /protein_id="CAG60922.1"
FT                   /db_xref="GO:0003924"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="HOGENOM:HBG156268"
FT                   /db_xref="HOGENOM:HBG737692"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniParc:UPI00003B6A8F"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FP73"
FT                   /transl_table=1
FT                   /translation="MVRVLPETFKRLQSDPTCVRNICIVAHVDHGKTSLADSLLASNGI
FT                   ISQRLAGRVRYLDARPDEQLRGITMESSAISLYFRVLHKQEGKDEPLVNEHLINLIDSP
FT                   GHIDFSSEVSAASRLCDGAVVLVDVVEGVCSQTVTVLRQCWTEKLKPVLVLNKIDRLIT
FT                   ELQLTPMEAYIHLNKTIEQVNSVIGSFFAGERQLDDLSWRERLETNANAEFIEKDDSEI
FT                   YFTPTDNRVIFASAADGWGFNIGQLAKFYEKKMGAKRENLQKVLWGDFYMEPKTKKIIT
FT                   NKNLKGRNLKPLFVSLILDNIWKIYENVIMEKDLDMVEKFTKILDVTLTARDLRTKDDK
FT                   QLLRQIMGQWLPVSTAVLLTVIEKLPSPLESQSERLDVIIGKEYEKEDVDEDLIKDMKE
FT                   CNRNGQLCAYVSKMLSIPRDELPLEDNKNMTADQIIERNRRAREVAMNAAKRAEMLEKS
FT                   KDNSTEEDLYARAKETIITPELDSGTENKTKNDTFQIVTAPAAPLDLGFEYEEDPEAVS
FT                   DDDSDTNGDAIPEFVPGEIDPNDPLSSMFEYEEEDPFSTGATLAETHFEPVSLEELKDD
FT                   DIFDEKDEVLIGFARIYSGTLEVGQEISVIGPKYDPKNPTEHIHTTTITKLYLFMGKEL
FT                   VSLNSCPSGNIVGIGGLAGKIIKNGTIVGNSAKGLNLAGVNLHSTPIVRVAIEPSNPME
FT                   INKLVRGLKLLDLADPCVNIEVEDSGEHILCTAGELHLERCLKDLKERFAGIDITHSEP
FT                   AIPYRETFLNVSGMNPPKNPELGRSVIELKLGKYRMSFRSIPLSDEITNFLTHHERTIA
FT                   RIVSSKSANENIEEQILDEDTFWKKLGSLFEESEGTEELVSYMDKIAAFGPKRIGANIL
FT                   VSNNGILGNVKQHEAPQFEYSDSIINGFLLSVNEGPLANEQVQGMCVVLEDIHEMTENE
FT                   ISEIDDPHYQVDEPNLSGRLITTTRDCIHKSFLDWSPRIMWAMYTCDIQTSVDVLGKVY
FT                   AVVQQRHGKIISEEMKEGTPFFQIIARIPVVEAFGLSEDIRKKTSGAAQPQLVFDGYES
FT                   IDLDPFWVPTTEEELEELGETADKENIARAHMNNIRRRKGLFIEEKVIQNAEKQRTLKR
FT                   N"
FT   CDS_pept        581464..582420
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000066072" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18501688"
FT                   /gene_name="IBD2"
FT                   /locus_tag="CAGL0J06116g"
FT                   /product="Protein IBD2"
FT                   /biological_process="cell division"
FT                   /biological_process="mitosis"
FT                   /cellular_component="cytoplasm"
FT                   /cellular_component="spindle pole"
FT                   /protein_id="CAG60923.1"
FT                   /db_xref="GO:0000922"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0007067"
FT                   /db_xref="GO:0051301"
FT                   /db_xref="HOGENOM:HBG123631"
FT                   /db_xref="HOGENOM:HBG202662"
FT                   /db_xref="UniParc:UPI00003B6A90"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FP72"
FT                   /transl_table=1
FT                   /translation="MSSNNQNTNNTSIELISENGPISLNLMMEEGVKALTRILSNQLND
FT                   TPGTQPMHFIIKKNDKDNKAIDINGDDEEVVELGNESNYHMSDGVQNEAEIILNDQLND
FT                   ILKNHESQLRLDGEEAEIIFDYETQGTVDGSDSIGEKITQMIESVLPNGLGPNTTGKLQ
FT                   AVLNGKELNITEEIHKSDRIEEEEHIEGGLTTAEGNFEVEFETEPLPEDHKHTEENIDG
FT                   HENYNDCCPHHHNNQDNRRRAPKYKNYNYHDYEYTVQHPKTEPNFSALINQKKPVCLFC
FT                   EYYMVFGEPPKNMIKWYNMHYGYNHLPQRNDRHHRNR"
FT   CDS_pept        complement(582568..583785)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000141919" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17440042"
FT                   /locus_tag="CAGL0J06138g"
FT                   /product="Similar to uniprot|P53891 Saccharomyces
FT                   cerevisiae YNL165w"
FT                   /protein_id="CAG60924.1"
FT                   /db_xref="HOGENOM:HBG123632"
FT                   /db_xref="HOGENOM:HBG202661"
FT                   /db_xref="UniParc:UPI00003B6A91"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FP71"
FT                   /transl_table=1
FT                   /translation="MDRVRSLLNSRRVVRVPEDEGERVLLPPQNSVSVESTAEHLYRPH
FT                   VGGDDDDQMTMIDGDRDDMTMHTLLSESSTIGDFQRLGFVNRCPNFDNERVVPFVSVLL
FT                   SRGFYAFASEESYKAYLGNKRKIEKFDVQSELGIPLFHALPSNVVKSMFGSRSTPVMRI
FT                   FKFIVVRTCDANDNEGSTRADVLDFAPQGSELVSELQGTPYSVYKYQFCTIFKAVDTKT
FT                   GKVEHKFAFSKLTSDVKDTVITENVNMTNYMQSRNADTNYAGLNLRWYGSTGFASPFGS
FT                   NNIKLLVLDDSMPSYMTQDTLNDYEQARRAERLRPLGYLPVWARYSDDKVSVIPKKRTL
FT                   RVATLDIKEQNRELSSDNPNTAFGLPWDTQVLTCMCMLLHEYESRKDKRHNATLRSQLV
FT                   GPGMLM"
FT   CDS_pept        584111..585373
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000095246" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17440043"
FT                   /locus_tag="CAGL0J06160g"
FT                   /product="Similar to uniprot|P53890 Saccharomyces
FT                   cerevisiae YNL166c BNI5"
FT                   /protein_id="CAG60925.1"
FT                   /db_xref="HOGENOM:HBG123633"
FT                   /db_xref="UniParc:UPI00003B6A92"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FP70"
FT                   /transl_table=1
FT                   /translation="MLDQEDVKKRMSQIELDINQMNKMIDENLQLGENDGHDSGTEGVE
FT                   GAVGEGVDGQAGPVEPVVTTAAEETSETKDIEHEQVTNEGMAKEVEDASESSVQATEQA
FT                   QDQQAGTNEETNTFKTESMPEPETQAPEVNDLEMKEPEMKEPEMKEPETVEPETVEPEM
FT                   KEPETVEPEMKEPVIKETDALEPEMKHAEIPPQATTEEQPTRHDEWEDVEEEEFNEIDT
FT                   STESNNVIGDTKQVEGSSVLAAGDLRGNVADNGNLTPVTDIDDAESTIFIPKKQNQNSE
FT                   LTEQMKETLRNTRRTTNPFRVISVSSSNSSTNSSRKSSGHDMGLEQTPSEQLKRYEQRH
FT                   YYLTTKCGKIQKEIDYLNKMNSQGTLSIDDSRKLTRAIAKLQEYLDKKNKERYEVGVLL
FT                   SRQLRRDINRGENGEFWIGTK"
FT   CDS_pept        586031..587572
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17440044"
FT                   /locus_tag="CAGL0J06182g"
FT                   /product="Strain CBS138 chromosome J complete sequence "
FT                   /function="protein dimerization activity"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="sequence-specific DNA binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /protein_id="CAG60926.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0043565"
FT                   /db_xref="GO:0046983"
FT                   /db_xref="HOGENOM:HBG123634"
FT                   /db_xref="InterPro:IPR004827"
FT                   /db_xref="InterPro:IPR011616"
FT                   /db_xref="InterPro:IPR020956"
FT                   /db_xref="UniParc:UPI00003B6A93"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FP69"
FT                   /transl_table=1
FT                   /translation="MQNTSSRPSGSLGTVSSFDLEPNPFEQSFASTKKTESGGDGGNIG
FT                   NTNDSAANGDGLDNAKGMASLSYLDSQNNGSSGSLNIDPQIAGDQKRAASLIYGNQRGP
FT                   MQSPPLLTPGGSKKLPPLLMSPSYLQGQSQSGQNGSSHNGSATGGQTPLGGSQGVANGS
FT                   ETDGQLPGFLMNLFKSGLTPNESNLRANFTPGILGSQFNQGSLPSLMNNNVSISRANSN
FT                   SVVPTNGDKDESGSGRKMNGQIDIPNKALTALGGLPAGQLTPGLSSLLASSAKQLNLDN
FT                   NTRESTPNISVSQPVVQGVTKSNSVPTNSYFPLADTTIEKDSGADGADNQSGTQKKRGR
FT                   KKSVSTKATEPKRKRASTSSASKKSEGNTGTATVTNPEANNAVNTGNDDLDEQERRRQE
FT                   FLERNRVAASRFRRKKKEYIKKIETDLGILQTEYNDMSKIIGHLAGITPEGSDDRVSAS
FT                   ILLMLEQSLMNNDIKAALQIIESTKQILTSSNFVKRNGANPVAKNTSHDSSDSGK"
FT   CDS_pept        588083..588868
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000063753" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17440045"
FT                   /locus_tag="CAGL0J06204g"
FT                   /product="Similar to uniprot|P53889 Saccharomyces
FT                   cerevisiae YNL168c"
FT                   /function="catalytic activity"
FT                   /protein_id="CAG60927.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="HOGENOM:HBG419601"
FT                   /db_xref="HOGENOM:HBG729228"
FT                   /db_xref="InterPro:IPR002529"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="UniParc:UPI00003B6A94"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FP68"
FT                   /transl_table=1
FT                   /translation="MSYTYLKDAKKIICIGRNYAAHIKELNNATPKQPFFFLKPMSSVV
FT                   TPVDEKHAIKELPKQASYHGLNDDGTNPGTIQIPKGTVVHHEIEVALVMDKYISNANES
FT                   EFTAADVYDSIRGVALALDLTARNVQDEAKKKGLPWSIGKGFDTFLPMSHMIPKTKFEA
FT                   NKENLQEAFRVTCDVNGTRRQDGNTNLMLYPLHKIIQHISTMMTLEPGDIILTGTPAGV
FT                   GPIAAGDNISGQLYYTDDLLIDFNFDCVVRPGPYEYKET"
FT   CDS_pept        589288..590814
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000282409" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17440046"
FT                   /locus_tag="CAGL0J06226g"
FT                   /product="Similar to uniprot|P39006 Saccharomyces
FT                   cerevisiae YNL169c PSD1"
FT                   /function="phosphatidylserine decarboxylase activity "
FT                   /biological_process="phospholipid biosynthetic process "
FT                   /protein_id="CAG60928.1"
FT                   /db_xref="GO:0004609"
FT                   /db_xref="GO:0008654"
FT                   /db_xref="HOGENOM:HBG070304"
FT                   /db_xref="HOGENOM:HBG395511"
FT                   /db_xref="InterPro:IPR003817"
FT                   /db_xref="InterPro:IPR005221"
FT                   /db_xref="UniParc:UPI00003B6A95"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FP67"
FT                   /transl_table=1
FT                   /translation="MIPVKTVLLKSKTLLSGRMPVRLSNGMQLRNRTAILKRGITNRLS
FT                   NPQRKSNEIVRKARSYASVTTKQKEKYIVSVNMKWAVLTGVTIVLGTLLLTSRRIEEDE
FT                   DSKKDSEGQGKRYKKIRILDNNWLFFCYSTLPLNAISRLWGQVNSYTLPIWLRPSGFKF
FT                   YSYLFGVNLDEMENPNLEDYANLSDFFYRNIRPETRPVAPGDEVIVCPSDGKVLQIGII
FT                   NSETGEVEQVKGLTYSIKEFLGTHSHPLLCKSESTLDLSGHEERHQEFARANKFKVSYS
FT                   SPDLNATKDEEATDVIKFENEGDKTVDEYNTPSISKTMKLLTEVSPNFPSYTSSMTGPE
FT                   ETNLYFAVIYLAPGDYHHFHSPINWVCRLRRHFPGDLFSVAPYFQRNFPNLFVLNERVA
FT                   LLGYWRHGFFSMTPVGATNVGSIKLNFDEELKTNAKRRKIKPHTCYEAVYEKASKVLGG
FT                   LPLTKGEEMGGFMLGSTVVLCFEAPKDFQFHIKTGEKVKMGQKLGSIQKD"
FT   CDS_pept        complement(591163..596457)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000033985" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17440047"
FT                   /locus_tag="CAGL0J06248g"
FT                   /product="Similar to uniprot|P53886 Saccharomyces
FT                   cerevisiae YNL172w APC1"
FT                   /protein_id="CAG60929.1"
FT                   /db_xref="HOGENOM:HBG059349"
FT                   /db_xref="HOGENOM:HBG202658"
FT                   /db_xref="UniParc:UPI00003B6A96"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FP66"
FT                   /transl_table=1
FT                   /translation="MNFKEDFSLFKKCFECSDDDLGDLWVSPDRRTVEWLVGKGTECRR
FT                   RFTFNSSAVVRAGFTKFENLQTKCLIIVLRELAYVYYIANESSESAKSDSSTICFPFPI
FT                   KDAFMYQNGIILERDDMLSLEPGSGGKSIFSEENSGRTSIEQQFISLSDPLAPFGTLVF
FT                   INEDDTILTSSGKRRNTREIDTVDGNILFKKKRRTCSPNEYTKELENSEQTCLASSRVR
FT                   HPLKMMTFPKNSGLSITVLYDSEELNLQFYYTRILGDNARTENTLSDYKNSNSAGQNSH
FT                   LQISKPRTISKLEASQQLENRHQYSNDLRKLSLMNRKVTPNAGLPVDVQLKSPADFFQE
FT                   VNVSHQQLSSSTLKRNDSSTMDRLGINGNESLLKNHPNSSVRVSSSTMATTDTMSSETS
FT                   IKDVVLTKISTVKLPESLRNGEGGINIKCLPLKYENMEGVLIFDTEKGYYKLWFIDMIP
FT                   EVINSNSFLLYGTFPQLMIQLKNLPKVDFGNILDFQPTNSSEYRLDGCVFAITEEKTYI
FT                   MNPYLDIYYEENIMAIRRMEMVSKEQLIVHQFPSTFVRYFTLYDRCPKRLLLREIFLSF
FT                   RYICDSKFYQLLVFFWFQISLEYVNSKENLDVFDCEWECFKVLISSLMSPDSLTSLPSL
FT                   RNSRILNSLERMDVGVTFPKMVMGLHLLREETILNIYRRRDTDDMGSLIGAITTILEWP
FT                   SQWDDYYQDYKGLKAIPCCLNLSSNIVNGYVKPLDAPTSILGSLSSLSDKDVNTIVPFI
FT                   EFSRLVEMDNKVNELITPRTFKVTRLFESLNNISPKSHFLKVLTKFKMNREDLQSYPPG
FT                   LFKPMVEALQLFENNFAEIEEDVDVGLISRADLARYSSILKEKMTWKGSNESALKTDIK
FT                   ASPLLNAKSTKSILSVLSDIVLSSESQLSKDILLDQNASEDIDDGVNLKKNSSLIFSED
FT                   RRFNDAMTLLSFSKVQKVPFFSTDSEYSKILSKKKKIAEIIALRSCAQGIGWAMVVFAT
FT                   EKPLSTQKWVLRPINFSVSFPDETVINVDKDLIPSDIIEWGEFHAGVSSGLKISRKTKG
FT                   VNGSWIVFNKPKDVSASHAGFLLGLGLNGHLKELEEWHIYNYLSLKNTHVGVGLLLGMT
FT                   ASMRGTMDLTLTKILSIHIASLLPKGANDLNIDIRVQTAGLVSLGLLFLKSQHKKMTNI
FT                   LVDQLESLVLINEEYVANEGYRMAAGIAIGMINLGAADNFTKSCGTEEHKKSRSNLVED
FT                   DLDSSYNLPEIQDSAYFTSLTDGLLNKLKFHSEAEKSELPQNSYIGRLLAIMLIYLKSE
FT                   NADVADQVKPKIIFGFERSSCRPEFYMFSEFAYRMIMWDSIHDSVEFLMEELGVDILDS
FT                   CLKSDHMQIYYILSGRILSLGLKFASTGNLRIKEFLLSLFDQLLPFYQYPGRDSVDFKL
FT                   VVTSINVLLNVIMVSLSMVMSARGDLDVFKRIRYVHEVVFGSSSDIYHRKESKSQNNWD
FT                   HSDANTINNQAVGSSRRSSLNGFEEVVEGGSAGEDTVPPNFDQPDTDNHYAKYIATSLS
FT                   IGFLFLGSGQYALKNTDKESVAYLILSTLPLFLPPYYLQELRHFWSLAVESRCLLVKDA
FT                   TTDKMVSGVDIRVLTKSANSQKLNEQILRTPCLLPEINAIKAISLISNDYYPLHIDFSK
FT                   NISASKLFKNGTILYVQSKKESSYPNGASDYRTRNNTDVVDLSLSKKIEKRLRFDKIMV
FT                   QPASSILSLLHIKGKDLQDPLNEFEDSSICSRNSKFDLELIQNNRRVSSISNDDLAIWW
FT                   KLYEEAQH"
FT   CDS_pept        complement(597098..599275)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17440048"
FT                   /locus_tag="CAGL0J06270g"
FT                   /product="Similar to uniprot|Q12027 Saccharomyces
FT                   cerevisiae YDL176w"
FT                   /protein_id="CAG60930.1"
FT                   /db_xref="HOGENOM:HBG123635"
FT                   /db_xref="UniParc:UPI00003B6A97"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FP65"
FT                   /transl_table=1
FT                   /translation="MSRTITLAVSTPSNKKGNTSTYCILDNKDGKFTRIRRSSNFGDES
FT                   VDSSVLAFCYLVPKDRSLYGNQKPSQRAEKTNNPVEGDCTSNINSEVEENETNFPNFDL
FT                   KDDSDYMLICRSNGIIEVVKDYRQKIYQNSSLCPQFLWKCFPDDIDPTGDFDFSIANLS
FT                   YFKGLLYCCTTSGKVYIFILNLPEDYIQVENLISNSDSNKIKDMKNDGNGGTTAARNIS
FT                   PDEDEFFKLTQYRYCGKTDDICYFLIPIDEDTRNSILGQQKYTASYSGAIMYKSSGYNR
FT                   LDQGIANFQINPLDRLSFIVSAQRSPLMIRKVVMTRIFVIFLRTYLKKKLECQSNQYLQ
FT                   SSSLIFNLDNDIANMPQIDHRLWNSIIQLSGTAPLQSIIVWKQKFGGRKDEIDKLLHNI
FT                   ADNQNVELAENLSISTRPLSRGNLMVNRSQDSLFRRINYMSRQLTEKKVDTLLKSLKKN
FT                   TFPIDFCAVQLRQESQQHIFNGSYTFNDEPPSDVEDDVIVSFLTDKYRNLDIYSIEKFL
FT                   KFHVFRPRLMNEPLVEINVYPNHQYSEFSNTKDSRERFDEILSQVCSFKKLFVLTEKII
FT                   LIIGSGGVLLLDRSLLKYMNHLSDNPIESICIIKIDLGLLNDAILLVDRFETCKDCSGV
FT                   LLNFQLITTNLSGEINSYNCMMRPHSRIGSYECTDSIQLTKVGKFVDKLIFITDFKEQV
FT                   SSRKRSQSDIEMGQSRKKQRSLSDNFVISSI"
FT   CDS_pept        599887..600336
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000111146" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17440049"
FT                   /locus_tag="CAGL0J06292g"
FT                   /product="Similar to uniprot|Q12257 Saccharomyces
FT                   cerevisiae YDL177c"
FT                   /protein_id="CAG60931.1"
FT                   /db_xref="HOGENOM:HBG301583"
FT                   /db_xref="HOGENOM:HBG667381"
FT                   /db_xref="InterPro:IPR001498"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniParc:UPI00003B6A98"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FP64"
FT                   /transl_table=1
FT                   /translation="MDWNVSDVVTDKKSKFQARCCFLRDQKDIPDILQGMIQSDKHIAK
FT                   ASHMHMYAWRTGTEELKGNEKQTKKKNNKKQDEVVQLKNVQQGSSDCGEAGAGQRLLTL
FT                   LERSNAFNVIVIVTRWYGGTPLGPARFRHICSAALQSLRIGGFVP"
FT   CDS_pept        complement(600516..602147)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000230997" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21045123"
FT                   /locus_tag="CAGL0J06314g"
FT                   /product="Strain CBS138 chromosome J complete sequence "
FT                   /function="flavin adenine dinucleotide binding "
FT                   /function="oxidoreductase activity"
FT                   /protein_id="CAG60932.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0050660"
FT                   /db_xref="HOGENOM:HBG257711"
FT                   /db_xref="HOGENOM:HBG553036"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016168"
FT                   /db_xref="InterPro:IPR016171"
FT                   /db_xref="UniParc:UPI00003B6A99"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FP63"
FT                   /transl_table=1
FT                   /translation="MMLKCGRQYRIVSKNASRVLNSTAVSGRNRLGLYMQPLLTMAAYT
FT                   RTYSSKLPPRLTAETYPEVKRDGRFKSLAKDDIDYFKSILSETELLEGNDSNDSLAAYN
FT                   EDWMRKYKGQSKLLLKPKTVEQVSKIIKYCNDNRLAVVPQGGNTGLVGGSIPVFDEIIL
FT                   SLANLNKIREFDPVSGIFKCDAGVILEAANEYLEKNGYIFPLDLGAKGSCHVGGVVATN
FT                   AGGLRLLRYGSLHGSVLGLEVVLPNGKIVNSMHSLRKDNTGYDIKQLFIGSEGTIGIIT
FT                   GVSILAPPKPKFTNVCFLSLEDYESVQKVFVKARQELSEIISAYEFMDNKSLSLTKDHL
FT                   EGVPFPLEDEHPFYVLIETSGSNKEHDDAKLEAFLELAMEEGLVTDGVVAQDETELANL
FT                   WQWREMIPESSQSNGGVYKYDVSLPLKSMYSLVEAVNDRLTQHGLLGEAPKPVVSAIGY
FT                   GHIGDGNLHLNVAVREYTKEVEKCLEPFVYEFIQRHHGSVSAEHGLGFQKKNYIQYSKT
FT                   PEEIEMIKSIKNQYDPNSILNPYKYI"
FT   CDS_pept        complement(602954..603898)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17440050"
FT                   /locus_tag="CAGL0J06336g"
FT                   /product="Strain CBS138 chromosome J complete sequence "
FT                   /function="protein kinase binding"
FT                   /biological_process="regulation of cell division "
FT                   /biological_process="regulation of cyclin-dependent protein
FT                   kinase activity"
FT                   /protein_id="CAG60933.1"
FT                   /db_xref="GO:0000079"
FT                   /db_xref="GO:0019901"
FT                   /db_xref="GO:0051302"
FT                   /db_xref="HOGENOM:HBG123637"
FT                   /db_xref="InterPro:IPR006670"
FT                   /db_xref="InterPro:IPR006671"
FT                   /db_xref="InterPro:IPR011028"
FT                   /db_xref="InterPro:IPR012104"
FT                   /db_xref="InterPro:IPR013763"
FT                   /db_xref="UniParc:UPI00003B6A9A"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FP62"
FT                   /transl_table=1
FT                   /translation="MFETPPYCGLNPVEYEILVRFLKRNVTYEMLTFLISKTNSMIKIK
FT                   KTNSPKPVELSLFVEELVASSKVQASTLMATAVYLDRLSRIIPSNVCGIETTKHRMFLG
FT                   CLILSSKSLDDSSLFNKHWTKYCNGLLTLKEVNSIERELLSYFNWDINIQIEELYNTLE
FT                   PILKPIREEMVTRRYTLYLPTPSSSPGKIDGRIKLSSHPVLQKQIAEEISTYLDDASPV
FT                   SSISTFYDSESPTSMQSGHNGRLYLCDNCSTPALGNSTVSSEYVLDSSNQRKRGHSSDL
FT                   KSTKSEEEESNLEYLFKRDKKLVRWNNRWSMVF"
FT   CDS_pept        complement(605140..606867)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000141778" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19349513"
FT                   /locus_tag="CAGL0J06358g"
FT                   /product="Similar to uniprot|Q12301 Saccharomyces
FT                   cerevisiae YDL180w"
FT                   /protein_id="CAG60934.1"
FT                   /db_xref="HOGENOM:HBG123638"
FT                   /db_xref="HOGENOM:HBG203288"
FT                   /db_xref="UniParc:UPI00003B6A9B"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FP61"
FT                   /transl_table=1
FT                   /translation="MVRISSAASYFMPLLCSKKPSVVVSAVFVVTLIYSLAYLSSTILP
FT                   NAYDDPNMFAPNSQDYFRTFLLGFFSPCLLYLTRSFLLSVNPNQRFINLILDFPINDSF
FT                   LLLIIIGLAYPQIQDGHGIHTKNDGDDASAVQWHIIPKQSYIFGISWSLSEFIICAISN
FT                   LFEFQEVSIAGQLNSKEDSEIDVLNRKNSLNRENITLSKCIGVRRKSSTISNNVYTNDA
FT                   DPEVSTSKYGTLTYMDYTSWDKFRKSNFNSDEYGREANKNITTDKTGRDPLIIINPKDN
FT                   SLRITSLNREGNHLEFEESEPIFKDKRGFTWVRWKEDNYLENQGNMLDSDTTSIRHANV
FT                   IERLTSNGGQKSYFTLKGYGHLGKNFFIMSVVIFSNIWMTIGQSLLMSIYFIYVRGHEK
FT                   LFSDTVIFFGSKDITYFLLVVFIPFVSMNFLINTYIYLQDTLVEWFIDPYFNMNGGIGA
FT                   SLNNQYPYYPIVENSLLFPNKKRVSTANSKPTRQDLTSSYDSALLMESAMLYGSHNNAD
FT                   DYDANDPKPLKLAKRMIIKWKEISASDQFVLSAMFIWGLSVFVCGLFATIPSFNIPSR"
FT   CDS_pept        join(complement(608179..608292),complement(607459..607665))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000229898" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21045124"
FT                   /locus_tag="CAGL0J06374g"
FT                   /product="Similar to uniprot|P10622 Saccharomyces
FT                   cerevisiae YDL130w RPP1B"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translational elongation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="CAR58046.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006414"
FT                   /db_xref="HOGENOM:HBG631105"
FT                   /db_xref="InterPro:IPR001813"
FT                   /db_xref="UniParc:UPI00017BD8AE"
FT                   /db_xref="UniProtKB/TrEMBL:B4UN30"
FT                   /transl_table=1
FT                   /translation="MSDAAISYAAFILADAGLEITSENLQTLTKAAGANVDNVWADVYA
FT                   KALEGKDLKEILSGFHTAGPAVGGAAAAGGAAAASGEAAAEEKAEEEAEESDDDMGFGL
FT                   FD"
FT   CDS_pept        complement(609450..609731)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000183772" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19349514"
FT                   /locus_tag="CAGL0J06380g"
FT                   /product="Strain CBS138 chromosome J complete sequence "
FT                   /function="enzyme inhibitor activity"
FT                   /biological_process="negative regulation of nucleotide
FT                   metabolic process"
FT                   /cellular_component="mitochondrion"
FT                   /protein_id="CAG60935.1"
FT                   /db_xref="GO:0004857"
FT                   /db_xref="GO:0005739"
FT                   /db_xref="GO:0045980"
FT                   /db_xref="HOGENOM:HBG429440"
FT                   /db_xref="HOGENOM:HBG738366"
FT                   /db_xref="InterPro:IPR007648"
FT                   /db_xref="UniParc:UPI00003B6A9C"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FP60"
FT                   /transl_table=1
FT                   /translation="MLRLNAINTLKQSKSVTPACQTAMRRYSNIPPPVGGFSSTGQSDT
FT                   FNKREKAAEDYFIKQHEKEQLKNLREQLKHHKEQLQDLEEKIEKITKN"
FT   CDS_pept        complement(610975..612270)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000046858" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20196343"
FT                   /locus_tag="CAGL0J06402g"
FT                   /product="Strain CBS138 chromosome J complete sequence "
FT                   /function="transferase activity, transferring acyl groups,
FT                   acyl groups converted into alkyl on transfer"
FT                   /biological_process="carboxylic acid metabolic process "
FT                   /protein_id="CAG60936.1"
FT                   /db_xref="GO:0019752"
FT                   /db_xref="GO:0046912"
FT                   /db_xref="HOGENOM:HBG262099"
FT                   /db_xref="HOGENOM:HBG701974"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR002034"
FT                   /db_xref="InterPro:IPR011872"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniParc:UPI00003B6A9D"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FP59"
FT                   /transl_table=1
FT                   /translation="MTANNNPYAPSPTDYLSNVNSFQLIDSTLREGEQFANAFFDTEKK
FT                   IEIAKALDDFGVDYIELTSPVASEQSYKDCKAICNLGLKAKILTHIRCHMDDAKVAVET
FT                   GVDGVDVVIGTSKFLRQYSHGKDMNYIAKSAIEVIEFVKSKGIEIRFSSEDSFRSDLVD
FT                   LLNIYKTVDKIGVNRVGIADTVGCANPRQVYELVRTLKSVVSCDIECHFHNDTGCAIAN
FT                   AYTALEGGAKLIDVSVLGIGERNGITPLGGLMARMIVAAPDYVKSKYKLHKIRDIENLV
FT                   AEAVEVNIPFNNPITGFCAFTHKAGIHAKAILANPSTYEILDPHDFGMKRYIHFANRLT
FT                   GWNAIKARVDQLNLNLTDDQIKEVTAKIKKLGDVRPLNIDDVDSIIKDFHAEITTPQLR
FT                   SINGQARTSAIDLQSLDTVEENEPAQKKARVD"
FT   CDS_pept        complement(614059..616977)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000224130" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17440051"
FT                   /locus_tag="CAGL0J06424g"
FT                   /product="Similar to uniprot|P53091 Saccharomyces
FT                   cerevisiae YGL201c MCM6"
FT                   /function="ATP binding"
FT                   /function="DNA binding"
FT                   /biological_process="DNA-dependent DNA replication
FT                   initiation"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG60937.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006270"
FT                   /db_xref="HOGENOM:HBG409874"
FT                   /db_xref="HOGENOM:HBG546212"
FT                   /db_xref="InterPro:IPR001208"
FT                   /db_xref="InterPro:IPR008049"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR016027"
FT                   /db_xref="InterPro:IPR018525"
FT                   /db_xref="UniParc:UPI00003B6A9E"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FP58"
FT                   /transl_table=1
FT                   /translation="MSSPFPHDEETRGGPSSQPASSLGGFGSSSGFDESQVGSRLQFPS
FT                   SSQPHVPDSVGSNIPGIRDSSARDSSQFSSQRPYENEPEHEENEDMPMQGWRKRTFNHI
FT                   KKVEDVTGEKVREAFEQFLDEFTIQSSDTGELQKVYRAQIEFMKLYDLSTLYIDYQHLS
FT                   MRENGALAMAISEQYYRFSPFLIKGLKRVVRKYAPELLLTSDSVKMQNEDDDLSTIDPS
FT                   SMPRDSENSQQATKSTTTNSPEQTERLFQISFFNLPTVHRIREIRSDKIGSLMCISGTV
FT                   TRTSEVRPELYKASFTCDMCRAMVDNVEQSFKYTEPTFCPNPACENRAFWTLNVSRSKF
FT                   LDWQKVRIQENTNEIPNGSMPRTLDVILRGDAVDRAKPGDKCQFTGVEIVVPDVSQLML
FT                   PGVKPSSSLDTRGIARSSEGLNSGVTGLKSLGVRDLTYKITFLGSHVVSVGSNMNPNEN
FT                   SSAETNLQFISKLQNNDIYSDREKDQEIFLSSLSPDEINELQDMVKDDHVYDKLVRSIA
FT                   PSVFGHEAIKKGILLQMLGGVHKTTVEGIKLRGDINICIVGDPSTSKSQFLKYVCRFAP
FT                   RSVYTSGKASSAAGLTAAVVRDEEGGDYTIEAGALMLADNGICCIDEFDKMDISDQVAI
FT                   HEAMEQQTISIAKAGIHATLNARTSILAAANPIGGRYNRKTSLRANLNMTAPIMSRFDL
FT                   FFVVLDDCNEKIDTELASHIIDLHMKQDEAITSPYSAEQLQRYIKYAKTFKPVINKEAR
FT                   KFLVEKYKALRKDDAQGYSRSSYRITVRQLESMVRLSEAIARANCSDEITPEFVAEAYD
FT                   LLKQSIIRVDVDDIEIDEDPEEPEEIATDVQAAIVQENTDQQKSDKQKVVVTYEKYVTM
FT                   MNMIVRKISEVEKNEGAEMTATDIIDWYCVQRENDISSEEEYYAERKLAYKVLKRLVKD
FT                   RILMEIHGTKDNLDDDEDHDGNGKIVYVIHPNCEMFDTAQDA"
FT   tRNA            complement(617289..617360)
FT                   /gene_name="tRNA-Gly (TCC)"
FT   CDS_pept        complement(617932..621129)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000179930" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19349515"
FT                   /locus_tag="CAGL0J06468g"
FT                   /product="Strain CBS138 chromosome J complete sequence "
FT                   /function="catalytic activity"
FT                   /biological_process="trehalose biosynthetic process "
FT                   /protein_id="CAG60938.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0005992"
FT                   /db_xref="HOGENOM:HBG059172"
FT                   /db_xref="HOGENOM:HBG325476"
FT                   /db_xref="InterPro:IPR001830"
FT                   /db_xref="InterPro:IPR003337"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniParc:UPI00003B6A9F"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FP57"
FT                   /transl_table=1
FT                   /translation="MTIIVASLFLPFQPQFEVNADQEQTAELVDSKLVKISGEQEAHAN
FT                   KNLPDVRVQETDAYATAATQPFLNSRTPLALSSAASQLNVKQGPLSSEQFLENLTANAT
FT                   TAGTPVNPNLGVHGHASAEDFFTTNNSTAINNNASSPPFSVSSIAPEINANVDGTDTMD
FT                   VTADLLDNVNKSLLLHSVLNSGQGVSSPNAVEGHTATHLTNPNTTVITPKSRAVPESNP
FT                   GVVNFDNYKERRDSQSNSAFPSMKRVASGSHGPSHLKYSQNAIDAALESDVIDDADDRQ
FT                   NSEAESDYETDRKVHYNVPGFGGYSSTSKRLKNSLEIFSRVPWKIVPSRKGNGALKNAI
FT                   NTSILEKDIKDGVKWVGTLGIPTDEIPVETTKKIVKDLNENYQSSAVIADDVTFKGAYK
FT                   NFCKQILWPTLHYQIPDNPNSKAFEDHSWNYFQRLNQYFAEKIVSIYEDGDIVWVHDYH
FT                   LMLVPGMVRQKLPNAKIGFFLHVSFPSSEVFRCFAQRENMLEGILGANFVGFQTAEYAR
FT                   HFLTTANLLLTADVSGDHLRYKGKVVSVKSTPIGIDAFDLANQLLTDPVTKWRQLIRQR
FT                   WAGKKLIVCRDQFDKIRGLHKKLLAYERFLRENPDYIEKVVLIQICIGKSSDPELERKV
FT                   MVVVDRINSLSISISVSQPVVFLHQDLDFAQYLALSSEADLFLINTFREGMNLTCHEFI
FT                   VCSREKNSPLLISEFTGSAELLKDGAILINPWDTRHLAKCIKMGLEMPLDERKRRWKIM
FT                   MKSLINNDSTNWIMSNLQAIEHCWEFSKESSTLFSLSSEELASEYQSASNKLFILKISE
FT                   PPSPRMLAILRELSSRCTVYIMNTFSKTTLENLYGRVGNLGLIAEGGAYVRLNGTWYSI
FT                   VDHVDWLEEVTKILDTKIERLPGSYYKLADSMVRFHTENAEDQDRVASVIGEAMTHINT
FT                   LFADRGIHAYVHKNILFVQQKELSLETTKFILKFHNSGKVYNTGHSTPSKHNNEMSAMF
FT                   SGQSDTIDFICVAGSTSPTIEPIFKLVKDATLAGNLRYGHTIVYGDAPSTYAREHTSGW
FT                   NELFNIFQDLAKSNERQ"
FT   CDS_pept        621951..622415
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17440052"
FT                   /locus_tag="CAGL0J06490g"
FT                   /product="Strain CBS138 chromosome J complete sequence "
FT                   /protein_id="CAG60939.1"
FT                   /db_xref="HOGENOM:HBG123639"
FT                   /db_xref="InterPro:IPR003892"
FT                   /db_xref="UniParc:UPI00003B6AA0"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FP56"
FT                   /transl_table=1
FT                   /translation="MDLSTKVFLGLLVAFILVVKRYLNQPTHKNINKTVDISNDGEEID
FT                   KDVLVSGKDQKTVKRRRKRRVTEGMIEIVSTLAPHLDVEQIKYDLEKTGSVELTVERLL
FT                   KGEEFEFPPKEDESSTANNSKSNEEPQNEEDYYEDYHTETDSSDSEDDDD"
FT   CDS_pept        complement(622640..624277)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000183312" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18501689"
FT                   /locus_tag="CAGL0J06512g"
FT                   /product="Similar to uniprot|Q04199 Saccharomyces
FT                   cerevisiae YML102w CAC2"
FT                   /protein_id="CAG60940.1"
FT                   /db_xref="HOGENOM:HBG117507"
FT                   /db_xref="HOGENOM:HBG715018"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="UniParc:UPI00003B6AA1"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FP55"
FT                   /transl_table=1
FT                   /translation="MEATNLQIYWHESQPVYSITFRGSQADDDNDDENFNEKGELFTAG
FT                   GDNKVRLWRLNCEETGKGTCKVDTIDFLSGLSLHEQAVNVIRFDHRGNVLASAGDDGQV
FT                   LLWKLTNEETRKKQQRMGDEPVEGDGWAVWKRLRGTANDLDNMPGGGASEIYDLSWSPD
FT                   DKYLVTASMDNSLKVFNVDTGNCVAFAKDHNHYVQGVTWDPLNQYIISQSVDRSINIYE
FT                   IELRDSKDITSSTTSTELIKRLKLKNRIFKSELPFIDEDASSRKIDYSVQKSSYLYHNE
FT                   TLPSFFRRLVMSPCGSLLVVPTGLIKNHPTSTSIGTKDDGEESSQSNSINTSASSDFNN
FT                   AVFIYTRAAIKQNLGKPSICLPFFKKPAVAVAFSPIFYERTSNKPYVDLPYKLVFAIAT
FT                   INQVIFYDTENIEPISIVSNLHYTPLTDLTWSPRGDMVMVSSTDGFCSAISINTAVFGR
FT                   RTKKPSFTNTIVKEEISLNREDASEVKQPKRSHDIINILPVRKKSKVDTNKSTTDSAST
FT                   PDATGNDKENKDDAKTLEIIKNTETENS"
FT   CDS_pept        625604..630616
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000113877" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19349516"
FT                   /locus_tag="CAGL0J06534g"
FT                   /product="Strain CBS138 chromosome J complete sequence "
FT                   /protein_id="CAG60941.1"
FT                   /db_xref="HOGENOM:HBG059176"
FT                   /db_xref="HOGENOM:HBG203462"
FT                   /db_xref="InterPro:IPR018864"
FT                   /db_xref="UniParc:UPI00003B6AA2"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FP54"
FT                   /transl_table=1
FT                   /translation="MMAMTMEYRDVAGFLNSIEDDAINKEHINAVSAFLEKNKRQLLEL
FT                   QLGSNESTKHNDNNDTKRIIARKILGYDYDFEGSNEYNLNEFLEKELLERNSMVDIMVD
FT                   LNTRRHICDRYIPDLNVNNAKNEDSLTGRISTVIDVLLNTLTATNSVDECVLQCMDHLE
FT                   ELHLDNEDTIQDIIDLIINYNILYCFKLLKLLTLYIINRNVAVSLTQKWFSNFSEIVNQ
FT                   VTLISSTHSNRRFLDNTERSMVDTLFIAKLESTISIVSIVFLGLSSAREDSNLNMDTDF
FT                   LHDVATFELVHSVLLDEMHKKRMPIVLYMWSFILCAKSIIAEDDSDEITSINELDFIRK
FT                   CFPQDSIHSMSILFAKNAEDIGLLAKFLETSNCIRNDNIFTTLFASFMTLSVNFIPFTA
FT                   STTKIIKSVLNDLPRGVIENFISNNAFITKFDTIKAKLPLIDEGLLPFINLTSINEELA
FT                   EFNWEAFGSYAVKMPLGSIDYDVADRSNSNDSSTLEQIQLSSEVLVKPPFEQDDDVLMP
FT                   LPKSTKAFIVADVPAITSGKEHTKDSIVKYNSEDGSSNFTTNNVTNETLLVFDYQYNGW
FT                   SLLGRILQNLSILYTVKGNDINYEQKEFMIAAISLLSNIMSSTIPVDHSIKILESLSSQ
FT                   LSKPRDDDIISVVFKIFERALHKRNYELLCICASFTNVLVRRFPHFVWAYLSTSDLLDH
FT                   YGKSGLVNIILGSIELTNGEYDFTISIAKMTVGLIDDAVTTSLYSDSGVPLKTKKSILS
FT                   NLIVHLLNVYESFQFWKYSKSIEQRFELSLELTKAFSKILYFVHGIDSETPPENKITNV
FT                   LSKAADTITNAFLVPDSYDPPVVISLINTITSPKNKTIYIFGNGLFDELYDHVVQKAYD
FT                   LANLLVSIRGVSKLNASSLERMLFCQSPKLIDIYLTKPTLKISIVKLLNSLVGVPWSSE
FT                   YPFLYSYLGHTYSEKFLSSIIKDLTTTLQDYQLAKTLYVFFGTLIRSKQDGLSILFLTG
FT                   RAPDKAISSSLKNTSKDNQISILNVLKNNAKKMDQYPETTCCYLLEAISYAFNTWSNAR
FT                   NLDEDNDFIVSLLNKLENLMDATVGTNSSDDSQVTHDKELKRRYKLIARIVEIFALYIF
FT                   TSKNPNSDLMSLLESDKIVPHLQKFFLIEGYQSDLQTNLEKNISEIWNKAELSMFALSP
FT                   IAKTFINFDDNIFDISILDQCLGNDSSWTGTDSIRNQIIDASSNLQSTVAQVAAAKSWG
FT                   ALITAFIKRKNSIVPECYMSLLSDLLQYNIEYGVEAPIFTDVYMERLELVFFFLYNIHN
FT                   NGQQLPDKNIQKLLAQLLEILKSPEVNFLTNIPENTGSLLYRPILRSILLLLSMVKDGP
FT                   QFVELNADLLIQTNEESFCKGLYLLFSNILSEINSMKATSGQYSIANIDEKIQDISLLL
FT                   NIVVKTQELNPSSEFNSIFASSLYEVGTLQVMLNLYSSSHLYLVNDEPILGQLSLSIIA
FT                   ELCMIREVAEKLITNGLFTVLVESPLSVALQRNAIKTSSQPRIHYIWSNGLLSITLILL
FT                   SNFGSKILPETYLFISYFSNQIGNVLSSWFDSNMSVSTALVNETKQIILLQKMLEAINK
FT                   VNSVSTSRNNSTVQNPDNVKQIPGLVSEQDYKQLNSALKKLLTHPKYLNSRIVASTTDE
FT                   QHMLEEISRRNELSTIISNQIKEIQDLLFETL"
FT   CDS_pept        630978..634214
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21045125"
FT                   /locus_tag="CAGL0J06556g"
FT                   /product="Strain CBS138 chromosome J complete sequence "
FT                   /function="phosphatidylinositol binding"
FT                   /biological_process="cell communication"
FT                   /protein_id="CAG60942.1"
FT                   /db_xref="GO:0007154"
FT                   /db_xref="GO:0035091"
FT                   /db_xref="HOGENOM:HBG123640"
FT                   /db_xref="InterPro:IPR001683"
FT                   /db_xref="InterPro:IPR003114"
FT                   /db_xref="InterPro:IPR013937"
FT                   /db_xref="UniParc:UPI00003B6AA3"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FP53"
FT                   /transl_table=1
FT                   /translation="MQKLPSVFGFAILLFVPSLFRNGLLILCILSLAIIFLLCSIIKLQ
FT                   NFITGSHFKSKRINEIVSCHKNILPNNVATYKSKFITIDKYPRTASEIREIIEFIVTDF
FT                   IQSWLLRIEKDNDQSLPNLIQSLLENTTDKIATIQADKNIVDIISTKCIPKITKHINIY
FT                   KRCVTTEANLKRQTTLHKNSLHLAVEFNKYQKFHRNVSLRNHILDDSVKNYCLDKAQLI
FT                   QKRILNENEASSTIVSSLVKEILAGSVLYPLINKLINPYDINLQIISMSERILKETKQV
FT                   SRIRQLLNEETDTSGTTEELINNAKVWWLFKELPINNKQYELSLRYITTCGQIVPLHNI
FT                   GYVLLLCFGILDDNIDKKASKQRLLLMLNLVEMRLKTFNSKLIYGPSLSSKVLNSKNSW
FT                   RESTQFVKNFISTITFADIVQQNELILFFEEFLANENNINLKPLLSFICESNLILTPLD
FT                   DSYEEDQSIVEPLAFYRQLKQFITETMIHALRNINAERTDNIMNFMSQNEPDMNIYFID
FT                   CLKSIRFLNNLVENILKQYFEQFKSSASFLNMITSSKFFQTNVYIKGILEFSLRQKSED
FT                   YSQENATNMGTKNSRIDQKLESIIFENGILANDLPKRNVEDSTLANALLDNYDKDKSID
FT                   DIQLSVPQESKELLFRPGLKSFKDIKEAIADLTLKINQTEKEDEILDHLLLKAELINDK
FT                   EQLRILSKSKRAMKKDIERMDVARQLLLIQESSNALYGTTEVSISSFYEDVDEGGKKLI
FT                   TFYLVNVKRQNGDKSTSWEVSRRFNEFAVLYKYLHANYSKKLKKLDLSFPSKIPITENY
FT                   NIAKVDICNERRIKFELFLNQLLQIQEICEDDLFRTFLTNPLSFSINRNPEELPLINNS
FT                   QSYECIPELSLMDEGLRSTDDLVYDNKYLTSHYAKVPTSNETKSTVKIISEFFIAIFSS
FT                   RTNSRWLRGRAIVTLLQQLMGSTIDKYMKEQGDKWSSDSHVSDLLASLKFLLWGPNGTF
FT                   RRPKVDKKEISSNEKRKVEIKAFQMMQTLFIEQFGTFIGYQRSKEASKSLHEMLQNQYL
FT                   NCNLVFELFDDIIDEFLLRKEELETNKITM"
FT   CDS_pept        634596..635390
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000248333" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17440053"
FT                   /gene_name="SEC65"
FT                   /locus_tag="CAGL0J06578g"
FT                   /product="Signal recognition particle SEC65 subunit "
FT                   /function="7S RNA binding"
FT                   /biological_process="SRP-dependent cotranslational protein
FT                   targeting to membrane"
FT                   /cellular_component="signal recognition particle,
FT                   endoplasmic reticulum targeting"
FT                   /protein_id="CAG60943.1"
FT                   /db_xref="GO:0005786"
FT                   /db_xref="GO:0006614"
FT                   /db_xref="GO:0008312"
FT                   /db_xref="HOGENOM:HBG059180"
FT                   /db_xref="HOGENOM:HBG397856"
FT                   /db_xref="InterPro:IPR002778"
FT                   /db_xref="UniParc:UPI00003B6AA4"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FP52"
FT                   /transl_table=1
FT                   /translation="MPKLEEIEDYDDIDNMDMDLAELDPTLNTPIAPKITPTVVRSQDI
FT                   EEEERKKQYAGSNKEMISFINPQTGKVEESAPITKQELDEVKKFQVLYPCYFDKNRSHK
FT                   EGRRVPIEMAVENPLAKTISDAVREYGLLSIFEGDKCHPQDFGNPGRIRVLLKEEGKLV
FT                   PSASKFSGGKRQLMKLVAEYLQKHPTTVESLRELPYGPDFDNIEFKKIPKVKGFKMNDI
FT                   VPLHSPYLWGHPMTKSIYEAPKIEAPEKQFKAPKNKFKVVRR"
FT   CDS_pept        complement(636175..636846)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000037974" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21045126"
FT                   /locus_tag="CAGL0J06600g"
FT                   /product="Strain CBS138 chromosome J complete sequence "
FT                   /function="orotate phosphoribosyltransferase activity "
FT                   /biological_process="nucleoside metabolic process "
FT                   /biological_process="pyrimidine nucleotide biosynthetic
FT                   process"
FT                   /protein_id="CAG60944.1"
FT                   /db_xref="GO:0004588"
FT                   /db_xref="GO:0006221"
FT                   /db_xref="GO:0009116"
FT                   /db_xref="HOGENOM:HBG404341"
FT                   /db_xref="HOGENOM:HBG465843"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR004467"
FT                   /db_xref="InterPro:IPR023031"
FT                   /db_xref="UniParc:UPI00003B6AA5"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FP51"
FT                   /transl_table=1
FT                   /translation="MPLEDYQKNFLELAIESQALKFGSFTLKSGRQSPYFFNLGLFNTG
FT                   KLLSNLATAYAIAIIQSDLKFDIIFGPAYKGIPLAAIVCVKLAEIGGSKFQNVQYAFNR
FT                   KEAKDHGEGGNIVGAALEGKKILIIDDVMTAGTAINEAFEIIAANQGQVVGSIIALDRQ
FT                   EVVGSPDSTDSMSATQAVSKRYNIPVLSIVSLSHVINFLDGRITAEEKQKIEDYLQKYG
FT                   A"
FT   CDS_pept        637316..638311
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17440054"
FT                   /locus_tag="CAGL0J06622g"
FT                   /product="Similar to uniprot|Q03760 Saccharomyces
FT                   cerevisiae YML107c"
FT                   /protein_id="CAG60945.1"
FT                   /db_xref="HOGENOM:HBG123641"
FT                   /db_xref="UniParc:UPI00003B6AA6"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FP50"
FT                   /transl_table=1
FT                   /translation="MQANKLMDLEARLLRLSRELDSYHGHLVHRNEAVPRTAERIVKRR
FT                   KYRSCGPLKSNRFLSSKNMKFRKLYENLVETEKEKTHLQYTLAEILEKYQHLLDGTKYL
FT                   DIEWSKLTNPLTLVANGWSMHRIVDRKAPDAGETHNSLICTCSNCHQLISFNCDKTSMD
FT                   LSDKLALRGWLTDSHLKDCSWRHYQFPLERDYYLNKHNLLAEFLCLQKLNLRATIEVDI
FT                   FYRNSIDQIRYCFNIKDENNLKLFLRGFWSSNPSHTIKDFVTCQYCCCRSALTSLSKND
FT                   HVGHYPWCRYQDQDQLYHLIEDAIHDSSYIVKELPIVARLNKLEKTLEKL"
FT   tRNA            complement(638437..638508)
FT                   /gene_name="tRNA-Gln (CTG)"
FT   CDS_pept        complement(639077..639415)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000141943" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17440055"
FT                   /locus_tag="CAGL0J06666g"
FT                   /product="Similar to uniprot|Q03759 Saccharomyces
FT                   cerevisiae YML108w"
FT                   /protein_id="CAG60946.1"
FT                   /db_xref="HOGENOM:HBG058035"
FT                   /db_xref="HOGENOM:HBG203432"
FT                   /db_xref="InterPro:IPR015080"
FT                   /db_xref="UniParc:UPI00003B6AA7"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FP49"
FT                   /transl_table=1
FT                   /translation="MSNLYRMMVLLEEPMEEDITISDSKEEKKVMHEFMDELTLPFQID
FT                   EIDLLNKWFDKFDDEICIPNEGHIKYEITSDGLIVLILDKELGEEFVGKVKTFVEQNNV
FT                   EDEDEEDA"
FT   CDS_pept        complement(640041..642527)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17440056"
FT                   /locus_tag="CAGL0J06688g"
FT                   /product="Strain CBS138 chromosome J complete sequence "
FT                   /protein_id="CAG60947.1"
FT                   /db_xref="HOGENOM:HBG123642"
FT                   /db_xref="InterPro:IPR013941"
FT                   /db_xref="UniParc:UPI00003B6AA8"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FP48"
FT                   /transl_table=1
FT                   /translation="MSRLEVPKRRSRVQKTDGVSSEYLRAAQSLDQEVQNVKNLKRLSI
FT                   GSIDLITDPELNVTVTGTEREDTSYDADLSNGSFTEEDDTTTEIDGSDADETSASIDRT
FT                   RVEYLTSYDNTQESSNESPKGVARTRSLNLNYHANSNSDISIKERTLRGSRSLSNLKKP
FT                   KNEEQSVSDKLFWVPANQHPNVKPENYLELVKETLNKIRDINTDGKEKSENNSEEEVSN
FT                   KENINENGRLRGSIVRRPSKLRKSYTEFSSEDLELLDKALSNNRIISTRNTTNSKRLSL
FT                   KEITNELVKHSNKAGLTDDNAVTLARTLSIASSVTNQNETGRNDQSNTEQQKQSEDADD
FT                   DTFATAVVGNSHSLASNTSSLRRSKFNTYRVKAGQQRGISRSNYIDSTNRTDNLIARHT
FT                   WETPLKDSYDEHSTSYHNKQHSILDSNIPVVTTVSDDNHDISGSSFSQDSSMVSSDSTS
FT                   NSILNRPEHSYSYVSEKLDREIEKTDQFSNLGSSENKIDEPTVDTKRPSLEHRITGATE
FT                   IKDKNLEQSAISNHQTIQKNTFIEKKERLDKKISNLFKRKKGKKTDNVLEADVPLEKDN
FT                   CYDIISSESQEEIGNVIPRTTSPESIRGGSLISFTNSADDIDVKSYQSDNQQRRLSDEV
FT                   VEYVQELEEDSRELSGSDIFNDLNDEYNRHLEYSIDNSNESVSINQSYSLHTDEPNKVG
FT                   KPKKLTFDDVKKPERANAPMEFTDSAFGFPLPPLTISTVIMCDHRLGINVERAIYRLSH
FT                   LKLSETNRELRQQVLLSNFMYAYLNLVEHTLSVEEAEQDKQSTSSPDNKVVELEGSNYN
FT                   TAHNQSDGTILIPELQ"
FT   CDS_pept        644531..645397
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000249463" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18501690"
FT                   /locus_tag="CAGL0J06710g"
FT                   /product="Strain CBS138 chromosome J complete sequence "
FT                   /function="methyltransferase activity"
FT                   /protein_id="CAG60948.1"
FT                   /db_xref="GO:0008168"
FT                   /db_xref="HOGENOM:HBG463539"
FT                   /db_xref="HOGENOM:HBG559580"
FT                   /db_xref="InterPro:IPR004033"
FT                   /db_xref="UniParc:UPI00003B6AA9"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FP47"
FT                   /transl_table=1
FT                   /translation="MFLTRRSAIAARRLTSNIKLCAWNSTQSNNTTHFGSKTVPVEEKE
FT                   KLVGDVFSSVASKYDLMNDVMSLGIHRCWKDHFIHKLDAGKRPNSTEPLNFIDVAGGSG
FT                   DIAFGLLDYAEEKFHDTESTMDVVDINPDMLKEGEKRAMENKKYYNDPRVNFMVQNGEV
FT                   LDKIPSDSKDVYTISFGIRNFTNIQAGLNAAYRVLKPGGIFYCLEFSKIENPVMDLAYQ
FT                   QWAKLLPVMGSIVANDYNSYEYLVESIERFPDQETFKSMIEKAGFKSVGYESLTFGVCA
FT                   IHWGVKV"
FT   CDS_pept        complement(645658..648627)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000095282" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18501691"
FT                   /locus_tag="CAGL0J06732g"
FT                   /product="Strain CBS138 chromosome J complete sequence "
FT                   /protein_id="CAG60949.1"
FT                   /db_xref="HOGENOM:HBG058302"
FT                   /db_xref="HOGENOM:HBG203519"
FT                   /db_xref="InterPro:IPR007519"
FT                   /db_xref="InterPro:IPR007520"
FT                   /db_xref="InterPro:IPR022794"
FT                   /db_xref="UniParc:UPI00003B6AAA"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FP46"
FT                   /transl_table=1
FT                   /translation="MQSPEKPGRRRRPPLFTLSTDSSINTSNRSNRAENESSNHVKFPL
FT                   SPPRAHHHETELGNARLSEEQERRRASTTNIANMRRKHIKEINVYNTPNPNDLDALCVA
FT                   KSSTELNQMNTDSKDPNMIIDVLPSFEFYNVLHKHIPQGNVDPDIHDFPPTYQEVQTQR
FT                   LPALQGSSSSQSGSELNVESPLRMNGSQTSIHGNFRNSSSNTLLPTTSGIFGGSSLQPY
FT                   STRHYSLNPNQNNPLHPTVSGSTAVNDNTNIEDDVNDADNIAIDKLYSLPKFSTPLEID
FT                   IRITKHVPKPHEKPEEESVLKEFTSGDIIHGYCVIENRSTQPLKFEMFYVTLEAYISIV
FT                   DKQKGKRTIKRFLRMVDMSASWSYSSMQVSSGIEYVPGDVDFDDSILGLSNSRTFLPKT
FT                   KYKKYFMFKIPDQLLDVTCRQEIFPHCSLPPSLGIDKWKDNGKYSIIKVNNVLGCGHLG
FT                   TKGSPILTNDITDENLSINYTIDAKIVGKEKKTSKLNIMREREYNLRVVPFGFNTPSPV
FT                   QSNLRSKSQLKELKRLLNERIAALERVFERLKKNEPIQNADIYGTDISGTIDSETDLDV
FT                   REHLERKLNQLHVRNRIEESDSWSGLKRMSQPDNLVESELRYQIKSRKLNSGTNIANSL
FT                   FSGFKSSSSMSSLKSSSSSSNSETGKILDGSSSHLKKHLKHSDKTGLITLSTTIPTKAV
FT                   KYWSPSLFRKTNTFESKNKHDQENWVRLIDLLSEEEKTPLENVNVKLKCFVSNNGPIHQ
FT                   PPGIQIITTSLICITASSDNSIPIQLSSKLLYNEENVTTLKKTFTDYNKKITEYKALFE
FT                   ENEEKLNILYHGNSMLSQTNRGLKFTDFIPTNLHNDVESLMELHVDVTELHQVFRKQSF
FT                   FTKSTSSNDSYFNFSLSSSETIGNNASSPSEIIDANNSPKPTKSETSASGWRSTGKFTF
FT                   ERDVNVHLSLDPHMKETLPPNFESCLCTRFYVVRVCIKFDHHIGTATLDIPVSVKRITT
FT                   "
FT   CDS_pept        complement(649591..650640)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000112045" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18501692"
FT                   /locus_tag="CAGL0J06754g"
FT                   /product="Strain CBS138 chromosome J complete sequence "
FT                   /cellular_component="carboxy-terminal domain protein kinase
FT                   complex"
FT                   /protein_id="CAG60950.1"
FT                   /db_xref="GO:0032806"
FT                   /db_xref="HOGENOM:HBG058303"
FT                   /db_xref="HOGENOM:HBG203414"
FT                   /db_xref="InterPro:IPR021000"
FT                   /db_xref="UniParc:UPI00003B6AAB"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FP45"
FT                   /transl_table=1
FT                   /translation="MDSFEARLQFIQVIKNLQKSLNVSKEDTDGTLGIGLGSGQSSGAN
FT                   SVSHSGSYSNIQELDDTTIGTQVSKSMSDPLQFYLKHYAHHYEDFHQCLFDTGLKMDPL
FT                   HRLNIVIFYYQIILALVAEMKKRKLDTSSLQATVVYEHLIPSMPRIFEICLPKDDWKAL
FT                   SNLKSCTDIYYNLLRLLKTLPGYQLEMSPEEMTLSEYTMDSEEVIQAMTQPTSELDWKT
FT                   IANDDKPQNVSQSILWTRELLNDRMIKKYVVFKTFVTNGVCNLKNSHNSSTSNNNVSNI
FT                   LHRMENDRERHKRQKENNWVVERVSQSMLDENEFKAAWNSITSLPSLSRSDQKDIRQLH
FT                   TIARGSYLI"
FT   CDS_pept        651309..654392
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000111181" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17440057"
FT                   /locus_tag="CAGL0J06776g"
FT                   /product="Strain CBS138 chromosome J complete sequence "
FT                   /function="binding"
FT                   /function="protein transporter activity"
FT                   /biological_process="intracellular protein transport "
FT                   /protein_id="CAG60951.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0006886"
FT                   /db_xref="GO:0008565"
FT                   /db_xref="HOGENOM:HBG020828"
FT                   /db_xref="HOGENOM:HBG397784"
FT                   /db_xref="InterPro:IPR001494"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI00003B6AAC"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FP44"
FT                   /transl_table=1
FT                   /translation="MSGIMLTELNLVEVLQQASDMQHMGTERQRMAESQLKAWETQPGF
FT                   HFLLQSIYLDLSNGLHVRWLAVIQFKNGVEKYWRATRINSIGKDEKASIRKRLFDVVDE
FT                   QNNQLCIQNAQATARISRIDFPVEWPNLFESIEQLLNINHRKEIQTHNILMHLNQIIKI
FT                   LGSARIGRCRPAMQSKIPLIFSLVVRIYLESFDEWTHSNVADGDILSKLQISYLALKVL
FT                   RRMVSDGYEYPQRDETVCEFMKLSITHFDVLIANHENFKKFDLYEKFIKCFGKLYFNLV
FT                   TASPANFILIPSSSQILISYTSFLLNKAQFVYQENPDVTGDFWEQVAIRGIMIIKRVIN
FT                   FVSKKGAVTIKARSDKPNIDAAITKINNEYLNENLIKKMVDTLMEWYLKLRATELDNWF
FT                   MDPEEWINEQMASSYEYQIRPCAENFFQDLINTFPELLASYLLNKIETSASTLSDSLED
FT                   FLRKDAIYAAFQLSASAVSEMVDFDRLLPTVFLPEAAGSNTPGERLKIIRRRVALIINE
FT                   WSIVKCSEESKNLCYKFFAEMLATEEDKVVLLTVVQSLRTMLDDWNFNKDNFEPYLNSV
FT                   ASLLLRKILPSVSLTETRLYVLNTMSDLIIQTKSLIGQDMLIEILQIVPNLWNVATNET
FT                   TESILCNSLLRLLRHLATSLGAFSYMTWEISIPIVMTSCNPSSKDYQLLNEDGFELWSV
FT                   LLQNYSPEKQQLDTRFTEFLPYVSSAVECHTEILPTLLEIIKSYALLLEPSQFFAHPSV
FT                   AEVFRKLSQYLLKLREDSFQLVLEIWEILTLCNESNNESLLIENFYSNGIFIALFDAVL
FT                   LEEALSSYQCLQVLQVISRITYVNPSAVMNFLTSYHSNLPLMEQNMQLPVTERKLVSSD
FT                   MSYDDVVRKFISVWVVCFKDVYDPKQKKVHILGLSSLLRTGLVSVIGEFPAIASIWIEM
FT                   LEEIKETNDGDCEKYHLNDIVTEQSLEFYPISCEQLRYHQLVKNNDPTHNISLRDFISQ
FT                   TMQFLETQMGSQEYQAFLNSNNPTLLENLQLFLSIQQQ"
FT   CDS_pept        654817..655521
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17440058"
FT                   /locus_tag="CAGL0J06798g"
FT                   /product="Strain CBS138 chromosome J complete sequence "
FT                   /protein_id="CAG60952.1"
FT                   /db_xref="HOGENOM:HBG123643"
FT                   /db_xref="UniParc:UPI00003B6AAD"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FP43"
FT                   /transl_table=1
FT                   /translation="MVVGPISNLRDDALKDDTLNHIRKEYLESKKQISNLLSQETNTNE
FT                   FSRKPYPNSSPIRKFDHFANERPTTIDAKLREQLRTGASDVAIEQSLRTNSDESRNQMI
FT                   YDDMKVMKRIIDGQQESIRELRRALEQERYMNSELQRKYNEMERRFDRLEWFINSHDKF
FT                   QAYQDIRSNTTKKDFSDPIFNNGLKRRWDEYPIRSFEPDTNINRNNRIFSNYDDSTTRL
FT                   MQITDPHYRSVG"
FT   CDS_pept        complement(655589..656890)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000197570" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18501693"
FT                   /gene_name="RNY1"
FT                   /locus_tag="CAGL0J06820g"
FT                   /product="Ribonuclease T2-like "
FT                   /EC_number="3.1.27.1"
FT                   /function="RNA binding"
FT                   /function="ribonuclease T2 activity"
FT                   /cellular_component="vacuolar lumen"
FT                   /protein_id="CAG60953.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0005775"
FT                   /db_xref="GO:0033897"
FT                   /db_xref="HOGENOM:HBG123644"
FT                   /db_xref="HOGENOM:HBG738816"
FT                   /db_xref="InterPro:IPR001568"
FT                   /db_xref="InterPro:IPR018188"
FT                   /db_xref="UniParc:UPI00003B6AAE"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FP42"
FT                   /transl_table=1
FT                   /translation="MILASVLKAFQGLQTGLQHSYQDGSPSCPINLPLSCGNETAISDL
FT                   CCFEYPGGILLMTQFWNYAPSKPNLNRTELEEELGPVDSFTIHGLWPDDCMGGYPQFCK
FT                   RDLFIDDVDYLLKSDAFNNDDTLPIQGEELLNNLNKYWKSNNGNHESLWIHEYNKHGTC
FT                   LSTLQPQCYSRWNPTTSQKGPKYYKKKAVYDYFRISYDLFQKLNTYEMLAKHNITPSND
FT                   TSYTKSEILSALSSEFQGTQAHINCNSQNALTEVWYYHQLNGSILNEDFIPLDPLRSMS
FT                   RCKDQGIKYYPKGYQRRDNRGPNKKPISRGTIRISQYGGFLIKTGRWMKRGTPANFELI
FT                   ESKYGNYLLKSRMGYCTVHNDKSQLDCSSRSPDYATQFDYNEEKGILGYSGSFEWGAES
FT                   APKNGRTSRSVVFAVSNEKNSNLKYKFQLKFNRK"
FT   CDS_pept        complement(657226..658740)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000170529" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19349517"
FT                   /gene_name="TFB2"
FT                   /locus_tag="CAGL0J06842g"
FT                   /product="RNA polymerase II transcription factor B subunit
FT                   2"
FT                   /function="RNA polymerase II transcription factor activity "
FT                   /biological_process="DNA repair"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /biological_process="transcription"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG60954.1"
FT                   /db_xref="GO:0003702"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006281"
FT                   /db_xref="GO:0006350"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="HOGENOM:HBG146258"
FT                   /db_xref="HOGENOM:HBG318428"
FT                   /db_xref="InterPro:IPR004598"
FT                   /db_xref="UniParc:UPI00003B6AAF"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FP41"
FT                   /transl_table=1
FT                   /translation="MSFSGLKHSITQYLEEIPSQVQTRLYKSPATCLAIYRLLPTLAKF
FT                   FIMTVIFNDKDISLRDLDRWVKSNGKLQFQEAIKSMKSLHLLIPTRVNGQLLINLNPTF
FT                   RESFRNALTGGEVNNSFGIVVDEDRLDTVVNLAVLDEYAATKWETILHFMVGTPMAKMP
FT                   SENVLNLLKHSKLMEEVPDSSEFMITNEGFQFLLQEVNSQIWSLLLQYLKLAESLHMDP
FT                   VHVLNFIFMLGALETGKAYSTENLSETQLKMLLDMRDYGLVFQKTSNPNIFYPTRLAQM
FT                   LTSDTKSMRTASGAMESVLNKPDDAAKSTDDKYDSLEGKAEDIQDGALIIETNFKLYSY
FT                   CNSPLQIAILSLFVHLKSRFANMVAGQITRESIRRALINGITADQVIAYLESHAHPQMR
FT                   RLAEEKLQKKLELDPNCKDPLQVLPPTVVDQIKLWQLELDRVLTYEGSLYIDFDTAQDF
FT                   NMLCKYAQDIGALLWKDDRKRKLFVSREGNAQVLEYAKRKIKKKEE"
FT   CDS_pept        complement(659025..659657)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17440059"
FT                   /locus_tag="CAGL0J06864g"
FT                   /product="Similar to uniprot|P32489 Saccharomyces
FT                   cerevisiae YPL121c MEI5 meiotic protein "
FT                   /protein_id="CAG60955.1"
FT                   /db_xref="HOGENOM:HBG253392"
FT                   /db_xref="InterPro:IPR018468"
FT                   /db_xref="UniParc:UPI00003B6AB0"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FP40"
FT                   /transl_table=1
FT                   /translation="MEDTFIGDDTTLLESASQPGEKPSVKTVNNGKVLKPRNENIKRHR
FT                   LILSEYRRKIRDEEKDIRELKQAIKIIEEKKLEHLMSLIEKWREVSQKTLSYMQYSTVL
FT                   KIDKMGGFKKYMERELENKLLEIEDEYTRFEEEMGSFLESDEFERLSEEQQEEYKDQIN
FT                   SRRYDLEKLKLQKAKEIEKEYENVDDVFTLQELTKLLKIDYKLIFPH"
FT   CDS_pept        660284..661822
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000158093" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17440060"
FT                   /locus_tag="CAGL0J06886g"
FT                   /product="Strain CBS138 chromosome J complete sequence "
FT                   /biological_process="autophagy"
FT                   /protein_id="CAG60956.1"
FT                   /db_xref="GO:0006914"
FT                   /db_xref="HOGENOM:HBG011748"
FT                   /db_xref="HOGENOM:HBG397104"
FT                   /db_xref="InterPro:IPR007243"
FT                   /db_xref="UniParc:UPI00003B6AB1"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FP39"
FT                   /transl_table=1
FT                   /translation="MNDLQFDSLKVFKCQNCHLPLQVDPTMLHLSKSQRELLLPREDRR
FT                   PGVEEFNLRQESQDMLKKVKTGKEAKQLLKEDFQSSDFLFLRDIDDSIAEKDLKKGLEG
FT                   DNDDRKSNEDSMVSELDVEDTAKTLSTQIERLSKLFEIMSTSESNIDYPICQECCNIMM
FT                   KRLKTDYEKAVKERDLYFQFVKRIEKQQLDESDSSQLSLRQKEYTDQTKKINQERERLL
FT                   LELTKKEQVEEELDAEIAELTRQISEKKANERATRKIDNAKQWDKMKLLNDISSLQYQY
FT                   ETELNKLDQLRKTNIYNESFRISHQGPFATICGLKLGSYEDHKVSYSEINAALGQLVLL
FT                   LMTISSSLNIKISGYRLQPIGSTSKVSKFLADKEDWETYELYFSSNFSLEKIFKRETDF
FT                   DKGMESLLDIVKQISLSFSTVVSSDTDINIQDERTRSNDSMLNGGANRNANLRADRLFT
FT                   ESELPYMIDGDRINGISVKLYGAEPNLEWTTAMKFLLTDAKWLLVFCSSKLSLQ"
FT   CDS_pept        complement(662041..663855)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000268804" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19349518"
FT                   /gene_name="DBP1"
FT                   /locus_tag="CAGL0J06908g"
FT                   /product="ATP-dependent RNA helicase DBP1 "
FT                   /EC_number="3.6.4.13"
FT                   /function="ATP binding"
FT                   /function="ATP-dependent helicase activity"
FT                   /function="translation initiation factor activity "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAG60957.1"
FT                   /db_xref="GO:0003743"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0008026"
FT                   /db_xref="HOGENOM:HBG517301"
FT                   /db_xref="HOGENOM:HBG737336"
FT                   /db_xref="HSSP:2DB3"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="UniParc:UPI00003B6AB2"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FP38"
FT                   /transl_table=1
FT                   /translation="MSDGSGRYVPPHIRRGGGNSHESAAADGLSGSRYSGNGFFSSPNR
FT                   GNHKSSGGFFGSRPFNDRRTGQGSRASGSGGFGGSGGRYGWVNGKHVPYPKNPRLEMEL
FT                   FGNATDHVTSGINFDNYDDIPVEASGDNVPEAITEFKSPPLDELLLENVELANFSKPTP
FT                   VQKYSIPIVTKNRDLMACAQTGSGKTGGFLFPVLSELFLNGPAPLPEHTRHSYMRKCYP
FT                   SALVLAPTRELAIQIFDEAKKYTYRSWVKPYVVYGGAPIGQQMRDMDRGCNLLVATPGR
FT                   LNDLLERGKISLVNVKYLVLDEADRMLDMGFEPQIRHIVEDCDMPSVNDRQTLMFSATF
FT                   PREIQHLARDFLKDYIFLSVGRVGSTSENIQQKVLFVEDYDKNSALLDILINEIDGLTL
FT                   VFVETKRMADQLTDFLIVQNFKATAIHGDRTQAERERALHAFRNGIANILVATAVAARG
FT                   LDIPNVTNVINYDLPTDIDDYVHRIGRTGRAGNVGVATSFFNSNSMNIAKELMDLLTEA
FT                   NQEVPQFLVNMVQDSMRFGRGGRNSRTGSNRGRGSNTRDYRHSNKDDWGSLGSSRRGFR
FT                   SNDNRGFGNNWGSSSGDGFTNKAANSWW"
FT   CDS_pept        664270..665289
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000141796" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18501694"
FT                   /locus_tag="CAGL0J06930g"
FT                   /product="Similar to uniprot|Q02950 Saccharomyces
FT                   cerevisiae YPL118w MRP51"
FT                   /protein_id="CAG60958.1"
FT                   /db_xref="HOGENOM:HBG190528"
FT                   /db_xref="HOGENOM:HBG203893"
FT                   /db_xref="InterPro:IPR016712"
FT                   /db_xref="UniParc:UPI00003B6AB3"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FP37"
FT                   /transl_table=1
FT                   /translation="MSLSNMLRASRLAQVYKSSKPLSTGLKIAPTHQVIETKPALLKFH
FT                   EWGLKSAIPSKVKTQYLMYKELDTLERLTDFEPRGGANWNRIRVQEFGLSPRYNANTKN
FT                   PLFNKEHYDFSSLNEVFTKFFFEKQQHGSMKYGSLSESRKLFIKNVRQEFKEWLVAKYP
FT                   EAILNQSFTKPDNMLTYGKEFLQSYNNRSSSKLNSPDTMIGTGGLTYALKGRLRNSPNG
FT                   VIQKHIVPGRFVAPTNDNKIAAIGGFVANAASSVISAQPQKWVSNRDKIYPFEVSNLSV
FT                   NNGQITLDAKGTMLNKPEQKRLRRNHYPKPLYGNRYSTGERKSDVAESLKAILEFNKS"
FT   CDS_pept        complement(665599..666426)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000274106" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17440061"
FT                   /locus_tag="CAGL0J06952g"
FT                   /product="Strain CBS138 chromosome J complete sequence "
FT                   /function="hydrolase activity"
FT                   /function="isopentenyl-diphosphate delta-isomerase activity"
FT                   /biological_process="isoprenoid biosynthetic process "
FT                   /protein_id="CAG60959.1"
FT                   /db_xref="GO:0004452"
FT                   /db_xref="GO:0008299"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG158579"
FT                   /db_xref="HOGENOM:HBG416977"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR011876"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniParc:UPI00003B6AB4"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FP36"
FT                   /transl_table=1
FT                   /translation="MSEYRKLVEGLDEAAILENFPEIIPLQSRPNTHSSEDASRGKDDV
FT                   FAGHDQEQIRLMNENCIVLDWEDNAIGAGTKKVCHLMDNINRGLLHRAFSVFIFNTEGK
FT                   LLLQQRATEKITFPDLWTNTCCSHPLCVDDELGENGSLPAKVLGAKTAASRKLEHELGI
FT                   PEAETATRGKFHFLNRIHYMAPSNEPWGEHEIDYILFYKIDEGKQLTVQPNLNEVRDFR
FT                   WVSADELKAMFNDPQYKFTPWFKIICDSYLFQWWEQLQDLSKVENDSQIHRML"
FT   CDS_pept        667811..669847
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000246666" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20196344"
FT                   /locus_tag="CAGL0J06974g"
FT                   /product="Similar to uniprot|Q02959 Saccharomyces
FT                   cerevisiae YPL116w HOS3"
FT                   /protein_id="CAG60960.1"
FT                   /db_xref="HOGENOM:HBG058550"
FT                   /db_xref="HOGENOM:HBG397120"
FT                   /db_xref="InterPro:IPR000286"
FT                   /db_xref="UniParc:UPI00003B6AB5"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FP35"
FT                   /transl_table=1
FT                   /translation="MDDPLSKFFQQFQLFVQNNPNVISAARAAAQIPESAKAVIVLSPY
FT                   SLSHEFSRDWVAKSYKKTIVERPERLLAAAMGVAAAITMYPALFTLKSSHRRQSSLLSP
FT                   HVLKVHGSEWPRTLLQLCKQSDSKLARGEVEVPDNWNAGDIYLTSRTIEALQGTIGAVE
FT                   TGVDSIFSGPSLEHISNRVFVAIRPPGHHCHYATPSGFCLLNNAHIGIEYAADKYGVTH
FT                   AVILDFDLHHGDGTQDLCWKRAGFKPDEHTEEDGYDEFGKKFAEFPKVGYFSMHDINSF
FT                   PTESGFATKENIKNASTCIMNSHDLNIWNVHLSRWSTEEEFAKIYKSKYRTLFAKADEF
FT                   FKNSKNEMNELGKPFKGLVVISAGFDASEFEQTSMQRHSVNVPTSFYTMFTKDALKLAQ
FT                   MHCQGKVLSLLEGGYSDKAITSGVFSHLIGLQNQDWINEWGSEQVVKEIVRGCKPSWKP
FT                   YKTKKARDVIRIWAEEVIRLGRAMIPEFEDILFKEGLQSNPGLGDVPTSTIAQRLRKTH
FT                   VKEEPTKTKELTEPPKTSTNTRKSRNDDTKKDVPFIQQELSSEDEGEDEDYVYDEELNK
FT                   TFNRTVEDITIDDISRHLETLELEQIDENEPQELFIKKDENKQQRHLQSNGMYKIPSSK
FT                   TQRFKNSQQPQSNSPPTYDDSDISMISHVSVARKHNTRSGRKW"
FT   CDS_pept        complement(670212..673529)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000095196" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21045127"
FT                   /locus_tag="CAGL0J06996g"
FT                   /product="Strain CBS138 chromosome J complete sequence "
FT                   /function="GTPase activator activity"
FT                   /function="phosphatidylinositol binding"
FT                   /biological_process="cell communication"
FT                   /biological_process="signal transduction"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAG60961.1"
FT                   /db_xref="GO:0005096"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0007154"
FT                   /db_xref="GO:0007165"
FT                   /db_xref="GO:0035091"
FT                   /db_xref="HOGENOM:HBG060014"
FT                   /db_xref="HOGENOM:HBG203894"
FT                   /db_xref="InterPro:IPR000198"
FT                   /db_xref="InterPro:IPR001683"
FT                   /db_xref="InterPro:IPR001849"
FT                   /db_xref="InterPro:IPR008936"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="UniParc:UPI00003B6AB6"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FP34"
FT                   /transl_table=1
FT                   /translation="MAGNFGAGSSALQLLEQYNDQRLEKDKKLEHIERNKPTEQKNYLD
FT                   PDKRASWRRGSLDGGNNDWKSLYDDMFQDNLRMNKQLQDKDKEIALLEKVVVYLRDNIG
FT                   VVNAKYNVNKNSTLEDLKKVVTEIDNAKHEHQFALPPRSTERTNNQRTTDPLDDFENEM
FT                   KLKKVSENTPRPTPSATGSFQSNSTKTQSSEEPTLPSSYANKLNISPIRITEAPQNFTS
FT                   PATSVTYTTSRITISSPRSVRHEPKQDTTAQVPESPSRRIVSQTIRKQQNGPLESCSNS
FT                   QSGRNTPTKHLEKDQSVDRSFAPMSPPRTDFQKPKGQDFSPSSKEKIDNFAELLEASFG
FT                   EEEVSKHDTQNGHQDLKKSNAIKSQGLPNVTINASITSTPVSAQQLGSPIIVNKKKDVL
FT                   VNHDSQMSTPGTSSIVSSIVPGSLPNETPLGRADNLRHEREYLPSNEQRQETPSHISPQ
FT                   KPPANSQQGLRVDLTSVNRDNSLRSNPSLKPVTSDIPLFVQPEDLGTIQIQILSTLYKD
FT                   PEINFQGEENSVLFSVIDRSSSQEMFKFSKSLKKLRELDVYLKSHIPSVSIPDLPSEQL
FT                   YKSLLPVRVDQRREMLNGYFSSLVSIPNFPVNVGLKIAEFISTDTVMTPLTLGDTLYEG
FT                   RLLMRKPKALGGGNTWKLRYGALNSKTLQLLENDQIMEQVKVRQVSLEILPNLPDDKFG
FT                   TKNGFLLTEHKKSGLSGSNKYYLCTETAKEREGWISALHGLLDPNSSNLAPSTSSIRSG
FT                   SNHTDNISFGRPDSSKPDPHYVTDLSNHRNSYNIETASNYSGISSPSGISEQNEGADDE
FT                   RESRRMKMRSIFPFKKIAGGVFPHDEDRDTENDSLNKSVETFVTSNNDNYSQRLVESTP
FT                   LPVSLNTVFGAPLQKSMQLSSKTYQRQYHLPSIVYRCLEYLYKNHGIQEEGIFRLSGSS
FT                   TLIKQLQEKFDREYDVDLSNFNNKLEGAGNEDDSNGGQFISVNTVSGLLKLYLRQLPHL
FT                   ICGDDEYGYFKGVVDMNHDNPAKIALGFRDIIASGKIPHQNLSLMYALFELLLRINENS
FT                   RYNKMNLRNLCIVFSPTLNIPIGVLQPFIVDFACIFKGADPIPDSSREQIDIHIPNV"
FT   CDS_pept        join(674365..676154,676461..676644)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000170353" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18501695"
FT                   /locus_tag="CAGL0J07018g"
FT                   /product="Similar to uniprot|Q02981 Saccharomyces
FT                   cerevisiae YPL109c"
FT                   /function="ATP binding"
FT                   /function="protein kinase activity"
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="CAG60962.2"
FT                   /db_xref="GO:0004672"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG142612"
FT                   /db_xref="HOGENOM:HBG327456"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR004147"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniParc:UPI00017BD8B8"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FP33"
FT                   /transl_table=1
FT                   /translation="MLLNLIKSRAKVTTALAKVRVVGRQRRFLISPLTTASIATGAISL
FT                   SIYHNRREHLLNETLEPDPTGDTFEMGLYIASEKERETLAASGKLDVIRKSRSLLVRSI
FT                   LKLWVVLDDNIIEPVLTVCRFLELMGLFLPVFSLYPICWLGRRIKLNDDITDTRGSIIW
FT                   CKLIRIALELAGPSFIKLGQWAGSRTDIFSETLCYELGKLHSKVRPHSIEYSKKMITSS
FT                   FEVDDFDEIFDSFGEKPLGVGAIAQVHVGKLNDAFYNKYSNKTPENNKWCAIKIIHPRV
FT                   RNQIYRDLKIMKFFACVIDGIPTMEWLSLPNEVEQFSILMKLQLDLRIEALNLKRFNEN
FT                   FKDATQVKFATPYLELSNRDVLFEEYLHGFPMEDFLKVKRHIKDDDLCRRVSDPFVEAF
FT                   LQMLIRDDFVHADLHPGNVMIRFVKTNKYGTQIISSEESSYNISHTLREKWRNKDSDLI
FT                   PYLKSALTTYTPQICYIDTGLVTELNDRNRVNFIALFNALAQFDGYRAGELMIERSRTP
FT                   ETAIDKDLFALKVEKLVDKVKQRTFTLGNVSIGDLLDQMLRMVRSHHVRMEGDFVSVVV
FT                   AILLLEGIGRQLDPDLDLFESSIPLLRDFNFMKETNNKFLTEIGTYKILKLLVGLEIRK
FT                   LMTVSVRELYNLVKTDQLCPNY"
FT   CDS_pept        677513..681250
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000175901" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17440062"
FT                   /locus_tag="CAGL0J07040g"
FT                   /product="Similar to uniprot|Q02979 Saccharomyces
FT                   cerevisiae YPL110c"
FT                   /function="glycerophosphodiester phosphodiesterase activity"
FT                   /function="phospholipase C activity"
FT                   /biological_process="glycerol metabolic process "
FT                   /biological_process="lipid metabolic process"
FT                   /protein_id="CAG60963.1"
FT                   /db_xref="GO:0004629"
FT                   /db_xref="GO:0006071"
FT                   /db_xref="GO:0006629"
FT                   /db_xref="GO:0008889"
FT                   /db_xref="HOGENOM:HBG055873"
FT                   /db_xref="HOGENOM:HBG329172"
FT                   /db_xref="InterPro:IPR000909"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR004129"
FT                   /db_xref="InterPro:IPR004331"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniParc:UPI00003B6AB8"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FP32"
FT                   /transl_table=1
FT                   /translation="MKFGKTLLKLRIPEWSHLYVNYKVLKKILKEITKVQDDLYQQENS
FT                   ANGEGDKPLWKKEEDGMTSDRKTFAENKKIQQLIISFFFNLDRDIEKVDSFYNSQFSEY
FT                   EKRLQKLLQSSQFQDVTYLIENREGEKELTPVGNGSIPPRYATPHHIDDVNEVYNILSE
FT                   LKTQFRNLKNYSELNKRAFVKILKKFDKITGLSRKDIFLQNRIYPLPFANETQISKDLG
FT                   TINEIWSKLSSRVGVIGALNPSVDELLQSTENLIPQIKLNDSPSVKGQVTSINDITPFI
FT                   DEDNGKGIIAQLIQLYGTITAVPTRSLINILNKSALKKSYNCVDSILEVIPSFNDVTDI
FT                   NNRNFFHHFIISLSKKLPSNDQQEEIPFVLKSQPSFAKPTEDVILSSNLEVIYNTYMNR
FT                   GTTGTVLEKQKLDENYLDPFRHIIQKLPVRLRPCILQVDNYSRTPLHYAAKFGFTGIAA
FT                   EIIEMLKAWGYWKDDISLDDKDFWGDSEGLSPVHLAVLGRNTDTLKMLLDSMNNNLLLT
FT                   SPTLLFLAIQTNEFDLINTILSSSRIDINFQDEQTKETALYQAVAANLFEATACLLING
FT                   ASTEIKEKLFGWTPLFIGAAEGYSDIVRLLVNNGANINILDDGGWTPMEHAVLRGHLEV
FT                   AKIVEVKDWPEVCHPVYNSTKNQDSQSRDNSEIIKGNSNSSEQMNDTKVKRIKSFGHSY
FT                   LKEEEAIMLITLGGTDTRITTPAISLNLKKLLQSADIDTALSLVISCDDDVSSVPVVLD
FT                   LPLDASMANINFKVPFKDNGVYTVFFDIVYTYGSYSPDNGNSLVRPNLDRNASVDSVIL
FT                   SSASDRDQNDSPPPVEYLKDRLVARAVALLNKTNSAAGTNRRLLNDNVTIPIQSKYGMD
FT                   LVGTISFEYSIVTPFSHPKMGVYATDTYWKSLVSTRVIGHRGLGKNYQSSKSLQLGENT
FT                   VESFIAAASLGASYVEFDVQLTKDNIPVVYHDFSVAETGVDIPMHELTLEQFLDLNNYG
FT                   GSRELLKSRRKSMDDSDFKNLKKDWDLGEPDDGRKSPYYQSRSKLMEERMKLTKAYKSN
FT                   NYKGNSRGHSIASSFVTLKELFKKIPQNVGFNIECKYPMLDEAEAEELGQIALEMNHWV
FT                   DTVLQVVYDNFNGRDLIFSSFHPDICVMLSLKQPNFPILYLTESGTTKMADYRAISLQN
FT                   AIKFAKSWNLLGIVSAAYPIVKAPRLAKVVKSNGLVCVTYGVENNDPNNAAIEIDAGVD
FT                   AVIVDSVLAIRRGLTKIQTK"
FT   CDS_pept        complement(681641..682606)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000204319" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19349519"
FT                   /locus_tag="CAGL0J07062g"
FT                   /product="Similar to uniprot|P00812 Saccharomyces
FT                   cerevisiae YPL111w CAR1 arginase"
FT                   /function="arginase activity"
FT                   /function="metal ion binding"
FT                   /biological_process="arginine metabolic process "
FT                   /protein_id="CAG60964.1"
FT                   /db_xref="GO:0004053"
FT                   /db_xref="GO:0006525"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="HOGENOM:HBG311682"
FT                   /db_xref="HOGENOM:HBG391953"
FT                   /db_xref="InterPro:IPR006035"
FT                   /db_xref="InterPro:IPR014033"
FT                   /db_xref="InterPro:IPR020855"
FT                   /db_xref="UniParc:UPI00003B6AB9"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FP31"
FT                   /transl_table=1
FT                   /translation="MTDYKYYKDRQLSLVLAPFSGGQGKLGVEKGPKYMLKHGLQKDLE
FT                   ELGWGTEIQSPLDEEEYVKKVKENTQDQFGIIKRPQLVGEATELIYKSVTDVLSRDRFP
FT                   VTLGGDHSIAIGTVSAALDKHPNAGLLWIDAHADINTLESSPSGNLHGCPVSFLLGLNK
FT                   GKHESLKSLDWVPGKLKPNKIAYIGLRDVDSGERKILKELGIKAFSMYHIDRYGINTVI
FT                   EMALEAIKDPESENTPIICSYDVDSIDPLFVPATGTPVRGGLTLREGLFLAERLAETGN
FT                   LISLDVVECNPDLAIQDIHVSNTISAGCAIARCALGETLL"
FT   CDS_pept        684122..685252
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000246508" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17440063"
FT                   /locus_tag="CAGL0J07084g"
FT                   /product="Similar to uniprot|Q02961 Saccharomyces
FT                   cerevisiae YPL113c"
FT                   /function="cofactor binding"
FT                   /function="oxidoreductase activity, acting on the CH-OH
FT                   group of donors, NAD or NADP as acceptor"
FT                   /protein_id="CAG60965.1"
FT                   /db_xref="GO:0016616"
FT                   /db_xref="GO:0048037"
FT                   /db_xref="HOGENOM:HBG060011"
FT                   /db_xref="HOGENOM:HBG203895"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI00003B6ABA"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FP30"
FT                   /transl_table=1
FT                   /translation="MRPKVLIPYQQTWEVASHIPEWEKLKDKLDFIEYKMTNADDFREY
FT                   LHSNDIAALWVTEEFFRVLGGPTPYIEDYPSSLRVIAVPWVGCDFIDGKMLLEKYNIYL
FT                   CNIGPHAVDNVTDLAIHLVVSCFRLTSFWEYCFRFSEPGSIDECKKYVGGTSKDQITKD
FT                   GALYPQKLDDDQSRFLNLAKDFNVAGKKVDSPTKKTALILGFGSIGQNIGSKLKFSFDM
FT                   KIKYYKRSGEVPREQLGYDAIYCSDLQSADTWQDVDVIVLALPGSPSTDDIINDSSLGM
FT                   CKDGVRIVNVGRGSCIDEDALISALDSGKVNSCGLDVYKNEETLINEKFLKRWDVTLLP
FT                   HIGSAVADMMVRQTIITLDNIEDILLKNGEGIYRAN"
FT   CDS_pept        complement(685582..686331)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000246665" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17440064"
FT                   /locus_tag="CAGL0J07106g"
FT                   /product="Similar to uniprot|P32773 Saccharomyces
FT                   cerevisiae YOR194c TOA1"
FT                   /function="RNA polymerase II transcription factor activity "
FT                   /biological_process="transcription initiation from RNA
FT                   polymerase II promoter"
FT                   /cellular_component="transcription factor TFIIA complex "
FT                   /protein_id="CAG60966.1"
FT                   /db_xref="GO:0003702"
FT                   /db_xref="GO:0005672"
FT                   /db_xref="GO:0006367"
FT                   /db_xref="HOGENOM:HBG060012"
FT                   /db_xref="HOGENOM:HBG737994"
FT                   /db_xref="InterPro:IPR004855"
FT                   /db_xref="InterPro:IPR009083"
FT                   /db_xref="InterPro:IPR009088"
FT                   /db_xref="InterPro:IPR013028"
FT                   /db_xref="UniParc:UPI00003B6ABB"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FP29"
FT                   /transl_table=1
FT                   /translation="MSNLEASKVYELIVSNVINEVREDFESAGIDEQTLQDLKRVWQEK
FT                   LTETKVTHFSWDPVTDAVPATNETNQQETSTTETNGLQLPGGAVISAPSTGNDMSPQDE
FT                   NTNNADDGDATAGMLAGGDDDLNNNENNVSDNNVQVKQEGDVKFEMTIENADTSDLESK
FT                   NKDHKEAKRSALLDADEVGSELDDSDDNYLISEGEDEGPDENIILCLYDKVTRTKARWK
FT                   CTLKDGIATVNRKDYSFQKAQVEAEWV"
FT   CDS_pept        687628..688371
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000216630" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17440065"
FT                   /locus_tag="CAGL0J07128g"
FT                   /product="Similar to uniprot|P39721 Saccharomyces
FT                   cerevisiae YAL049c"
FT                   /function="hydrolase activity"
FT                   /protein_id="CAG60967.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG067473"
FT                   /db_xref="HOGENOM:HBG324508"
FT                   /db_xref="InterPro:IPR002925"
FT                   /db_xref="UniParc:UPI00003B6ABC"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FP28"
FT                   /transl_table=1
FT                   /translation="MASNPPGKCCFEGFYHEGQAKGTHKDVCGVDTYVTGAENSSDRVI
FT                   VILTDIYGNRLNNVLLTADQMATDCYQVYIPDILFNDPVVALDGSTDFNAWLAAHPAEK
FT                   VQELVTKYLTDLRAQLKPKFLAVVGYCYGAKFAIQQIGANPLADCCAIAHPSFVSIEEV
FT                   DAISKPVLISAAEEDPIFPEELRHQTEAKLKENKARYQLDLFSGVSHGFAARGDTSNPV
FT                   VKYAKEKVLVDQLYWFNYFSGCCQK"
FT   CDS_pept        complement(688858..691926)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000066010" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17440066"
FT                   /locus_tag="CAGL0J07150g"
FT                   /product="Strain CBS138 chromosome J complete sequence "
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG60968.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG123645"
FT                   /db_xref="HOGENOM:HBG203615"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR002409"
FT                   /db_xref="UniParc:UPI00003B6ABD"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FP27"
FT                   /transl_table=1
FT                   /translation="MKYVDEGDSSDISKKRNRLSFVCQGCRKAKTKCDKEKPACSRCLK
FT                   HGIRCVYDLTSQKAPKNPNKDAMIARLEKELSYWKKKTLKLTKTLPPVSRHLISTNEPA
FT                   MDIELSSLRANCTNVEVNLFKVHPRLIVSGVIKREVNPLSENYLIIQDKFTTTAIASVF
FT                   LNYQGSALLSALASDMSITKTSTNVQNNISIIKENLLKQCRNDLQGKRIKLFVNKLAQN
FT                   IEPPPDLFQKGEEAKNFLTSLDNSFVEDYCPKGAPYSELLQSLIDSIESLLPPYDIIIA
FT                   YKKWYYDNVYYIAPFVHKSIFEDDLAQILVRDDKDPQKVKVVFGNSKLRSKLETMSMLL
FT                   LVMKLAYTSIILTDDDIRKYSSVLTMDIVRKYPISSEVAHVVQNCLSAENWCATPNENI
FT                   ISCLLLLWAFFVFSPDEGDFFYEQPTGVLASIAMMLGVSIGLHKDPSDYPVFSNDTLGD
FT                   KRVCNQRRLLWIAMICVLTFETNTKGSTVDKHDDLFDIFIDLRDPSSVYELMDRVKKDC
FT                   DHNDEGSIEVMNVIENLFRRTQTSYALYDLNALLLSPDGRFTLSEYEILSSKVHIMSKE
FT                   YIDLVSSYSPKHGPSGDKAKLPLFYMLNCCDVLSGIIFQLMNLRISIALFLHFEERLVT
FT                   EENVKNHYIYFFTKLCLDLIALGNTMEKFFDGTFDAVIAKASDFIIKKAIQVAINTVLF
FT                   GLLAVIMRFDLAASILFNELQSLQTQGVYKEQIYSEMNSKIQLLNDMKVIFETQLKNIY
FT                   HVCSTSLRFEYFTIFKMLTLFDALLDRIEKNELWIGILRMAHLDNVDPKIAKVLAITLR
FT                   IQLIRKTGLVEDMQLRSHLAHFELEKITKLHKSMTNYKSRLNLINTYNVDLESTPESSL
FT                   EPLIPMKEEPLVVIKEETVTPNFSNRTVSPNLPRIKSEEPVEIMATPATGLTQLSNAAL
FT                   LSSQPLSIPVLPIQSQQPASQSNSDNQGPVNENIPTAFPILGSTNQQNQMINNNGVANV
FT                   NLNNTEEPLADFFGISATLGVLDFEFLLGNQFQ"
FT   CDS_pept        695093..695707
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000232113" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17440067"
FT                   /locus_tag="CAGL0J07172g"
FT                   /product="Similar to uniprot|Q08873 Saccharomyces
FT                   cerevisiae YOR367w SCP1"
FT                   /protein_id="CAG60969.1"
FT                   /db_xref="HOGENOM:HBG396331"
FT                   /db_xref="HOGENOM:HBG517811"
FT                   /db_xref="InterPro:IPR001715"
FT                   /db_xref="InterPro:IPR003096"
FT                   /db_xref="UniParc:UPI00003B6ABE"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FP26"
FT                   /transl_table=1
FT                   /translation="MEKVYGVKPDVTTLDDDLKQLRSGKFSKEAVDEIKNWIFSSILKE
FT                   RPENSDSSLLELLKDGSVLCKVANKLGELEHGFSPIKWKVSNMPFVQMEQISLFLAFSR
FT                   QYGVPEDELFQTVDLFEEKDPASVYQALKSLSRYANKKHPDKFPVLGPQLTEKKPRPPV
FT                   KAKPKHLQTESPGWSTYEYGYMKGASQKTENIVFGQKRDIA"
FT   CDS_pept        complement(695807..696331)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17440068"
FT                   /gene_name="PEX22"
FT                   /locus_tag="CAGL0J07194g"
FT                   /product="Peroxisome assembly protein 22 "
FT                   /biological_process="peroxisome organization"
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="peroxisomal membrane"
FT                   /protein_id="CAG60970.1"
FT                   /db_xref="GO:0005778"
FT                   /db_xref="GO:0007031"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG123646"
FT                   /db_xref="UniParc:UPI00003B6ABF"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FP25"
FT                   /transl_table=1
FT                   /translation="MSKRRKNQGYLAIIAAVSIGAAAYLWWRNHSEDDSVSKFNQQDDG
FT                   TAQDNQIKEKPAIKLGKKRLHRSLCVIISNKLSNLVELDWDEILQEDIVFLILPSVNDF
FT                   QNSNDIKTDTHKIINCDTELGLWACVRTLKKNELLVCADDIKVPDDIGRYCDKISQIKS
FT                   SQQLMNYLDET"
FT   CDS_pept        696814..697986
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000804" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17440069"
FT                   /locus_tag="CAGL0J07216g"
FT                   /product="Strain CBS138 chromosome J complete sequence "
FT                   /function="damaged DNA binding"
FT                   /function="exodeoxyribonuclease III activity"
FT                   /biological_process="DNA repair"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG60971.1"
FT                   /db_xref="GO:0003684"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006281"
FT                   /db_xref="GO:0008853"
FT                   /db_xref="HOGENOM:HBG058901"
FT                   /db_xref="HOGENOM:HBG202934"
FT                   /db_xref="InterPro:IPR003021"
FT                   /db_xref="InterPro:IPR016587"
FT                   /db_xref="UniParc:UPI00003B6AC0"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FP24"
FT                   /transl_table=1
FT                   /translation="MVKSRFSATTVHLEHITTALNCLTPFGSKDDILIYIDHDGLSFVK
FT                   DNNGVIRISLLLAKELFSSYHFATTESNQTDNDGDDLDYMKLCVKINHILDSVSVVNKN
FT                   LDDVVECILSYDGRGSPFSLTFEDSMISERVDYSTYLIKEMDTSALELDRQKIILECIL
FT                   KGEVMHSALKDLKEINCKDIYLYANVTSNGDSTLAFISRSQLGLSKIKFPSNKNVIEKL
FT                   EIYDNNSTTMCYDKPVIGYFNYTSFNKIILSTKIASKILLRMDVHGILSINILSHTDNV
FT                   MMSEDKFTKQSSSTSSKRYNSMQLPKDYPGIVIDVCMIEKEPLDMYAQEEIHQFMGSGA
FT                   ITGVPNSKDSAADVPQHNLLSHPVTEYESNSNTKDTSSSSNMNEDLPIFF"
FT   CDS_pept        complement(698356..698784)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000210688" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19349520"
FT                   /locus_tag="CAGL0J07238g"
FT                   /product="Similar to uniprot|P48589 Saccharomyces
FT                   cerevisiae YOR369c RS12"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="CAG60972.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG125288"
FT                   /db_xref="HOGENOM:HBG319268"
FT                   /db_xref="InterPro:IPR000530"
FT                   /db_xref="InterPro:IPR004038"
FT                   /db_xref="UniParc:UPI00003B6AC1"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FP23"
FT                   /transl_table=1
FT                   /translation="MSDVEEVVEVQEEVVEQTAEVSIEDALKVVLRTALVHDGLARGLR
FT                   ESTKALTRHEAQLVVLVSSVTEDNIIKLVEGLANDPNNKVPLIKVADAKQLGEWAGLGK
FT                   IDRDGNARKVVGASVVVVKKWGAETDERNMILEHFSQQ"
FT   CDS_pept        complement(700532..702448)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248782" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17440070"
FT                   /locus_tag="CAGL0J07260g"
FT                   /product="Strain CBS138 chromosome J complete sequence "
FT                   /biological_process="intracellular protein transport "
FT                   /biological_process="regulation of GTPase activity "
FT                   /protein_id="CAG60973.1"
FT                   /db_xref="GO:0006886"
FT                   /db_xref="GO:0043087"
FT                   /db_xref="HOGENOM:HBG058902"
FT                   /db_xref="HOGENOM:HBG396845"
FT                   /db_xref="InterPro:IPR000632"
FT                   /db_xref="InterPro:IPR002005"
FT                   /db_xref="InterPro:IPR017230"
FT                   /db_xref="InterPro:IPR018203"
FT                   /db_xref="UniParc:UPI00003B6AC2"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FP22"
FT                   /transl_table=1
FT                   /translation="MLSPERRPSMAERRPSILVPHIDHNRDGSSVVHTLMVPHLAGIED
FT                   PLPEATPEEVDVVIIGTGMVESVLAAALSWQGSSVLHIDKNDYYGDTSATLTVDQIKKW
FT                   VNGINSGEVKGYTNAKLYVSTLIGPNRYASRDFGIDLSPKVLFAKSDLLSILVKSRVYQ
FT                   YLEFQSLSNFHTYENDSFEKLTNSKQEIFTDQKLPLMTKRNLMRFIKFVFNWEQQPEIW
FT                   QPYQDRTLEEFLTEKFKLEKAQISELIFSIGLCYNMNAKMPAVFQRIRRYLSSFDVYGP
FT                   FPVLYSKYGGPGEVSQGFCRSAAVGGATYKLNEQLVSYNPSTKVATFSDGSNVKVTEKV
FT                   IASPTQAPPDSQNIPQQKYEVHRLTCIVDKPCLEWFNEGESAAVVVFPPGSLKSNNTEV
FT                   VQALILGPGSETCPAGTCIWYLSTSQQGSKAELDLDAALEAMEISILRESSSDLENNDD
FT                   IVQFSVNGQTIINSVKLGQSFREYIPREKLQFLFKLYYTQFTSTPPFDVVNPALFATNT
FT                   SSKELMIPGASDNGIIYSPMPSVEISYDEVITAAKVLYEKIVGSDDDFFDVDFEDEDEM
FT                   REIAANAASNDMTNNKVGSQQTNAGIANPMIYENAIVDEDDDSQDVEMDRNDDSEFVGE
FT                   MEI"
FT   CDS_pept        complement(703034..705907)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000112781" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18501696"
FT                   /locus_tag="CAGL0J07282g"
FT                   /product="Strain CBS138 chromosome J complete sequence "
FT                   /protein_id="CAG60974.1"
FT                   /db_xref="HOGENOM:HBG123915"
FT                   /db_xref="HOGENOM:HBG203613"
FT                   /db_xref="InterPro:IPR011043"
FT                   /db_xref="InterPro:IPR015915"
FT                   /db_xref="UniParc:UPI00003B6AC3"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FP21"
FT                   /transl_table=1
FT                   /translation="MEGIVNDGSVNINSNHEKPTLISVPGSISKFMKSDSPSRYETFEP
FT                   LSFATNYVSIFAEPLEKNNNDKICLENEKLLKCYYEYRSAFSNIMNHTVNSATNSYTNL
FT                   SSMNDIQFNPDQHRHGSITSSIETSILQNERQSIYKVLNDFLIHKEHKLNPSILQKIMK
FT                   MDRSQFYRDSPFRPHFDNNDNKSDKNMENLNNEAGDNNDTYFNSTKPYLLYYKKPLSVK
FT                   FRDSEVIHRHNLWMPVVKRKYHYILKPEKLQQTLDYREPSEEAAAIYRDYFTSKACPLF
FT                   IKGLDFVPKNYDTYSGTSIVPSIFADYKMPGLVYHCSVHLNNNIYIIGGLTACYRFDEE
FT                   APDLSDFYVDPIKNLPPPLLSKLINNPSLISNPFLYVYSTLQSRFGKPDFSGNAPPPLI
FT                   CAKGSIINDRYIFYYGGFEIKTETKKDENGKYYLKKRAFVNNLGYILDTETLKFSKVEV
FT                   INPGQGSERNNKFYPRFGHIQLSANIDLTNNSVTSSSENVSVLSSRRTSSHQLYYGSHH
FT                   HYKTNHGNGQNNIRQPEELSSIAKKMPHSLGSDSKVTNDSETKIHNKTNLSPYKSIHSI
FT                   FVFGGYTQTEDDQYKALDDMWRIDLPVEIRGKRGFIKFASKAELINLPKKEVWPSARAF
FT                   SAFTISEVFPPIKESLESNLLKRLEEQYSIDTKNLTGNTSNLFGTTVGVKSDLGEAYHD
FT                   LGPSIHSQFSSHISLNSLNKPSQQGSAVNLGAPTEHSNVISNSMTAFETRMQILYNSKG
FT                   INIIMHGGSDHDEIYGDLWMFDIKNEVWSRSNLFAKEIKDKPRHECQGDISLAAPDEPR
FT                   TIVEEVPVDLKLTGHDMAYEGHMLVLLGGITQTDLPSMYHDGPIDADSEPRPLLGQNTV
FT                   NIFDMETSTLQGYKIRKNAQGHYEYIYEQDKPKKSHSVMTTAGATVHINGSLFVVGGIL
FT                   ALRSNLKDLKLRATVLQFVIPPISLSY"
FT   CDS_pept        complement(706716..708167)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000034154" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17440071"
FT                   /gene_name="ATG4"
FT                   /locus_tag="CAGL0J07304g"
FT                   /product="Probable cysteine protease ATG4 "
FT                   /EC_number="3.4.22.-"
FT                   /function="cysteine-type peptidase activity"
FT                   /biological_process="autophagy"
FT                   /biological_process="protein transport"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAG60975.1"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006914"
FT                   /db_xref="GO:0008234"
FT                   /db_xref="GO:0015031"
FT                   /db_xref="HOGENOM:HBG058153"
FT                   /db_xref="HOGENOM:HBG202635"
FT                   /db_xref="InterPro:IPR005078"
FT                   /db_xref="UniParc:UPI00003B6AC4"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FP20"
FT                   /transl_table=1
FT                   /translation="METIHNISNRLQEVLATNKSVNVDTDNDSLSSNQEDNEVEKVRHL
FT                   VVILGEKYSYAVDRNTGINALMQWFTTNSEIPEEILNAIRSKLNFTYRTNFEPIERAPD
FT                   GPSPINPLIMLRINPIDAIENVFNNRECFFTDVGWGCMIRTGQSLLGNALQRVKSTVKD
FT                   QPYIYEMDDTKEITDLFKDNTKSAFSLQNFVKCGRIYNKIAPGEWFGPATTATCIRYLI
FT                   QENPCYGIEACYISVSSGDIFKENIQGMIDRYPNGNILILLGIKLGLDSVHERYWGEIK
FT                   TMLESPFSVGIAGGRPSSSLYFFGYFDDTLLFFDPHNSQTALIDDFDESCHTENFGKLN
FT                   FSDLDPSMLLGFLLPCSKWDEFQEFTSLLTIVNVLDGMDQYRDPDLNSNDIGNVELSPQ
FT                   LKLSQTPDAITDDDYVDIGALIQGNSMNINDRDNGYQEVQCKNQQIVIMDSLNETKPLE
FT                   IEKVLVGQGTNLVNATTPCREAFPK"
FT   CDS_pept        708554..710980
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000154406" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17440072"
FT                   /gene_name="SQS1"
FT                   /locus_tag="CAGL0J07326g"
FT                   /product="Protein SQS1"
FT                   /function="nucleic acid binding"
FT                   /biological_process="RNA splicing"
FT                   /biological_process="mRNA processing"
FT                   /cellular_component="cytoplasm"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG60976.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006397"
FT                   /db_xref="GO:0008380"
FT                   /db_xref="HOGENOM:HBG058146"
FT                   /db_xref="HOGENOM:HBG202634"
FT                   /db_xref="InterPro:IPR000467"
FT                   /db_xref="UniParc:UPI00003B6AC5"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FP19"
FT                   /transl_table=1
FT                   /translation="MAKRHKHFESRGGFRKKRGGGRGSQRGRGSKRGRGGRFRGFEETE
FT                   RSASEPGAWLNSSVPLGDGDLSNPDMMVDNYRPRKHISQDTITDHYFGRKSSLKLNSMR
FT                   MAGLRHNDWRDPNNGNSASFRKRPIEFIKANCTYDPSRDLILQLANRSKNQESKEPEED
FT                   ANKCSEYAEHSEKDMEIDTAATENDANISYDESDTDQEIGNFNHSIENSKHNNNISECD
FT                   ITAVTDQELFFVDEEGMDISQKPTKVVHITEHEKKMGSNVEFHNVLTVGKVEISLNQDE
FT                   NDEVYVDRKPTAKYHPFHNYISNVIERMQEEENIDSDDFEDEDDIYLDNSGNDMPETEL
FT                   DQDEIIDLQRHDDKDHAVQTCAIPTNTLSNDLDTLHITESNDDRITINNHNMDSTVETD
FT                   KEKDPEFGFLEEDYAVNTSEVIVDNIRLGLNDNSYFLKCYRFFGDYSFHWIDQEAFVSF
FT                   LTEDLELPMNRVGAYLAYVKNSLVPDETPPSPTYSDIPFSDTSNESDEDNALPNVDAVS
FT                   SCSNDDEDEELGDDVDDLVSYSLKYANSRNIDYETRALEFTGKGKKKKLLVNEQLDLDN
FT                   ETMETLQAKLSKRMENKAKKRRLKEDFIDKENMNSDDLFLKYPYGFHVQNIRDEFELFL
FT                   TRNKDRMSFPPLDPHGNKVITKFATCYNIKSSKVGKGNHTHIMVEKVKKTKWSRPNYNM
FT                   VLQLTRQRPVFMRIDVRRPKEDAIKENSGRRGPTAKFHVKEGEVVGENAPEIGQDNIGR
FT                   RMLEKLGWSSGEGLGAHGNKGISIPVMARVKKSKSGLRHSKEDEDTGRSSSFRKK"
FT   CDS_pept        711496..713091
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21045128"
FT                   /locus_tag="CAGL0J07348g"
FT                   /product="Strain CBS138 chromosome J complete sequence "
FT                   /protein_id="CAG60977.1"
FT                   /db_xref="HOGENOM:HBG123647"
FT                   /db_xref="InterPro:IPR021750"
FT                   /db_xref="UniParc:UPI00003B6AC6"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FP18"
FT                   /transl_table=1
FT                   /translation="MSLSVEDQRAEHMRKEAALVALQYAYDEEDKENHPLRETNGHFLN
FT                   HPKTTIPHSTPLVKIDDFNSKYEKEIETLKDQLFSIKNLLGIEDPDSEHSDYELIETSI
FT                   KKMKGQIENALKENRMLKDQAVENASVTSSRISELETKMNELTAQNQTQNELIQSLKKD
FT                   NQLKEEELQQSSKAAEQLTLELDTSKEEIKNLTNERMSNREYIKTFILFGRPIGEIITD
FT                   CLDSSINVLDDSIKKTHADIVSFKTNQDINYTSIQSKAVERLDEIKAILSQLPQQIKDN
FT                   ENLNSEKLNELVSKYNEQNLETIEKVNKTNKISTGINNETLNLITQVNELKSEIQQLHS
FT                   EVEQINNQQFNLQEILQEKEQLQKTVFELQLQLNTERESKMELQQLNDSKDNKLLSITG
FT                   NTNNMLSFEKLKQLDNSFCKEEYVSLKISEIEDISLVQLQNMAKMICMYFRTPFDKLDI
FT                   KLPLAAIQIIHERKILIHFANILNEYFMSKPLSMKKCTDSAYCEWQLSHNIFRIEHPLK
FT                   FKLEELYTTILRST"
FT   CDS_pept        713487..715358
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000193307" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17441142"
FT                   /locus_tag="CAGL0J07370g"
FT                   /product="Similar to uniprot|P53863 Saccharomyces
FT                   cerevisiae YNL227c"
FT                   /function="heat shock protein binding"
FT                   /function="unfolded protein binding"
FT                   /function="zinc ion binding"
FT                   /biological_process="protein folding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAG60978.1"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0031072"
FT                   /db_xref="GO:0051082"
FT                   /db_xref="HOGENOM:HBG382717"
FT                   /db_xref="HOGENOM:HBG522783"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR003095"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR015609"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR022755"
FT                   /db_xref="UniParc:UPI00003B6AC7"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FP17"
FT                   /transl_table=1
FT                   /translation="MKTCYYDLLEVRSDASDLDLKKAYRRKALQYHPDKNPDNVEEATT
FT                   IFAEIRAAYEVLSDPQERAWYDSHKEQILSDTPLNPNDEDDDYVVDSTVTGVTTEELMM
FT                   FFNSSLYTSIDNSPAGFYQIAGKVFAKIAKDEVSWGLRLGLDGYKNYKDMEFEEHINSR
FT                   GYILACDSSKANLSNLLFPIFGYSSTSYEELKLFYTKWSSFNTLKSFTWKDEYMYSRNY
FT                   DRRTKREINKRNEKARAKAKEEYIKTVKRYVNFIKKLDQRMKEGAKKAAEKRLADERLR
FT                   KENEMKLRKERLNNEQGAQFHLQSWQTIDQENWKELEKQYEKEFEKRNVDKDDELIGHE
FT                   FTKNQFQTNNNSQHEDVDEIIIYDCFICKKSFKSEKQLENHIKTKLHKRNLDRVQKEMK
FT                   KDSMALGLDELSDYNDFDSAESETEKLYSGMDLNDIDAELKKIEEQLAQSSVTDSEDFT
FT                   DDNNDTEDQNSLVDKLSNTNYDIEIDDEINDDTNEEVQISGADNSETQNAEQDHDSNGD
FT                   SEEEKEDELTRILRELEESKTSRSNFSDSDEEWSNKKKTKAKKKKNKANTPDKQPVTAN
FT                   KNDAKEVCGECRAEFESRNQLFSHIQTEGHVSPLSKVKKGKRSKKNK"
FT   CDS_pept        716085..717152
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000125742" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18501951"
FT                   /gene_name="URE2"
FT                   /locus_tag="CAGL0J07392g"
FT                   /product="Protein URE2"
FT                   /biological_process="nitrate assimilation"
FT                   /biological_process="regulation of nitrogen utilization "
FT                   /protein_id="CAG60979.1"
FT                   /db_xref="EMBL:AAM91940.1"
FT                   /db_xref="GO:0006808"
FT                   /db_xref="GO:0042128"
FT                   /db_xref="HOGENOM:HBG416344"
FT                   /db_xref="HOGENOM:HBG753188"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR017298"
FT                   /db_xref="InterPro:IPR017933"
FT                   /db_xref="UniParc:UPI00003B6AC8"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8NJR5"
FT                   /transl_table=1
FT                   /translation="MGDSRNTGTISNLSSALRQVNIGSGQDQKNINYEFSNGLNNNVND
FT                   NGNHNLVNTNEDNVNKDGSINTNMMSRQVPIQHTHGSQLLQQERMNEQQFNPMEYSRIS
FT                   KFFQNQPMEGYTLFSHRSAPNGFKVSIVLSELGLQYNTIFLDFNLGEHRAPEFVSVNPN
FT                   ARVPALIDHGLENLAIWESGAILLHLVNKFYKETGNPLLWSDDLADQAQINAWLFFQTS
FT                   GHAPMIGQALHFRYFHTQKIESAVERYTEEVRRVYGVIEMALAERREALIMELDTDNAA
FT                   AYSAGTTPLSQSRFFDYPVWLVGDKLTIADLSFVPWNNVVDRIGINIKVEFPEVYKWTK
FT                   HMMRRPAVIKALRGE"
FT   CDS_pept        717856..718944
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000066075" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20196617"
FT                   /locus_tag="CAGL0J07414g"
FT                   /product="Similar to uniprot|P53861 Saccharomyces
FT                   cerevisiae YNL230c ELA1"
FT                   /biological_process="regulation of transcription "
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG60980.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0045449"
FT                   /db_xref="HOGENOM:HBG058124"
FT                   /db_xref="HOGENOM:HBG202632"
FT                   /db_xref="InterPro:IPR010684"
FT                   /db_xref="UniParc:UPI00003B6AC9"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FP15"
FT                   /transl_table=1
FT                   /translation="MKSLSEICQIHLMRHCNRIEGVNNVPYRLISGILEKLKLDQLRKL
FT                   ESTNVLLLLEDEELWLKLLTNNFPTNVHEIYISKKDKIINYYISYFEEHDPLLVHDNEE
FT                   LLRNWIQQCIKKNPDNGKYRLPYRMLYDKYESDMIEKQEESARRLRQQMRQIEEQRQKK
FT                   QTELIEGKSLAFGTSRRSGSNNERSELFRKSLKDHKDRLQHFKSGGFDVTRRLDDSKRK
FT                   VYNNRVAFGGGSGSINTNRSSIKVSAGNKDERIDTSNQAKPALSPGKETPKENKPIVKK
FT                   RRSEREEPSIFLKNKRPNMIRRVFDTRPSRPEHSNRNTEINTSPVRHRNDTANTSPVRH
FT                   VNVSTETPKIGKRKKSSFFNLK"
FT   CDS_pept        719991..721025
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000176881" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19349778"
FT                   /locus_tag="CAGL0J07436g"
FT                   /product="Strain CBS138 chromosome J complete sequence "
FT                   /protein_id="CAG60981.1"
FT                   /db_xref="HOGENOM:HBG055781"
FT                   /db_xref="HOGENOM:HBG327719"
FT                   /db_xref="InterPro:IPR001251"
FT                   /db_xref="InterPro:IPR008273"
FT                   /db_xref="InterPro:IPR011074"
FT                   /db_xref="UniParc:UPI00003B6ACA"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FP14"
FT                   /transl_table=1
FT                   /translation="MFKKLTGKKEVKKVDESKLISIDKPIKSLPEEIKRPEEEKLTAEQ
FT                   QAKYDEVYKYLTNAELKVGNKEKNPTESSGLIDEERAWLTRECIIRYLKATKWHVKDAI
FT                   DRILGSLAWRREFGINHLGEENGDEVTSDLVAVENESGKQVVLGYENNARPILYLKPGR
FT                   QNTKTSHRQVQHLVFMLERVIDFMPIGQGSLALLIDFKEYSDVPKVPANSKIPPIGVGK
FT                   EVLHILQTHYPERLGKALLTNIPWLAWTFLKLIHPFIDPMTREKLVFDEPFTKYVPMDQ
FT                   LDAIYGGHLNFKYKHEVYWPALIEYSKEKREHYMKRFQKFGSKIGLSEYDLRGTHETPL
FT                   YPVN"
FT   CDS_pept        complement(721367..722224)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000177330" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19349779"
FT                   /locus_tag="CAGL0J07458g"
FT                   /product="Similar to uniprot|P53859 Saccharomyces
FT                   cerevisiae YNL232w CSL4 3 -5 exoribonuclease "
FT                   /protein_id="CAG60982.1"
FT                   /db_xref="HOGENOM:HBG118732"
FT                   /db_xref="HOGENOM:HBG629943"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019495"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniParc:UPI00003B6ACB"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FP13"
FT                   /transl_table=1
FT                   /translation="MSEHLPIDQTVFPGDLICPEIGSEKQEDKLIIYKYTPGRGCSLQK
FT                   YKYNQHSLDAIVSTVVGVVETQEIEPETTETKENNTVTTEGDTDRTVKYVEVRVVPIPK
FT                   DLEVEYKSNKDNNFANNLPKEGDVVLARVTRISAQKVNVEILAVENEPIPLDSGVGSNG
FT                   AGKVAPGGGSGASTFSVSQASSDLGETFRGMIRSQDIRATERDRVKVIESYKPGDIIRA
FT                   QILSLGDGNNYYLTTARNDLGVVFARSDNGAGGLMYAVDWQTMVSPFTGVQERRKCAKP
FT                   FEYE"
FT   CDS_pept        complement(722608..725538)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18501952"
FT                   /locus_tag="CAGL0J07480g"
FT                   /product="Similar to uniprot|P53858 Saccharomyces
FT                   cerevisiae YNL233w BNI4 bud neck involved "
FT                   /protein_id="CAG60983.1"
FT                   /db_xref="HOGENOM:HBG058107"
FT                   /db_xref="UniParc:UPI00003B6ACC"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FP12"
FT                   /transl_table=1
FT                   /translation="MSQGQMRSKNDLLNSTFYSSTSINTMDHAKTFRNSLILNVLSDNS
FT                   IANSTDKDEGNYSTIADDGGDVTYVEDNESDIAVKRDEDSNSSTLSNNESQPNRSNLLK
FT                   KNEIQTINMTTSPSLSALANILQEKSKNADKKMRNSGLLNISEDNEVVENNYTNITNSK
FT                   TVGNSLQQKPQIDLINSPNLIDIDGSQTVNYTQINSNDYDQPDFLTTPKIQPDLGNKPT
FT                   YASNLDCIQESPVQETSNLKQFEHVEIQSMPKQSRSASLPKLEPVSAEQSTITNLKIVE
FT                   AQPQIHVQPISESEVKQESQNDGGHLLEKHRDNHNGDDSNTNFANNGNKYPLTENRNFS
FT                   TTSLPYTTIHSAGQPIKRSVTNEQIKNNLLRKGPRVDPKTRATRTVSTGPVLEQISDYK
FT                   EKKGFFSFLKRKNKSSSASGDKRKNNNKTVHQQENKRAFSNSNNSVVSSPNDVNSGRKK
FT                   EPIKSQSSNTLFSNFRKKKSERNQISNDFDNNELNISKTRIVHAETESQSLLKDGSHFT
FT                   GTESEVNIRKPTPLNIDLQIKNDPELIESTTRQNDEKNDNISEYRESPAFSLPRPDAGE
FT                   ALFPKFLNSFEVDSIVSLERTRSMKSNKRSSITSHRRSLTDTLSINAQNEGMFIKEVGP
FT                   MVISTPDLTKSPASSILRNGMFEPPTISSTIESSPQPAGVVELDHSHDDYGRTQYEYEE
FT                   EQYDTNAFNVENMEAQFNQLISTDDTITNREPIPNLTKKEDLIYEEDEQLITDIMDFAN
FT                   IIDFGDELDVGLGINYNSQELLPNNNKLVESMYDQGTEKETTQQIETRAAEQKSSLTEE
FT                   NEDVFKYKIPQDRIETSLPSPPASTPGNYQVLDNKVIDPNEFENEDFNEIDDSQLEYEQ
FT                   NLHQIDENWATKLRKYEGLGLQEPALNLLQIPETGSHGIPQLKVCFSSEILLFETYGEE
FT                   EYDRRPDIATCNQLTPQLAQMIKAELNEIKDEMEIHEESKCYTHYY"
FT   CDS_pept        complement(726663..727961)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17441143"
FT                   /locus_tag="CAGL0J07502g"
FT                   /product="Similar to uniprot|P53857 Saccharomyces
FT                   cerevisiae YNL234w"
FT                   /function="heme binding"
FT                   /function="oxygen binding"
FT                   /biological_process="oxygen transport"
FT                   /protein_id="CAG60984.1"
FT                   /db_xref="GO:0015671"
FT                   /db_xref="GO:0019825"
FT                   /db_xref="GO:0020037"
FT                   /db_xref="HOGENOM:HBG123649"
FT                   /db_xref="InterPro:IPR000971"
FT                   /db_xref="InterPro:IPR009050"
FT                   /db_xref="InterPro:IPR012292"
FT                   /db_xref="UniParc:UPI00003B6ACD"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FP11"
FT                   /transl_table=1
FT                   /translation="MMSSETSISFMKENSSNMSDSEKNKVLEDIIGESQSLVKGSSKKS
FT                   TTSSSLMDPRMLKLELHLTEREIELIRDSWFIMLNDDLSPQTMAAFYGKLRQNKKISLT
FT                   ANLITNEKFNVMNQQYEENRKRLIKDKSIPYQISNTSTIEGSLFCAQFYENLIAMDQNV
FT                   ERMFPSIRHQAVSFSGVLNTAVDNLENIHVLDSYLRGIGKRHSRILGIKPAYFETMGKA
FT                   FIRTFQDRFGIFFTIELEDIWSRLYSYLANGMIAFGVDPVLPQSIKSTRANSLDTLRTT
FT                   SSGDASLRNSSFSKAQESDTSDFKTYMAQFNCDIVEEDDLDFPIPEILTTETSINENDN
FT                   DVDDVKDMIKNFGFNMNKAEMTHKDSIQVKKTPLDSVNPKSSASSSKDNMSTASSISEK
FT                   TRKKAVLQNKMKKKISAPIETPYKMSKRDCIIM"
FT   CDS_pept        complement(730066..732987)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000113525" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17441144"
FT                   /gene_name="SIN4"
FT                   /gene_synonym="MED16"
FT                   /locus_tag="CAGL0J07524g"
FT                   /product="Mediator of RNA polymerase II transcription
FT                   subunit 16"
FT                   /biological_process="regulation of transcription "
FT                   /biological_process="transcription"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG60985.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006350"
FT                   /db_xref="GO:0045449"
FT                   /db_xref="HOGENOM:HBG058306"
FT                   /db_xref="HOGENOM:HBG202760"
FT                   /db_xref="InterPro:IPR021665"
FT                   /db_xref="UniParc:UPI00003B6ACE"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FP10"
FT                   /transl_table=1
FT                   /translation="MCELNNKRVSWSKTGLIAYADEQSTYGNLCISFLETINGVNCRFH
FT                   PPQRYVIHPQLHEVPLKTETGNGINGASGSSTAQSNIHGTTSVPGSAGKHQHQFFYDIS
FT                   SIHWNNWFSLPGDMLAVCDELGNMTMLIAGQSPDGPTTLDKLTMLFQDNVYKIHNHVMQ
FT                   LEPERENTDSKLERKKTKKEYNTTILDFHWLSSSKPVIVSQFCAFDSSINMYRNKAQQL
FT                   SPHGIFHPPFMKYAGLAIRRNGQLDFWYQFSNSKDHKKITLQLFNPHNERSKGLDFLQY
FT                   AKITSVNNDNSILITTYSRLTGKLSFYKLFVDWNVNTAKPVVLNDPSLKIKHILDATVD
FT                   QTDDEGRILDFTHVHVLAKVVAEKDAAPEVLLAYDVVGTPESLIKRFKLGQVRLPLDYL
FT                   GILKPELNTSNENHNQALRSNRSNLRFLGVLNLHHKVASISSEVLDGFVSFYYRNGEIE
FT                   IYNQNDWKLETERLLNQGPQGKFSNIITSILSAGFKYPTIKNLGTVEWIRVSPAMAGIL
FT                   YKYRHDDLPQFQPMNIDDVSDKSKDEINAATMAFGYVTSAHRQLSGEDIALACKQHILK
FT                   IAKIDEKRAKDFTTTLMFNLYNFFNFSPGAPKELMDKIISSRPLQKVMLLQLELGSIFT
FT                   DENTCEMARVILYLKNVSFAFNGVARNLQFAIEQMTNSTNSSNPPLSGDKFFQTAFSKQ
FT                   DLVHSLIPVTKWFVKFITYLIQQILILTNDPENPDNRLVLGVFGAKIPRTLILTILKEI
FT                   KNVTAIITKFPETNYPILNESSTYLKMLLIESPINFEKFETFLMDVNNKLSAFSEQQPS
FT                   IMREPTLLVRSSVPNELNKITEFLLQYSSNTVISHADASAIYFSDTSGLRISCDEFFEP
FT                   GVHRLLQPIEDGIVIDEKNMPATFRDSKTFTKLTYDGITYDRFSKEELSDNKLKRCNRC
FT                   GAVTKAGYPIPTNKTIVPTSISTRRWPTMYTRMCICLGMLYEL"
FT   CDS_pept        complement(733686..736055)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000192536" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21045380"
FT                   /locus_tag="CAGL0J07546g"
FT                   /product="Strain CBS138 chromosome J complete sequence "
FT                   /function="serine-type endopeptidase activity"
FT                   /biological_process="proteolysis"
FT                   /protein_id="CAG60986.1"
FT                   /db_xref="GO:0004252"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="HOGENOM:HBG153135"
FT                   /db_xref="HOGENOM:HBG715943"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR002884"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR022398"
FT                   /db_xref="UniParc:UPI00003B6ACF"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FP09"
FT                   /transl_table=1
FT                   /translation="MKWWNKGCIYLAYIALISKNSNAELIPAKNFTSRDYFAVESHLSA
FT                   AELSKLHPDWTFEHLVRGLDNHYVFSVAKSENEDDIDSGNSLRKRAIENEDHILSSEFL
FT                   TPSNKLQKRMPVPAPPLDSSMLPIQEIKDKIGINDPLFPKQWHLINPAFPGNDINVKDV
FT                   WLQNITGKGVVAAIIDDGVDYTSPDLKDNFCKEGSWDFNENQQLPMPLLSDDNHGTRCA
FT                   GEIAAIRNNNYCGVGVAYDAKVSGIRILSGPLTAEDEAASLVHALDVNDIYSCSWGPTD
FT                   DGKHLQGPSPLVKKAMKKGVTEGRGNKGAIYVFASGNGGMHGDNCNYDGYTNSIYSITV
FT                   GAIDHKGLHPPYSESCSAVLVVTYSSGSGEYIHSTDINGGCYDRHGGTSAAAPIAAGIY
FT                   ALVLEANPNITWRDMQYLSILSSETIENNLEDGDWQTTKLEKKYSHKYGYGKLNAHNIV
FT                   ALAKDWENVNPQVEFATDIKEVNEETDKEDKPIESTIEITASDLEKAKFRSVEHVTINV
FT                   DISTENRGTTTIDLISPFGVVSHLGVVRRKDDSNEGFRDWTFMSVAHWGELGSGEWKLI
FT                   VKTTSDDDKVEFHSWSITLFGLSEYSEQKLKEGDIPSENDDDNRKEDGPETDNNNVTEE
FT                   TGSDQQPETENPENDGDNGTDKNTGHHMTPTIPTGVHLIVSIFIIGCVFLLLHFMFFVR
FT                   TRRRIKRVRASNYDYDVIDTDAEYDSTNESSSTPLPDTFRLSDIDDNEFDISDEENTQY
FT                   NHLFNNDESLDQRLLDSDNPEQNPTGEQAQTHSSDT"
FT   CDS_pept        complement(736677..738077)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000064089" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17441145"
FT                   /locus_tag="CAGL0J07568g"
FT                   /product="Strain CBS138 chromosome J complete sequence "
FT                   /function="cysteine-type endopeptidase activity "
FT                   /biological_process="proteolysis"
FT                   /protein_id="CAG60987.1"
FT                   /db_xref="GO:0004197"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="HOGENOM:HBG028494"
FT                   /db_xref="HOGENOM:HBG350935"
FT                   /db_xref="InterPro:IPR000169"
FT                   /db_xref="InterPro:IPR004134"
FT                   /db_xref="UniParc:UPI00003B6AD0"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FP08"
FT                   /transl_table=1
FT                   /translation="MYRLRSLIRPIRKYSMSRSLAIDEIASWDKELSKDLHHQLATTVL
FT                   KNINADDALLNKTRLQEQDVRVFNTKLSVDCTPVTNQRASGRCWLFAATNHLRVNVVKE
FT                   LQLKDFELSQAYLFFYDKLEKANYFLDQITQSHEEPVDSRLVQYLLTDPTQDGGQYSMF
FT                   LNIVKKYGLIPKDLYNDAAYSTTASRKWNSILTSKLREFAETIRETLKTKDVESKEFKE
FT                   LRTSMQKEIFRLMTLFMDLPPVKPDEKFTWTYQDKDKKVHTIESTPLEFASKYAKLDAA
FT                   KPVSLINDPRNPYGKLIKIDRLGNVIGGEETLYLNVDNKTLTDLIVKRLKNDKPVFFGS
FT                   HTPKYMDKKTGVMDIDLWNYHAIKYDLKQSKASRIEYHESLMTHAMLITAAHVDDDGNP
FT                   VRFCVENSWGKDSGKDGMYVMTPEYFEEYCYQIVVDIDELPTDLAEKFDDKEPIVLPIW
FT                   DPMGALAE"
FT   CDS_pept        738538..740193
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000191744" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17441146"
FT                   /gene_name="NAR1"
FT                   /locus_tag="CAGL0J07590g"
FT                   /product="Cytosolic Fe-S cluster assembly factor NAR1 "
FT                   /function="4 iron, 4 sulfur cluster binding"
FT                   /function="metal ion binding"
FT                   /biological_process="iron-sulfur cluster assembly "
FT                   /protein_id="CAG60988.1"
FT                   /db_xref="GO:0016226"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="GO:0051539"
FT                   /db_xref="HOGENOM:HBG139107"
FT                   /db_xref="HOGENOM:HBG738660"
FT                   /db_xref="InterPro:IPR004108"
FT                   /db_xref="InterPro:IPR009016"
FT                   /db_xref="UniParc:UPI00003B6AD1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FP07"
FT                   /transl_table=1
FT                   /translation="MSALLSEDYLNDYISPALACTKPTEIKKEKFVTEDGEFQVGVEPQ
FT                   ELEKVTISLSDCLACSGCITSSEEIMLSQQSHSVFLDAWRELGFDKCGSAGDAQCTNKL
FT                   VVSISPHCRASMARYYGVDVDAADYAILRVFKEVFHATSVIGDGAGRLLSVKRVVEELM
FT                   ERRKASQGTALSSICPGFLIYTEKTKPKLVPMLLNVKSAQQVTGALFKEIALEEGYDVD
FT                   TSLKDGKRTNVQYHLTIVPCFDKKLEASRPDGEGEVNCVITPREVLAMLGEMGVSFRKY
FT                   LGDWASLDKQLQQSQLGMLRAEMSPAGWDPLLHWSIPANGDGYSDGYAYQYACTVRDAH
FT                   VASGCAAQVVSVPGKNADVLEYRVVEPSSEGGKVIARACVLSGFRNIQNLCRKLDPSGH
FT                   KKRSVRRVAALRSRGRKDSSSEDSTGTPSAISNALGGTANPAECDYVEVSACPSGSING
FT                   GGLLMELAPEREEMGETPLPSSTIGGNARRRQQQLQELQAMYKAQIRITDETPTSLPPA
FT                   ALPPLPPQYTMQYTFYIQEEDPAKPDIVTVGNTW"
FT   CDS_pept        740949..742451
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000046192" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18501953"
FT                   /locus_tag="CAGL0J07612g"
FT                   /product="Strain CBS138 chromosome J complete sequence "
FT                   /function="binding"
FT                   /function="glucose-6-phosphate dehydrogenase activity "
FT                   /biological_process="glucose metabolic process "
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAG60989.1"
FT                   /db_xref="GO:0004345"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0006006"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG211646"
FT                   /db_xref="HOGENOM:HBG322449"
FT                   /db_xref="InterPro:IPR001282"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR019796"
FT                   /db_xref="InterPro:IPR022674"
FT                   /db_xref="InterPro:IPR022675"
FT                   /db_xref="UniParc:UPI00003B6AD2"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FP06"
FT                   /transl_table=1
FT                   /translation="MSEPVKFEKNTVVVVFGASGDLAKKKTFPALFGLFREGYLHESTK
FT                   IIGYARSSLTVEELTERIKPHLKTPRGKEDEAKIPQFFKLLTYVSGPYDQDDGFIRLRE
FT                   QIETFEGAKCSTVPHRLFYFALPPSVFLPVATNIKRLVYAENGVTRLIVEKPFGRDLET
FT                   ARKLQADLSPLFKEEEIYRIDHYLGKELVKNLLVMRFGNQFLNSAWNRDNIQSIQISFK
FT                   EPFGTEGRGGYFDNIGIIRDVMQNHLLQVLTLLTMERPVSFDPEAIRDEKVKVLKAMAP
FT                   FDPKDILIGQYGKSEDGSKPAYLDDETVKPGSKCVTFAAIAFQIENERWEGVPIVMRAG
FT                   KALNEGKVEIRLQYKAVASGVFKNIPHNELVIRIQPNEAVYMKFNAKTPGLSNATQVTD
FT                   LDLTYSSRYKDFWIPEAYEALIRDALLGDHSNFVRDDELDVSWSLFTPLLNYLEGPDAP
FT                   QPEIYPYGSRGPSGLRDYLKKHNYMIEEKHPYTWPVTTPDED"
FT   CDS_pept        complement(743067..747830)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18501954"
FT                   /gene_name="ATG2"
FT                   /locus_tag="CAGL0J07634g"
FT                   /product="Autophagy-related protein 2 "
FT                   /biological_process="autophagy"
FT                   /biological_process="protein transport"
FT                   /cellular_component="late endosome"
FT                   /protein_id="CAG60990.1"
FT                   /db_xref="GO:0005770"
FT                   /db_xref="GO:0006914"
FT                   /db_xref="GO:0015031"
FT                   /db_xref="HOGENOM:HBG058208"
FT                   /db_xref="InterPro:IPR015412"
FT                   /db_xref="UniParc:UPI00003B6AD3"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FP05"
FT                   /transl_table=1
FT                   /translation="MAFWLPQNIQRRLILYVLQQITLFSNVDITKLDVSLGSHSKFTFQ
FT                   DVDLNISEMNISGCEVNSGMLGKLMLGLTVSGDVHISGDNIDFMITMINEDDFNDMNSF
FT                   SLAKSFYDLTSSIMQFKPDAHLKNEISGSGSDSPRIPDDYTNPSSAGGNPTTNTYDIIV
FT                   DDTASSTTESDDSSPIDSIPTSRFNIMQQKVIATALAKLKITLQSVRIRINLGKRKDCN
FT                   CLDVVVKRIDMSTSEGHVRNFDANGISIAYINNEPSVVPPNNMDMAESLYFSQADASSI
FT                   YMSALSDANTDIKSLDASVFNSERYELLSINGMSFSFVGISSIDDFAISRIKINLGTLQ
FT                   VNIPFLLKVREDIILTMIFKLISPRHTDKVDVKNSPAYKRFQNELHSNDTNLFSNLAIE
FT                   EILIGLSSNQKIILRAVDLESNEINGINLSVGDIDLVGLDMDWISETRPCFNASFGKSN
FT                   TIIELANTIIRVSEHDLILFLKIYYEIMDFIDFVLSKWKILGVKQVSQLRNDEKFSLNV
FT                   GSLVIEIPLDNSILEINIPNIEHDSLNQDLKLYEVNMTHIVESIKISSLKLKEVSIDLS
FT                   SARKKMKCYNEHFSQYFVFTHYKVQITGIDSQINLKSLWIIGAVIEQFYIASPVQEYPE
FT                   ATNKNSVRFHDNNKRLLSTSLMINKRAILAKYIIELDDIKVCISGFDADQIRHCKFSLQ
FT                   RLLFLNQIDKGLLFNIFQPHVEIKFFSGSLNDIIRSTNIGVSGQPHLILCIFADKKIKV
FT                   SIKDIMIFYQAKWLDSVQRNASLDQEKGQNVEYSELPEFSISIRDSAINFLPFRINPSL
FT                   VILFESIIVTKSGNDALINMHSKVGRFYLTDNYDHLKTTQVMNKTICDSLIKSGYSQIG
FT                   KFEGLSMTLNKKHKIVNCNGCLEKVILSVCSDSFHTLVQLCMDLKVPVTFPDDKKYQPV
FT                   PSVAVDLFETIEENEFNLSNLDNKDIDKSIGSDSDSLHIVNSFLDEVEDFQFHEDYNSG
FT                   TVWSHTTSDTHSSSDILPISLKEEYLDSRRTEVQKHSQSNDRNIISEIDFDIKNADIRL
FT                   YDGYDWRYTRKNVSSAISELEEGLLSGIQRQEQTESELSRTTVFDSICIATKQKDLGNL
FT                   KQIISEQVQGKHDHLNSDKVYLYPSKHYKSLIKANELIFKIKIYDSNSPRNEEFNNHAA
FT                   KLFQITASISTYEVLDNLPTSTWNKFVTLLKKEAWPKSEPMLYFDFMLFKPINSLEATE
FT                   ATINIRSAPLRIHADQYMVDFLLRFFQFNDKRFELIDEYPEILFLQKFKSNTIKLRIDY
FT                   KPNKTSSGMYSGKISDLINLFVLDESKVTLKGVVLHGINGFNELSEQLVKIWGNDVTSK
FT                   QIFNILQGFAPVKSFIALGAGAQTFITVLLAEYKRDRSISRSVKKSGNIFIKTTTGDFI
FT                   KLGAKLAVGTQALLENTEGILSGNATQNRTLADVSQTNKVLDLDSLLQQDQVLIGRNPK
FT                   IRNKSPSAIIIDAADLEESGRPKVVSLYSEQPLDLHKGLEEAYHALEKHIQIAYNTIWQ
FT                   TNQELRGEESRSAKAAAVTIAKAAPVAVIRPMIGATEAIAKTLQGIYNQLDKSNIEEIN
FT                   DKYKKEDN"
FT   CDS_pept        complement(748336..751194)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000193921" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17441147"
FT                   /locus_tag="CAGL0J07656g"
FT                   /product="Strain CBS138 chromosome J complete sequence "
FT                   /function="actin binding"
FT                   /function="phospholipid binding"
FT                   /protein_id="CAG60991.1"
FT                   /db_xref="GO:0003779"
FT                   /db_xref="GO:0005543"
FT                   /db_xref="HOGENOM:HBG252635"
FT                   /db_xref="HOGENOM:HBG326490"
FT                   /db_xref="InterPro:IPR002558"
FT                   /db_xref="InterPro:IPR008942"
FT                   /db_xref="InterPro:IPR011417"
FT                   /db_xref="InterPro:IPR013809"
FT                   /db_xref="UniParc:UPI00003B6AD4"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FP04"
FT                   /transl_table=1
FT                   /translation="MSRKSSEADLQKILKKACSIDESAPKRKHVRACIVFTWDHASARA
FT                   VFSALKSMPFTDHEIQLFKLLIVLHKVIQEGHPSALAQAIKDREWIRSLGRINIGHSPY
FT                   TKLVKEYVRFLMLKLDFHATHKGFKNGTFEYEEYVSLINVSDLDEGYETVLDLMTLQDQ
FT                   LEDYSQIIFASIHSERDSSELRIAALIPLVAESYGIYKFITSMLRGLHAQLNDAEGDAA
FT                   LQPLIEKYDLQHARLFEFYADCSSIKFLTTMVTIPKLPTKAPDVLVDNSNDIETTRKTP
FT                   TPQPKKTPTPEVRKPSPGPREQLKPTRTASTANTLSPMFTANVMIPTVTGAVQQAFPQQ
FT                   QQQIQPDFWVNQQAQLAQEQQRLAQERQQQLALQQQQQEEFQRQLQQTQQEMMNMQMQQ
FT                   QSQHQNDLIALTNQYEKDQALLQQYDQRVQQLEEEISNIDKNANEQIDNKNEQIGSLQD
FT                   QLEMWEKKYESLAKLYSQLRQEHLQLLPRFKKLQIKVGSIQEAVANKEVLEQKLKKKDL
FT                   QLIDAIKERDRLRLDNERLISNKSEDLNSDGVEKFADDRVLPMLDAVLLSGINTIQESV
FT                   FNMDNSLSWSGPLAPASFLLALADNTSERATEFATNFNNLIVDGLVNGDQTAVIHSVSD
FT                   FSVSIATLVTYVNAYTTSLLGENDSESIASMAKKCAREAEFFFEDLLSENLMPYDDEGK
FT                   TDVVINSNVNFQEKLQHLTTTIEKVLQSAPQNKNKEQDPHSQLIATADAIVKSSQPLRI
FT                   TPNVPKPLLTLALAIIDAVVALVQAAVQCQNEIATTTNTPLSQFYKKNSRWTEGLISAA
FT                   KAVGGATDILISTAGELVTDDKEGSPERFAVAAKEVAASTIQLVAASRVKSGVHSKAQE
FT                   KLEECSRAVTEACKELGHTVLVKYNSEAQDDQPMEFTSEHQLKTVEMEQQVEILRLEQS
FT                   LNIARKKLGEIRKHAYFTEQDE"
FT   CDS_pept        752132..752458
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000279813" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19349780"
FT                   /locus_tag="CAGL0J07678g"
FT                   /product="Strain CBS138 chromosome J complete sequence "
FT                   /function="translation initiation factor activity "
FT                   /protein_id="CAG60992.1"
FT                   /db_xref="GO:0003743"
FT                   /db_xref="HOGENOM:HBG012772"
FT                   /db_xref="HOGENOM:HBG522548"
FT                   /db_xref="InterPro:IPR001950"
FT                   /db_xref="InterPro:IPR005874"
FT                   /db_xref="UniParc:UPI00003B6AD5"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FP03"
FT                   /transl_table=1
FT                   /translation="MSIENLKSFDPFADTGDDETAASNYIHIRIQQRNGRKTLTTVQGV
FT                   PAEYDQKRILKVLKKDFACNGNIVKDSEMGEIIQLQGDQRAKVCEFMISQLGLQKKNIK
FT                   IHGF"
FT   CDS_pept        753062..753592
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17441148"
FT                   /gene_name="CWC25"
FT                   /locus_tag="CAGL0J07700g"
FT                   /product="Pre-mRNA-splicing factor CWC25 "
FT                   /biological_process="RNA splicing"
FT                   /biological_process="mRNA processing"
FT                   /cellular_component="spliceosomal complex"
FT                   /protein_id="CAG60993.1"
FT                   /db_xref="GO:0005681"
FT                   /db_xref="GO:0006397"
FT                   /db_xref="GO:0008380"
FT                   /db_xref="HOGENOM:HBG123650"
FT                   /db_xref="HOGENOM:HBG202758"
FT                   /db_xref="InterPro:IPR019339"
FT                   /db_xref="InterPro:IPR022209"
FT                   /db_xref="UniParc:UPI00003B6AD6"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FP02"
FT                   /transl_table=1
FT                   /translation="MGTGDLNLLKSWNPKLVKNRKKVWEKEQRLLEEDEKIRKRQLEIA
FT                   KEKEEEELLAGRDSTKGRKTGLEWMYQDDPTAKEDYLLGKKKLDTTVIKKAEVMEENQT
FT                   PLTKINKTTVIPDAIYSKEDPMARFGTKVKRNKVVKKEPVKPLRGKTTNEPRTDNIKPK
FT                   SDYKKRLQEELDY"
FT   CDS_pept        complement(753637..754425)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000094457" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17441149"
FT                   /locus_tag="CAGL0J07722g"
FT                   /product="Similar to uniprot|P53853 Saccharomyces
FT                   cerevisiae YNL246w"
FT                   /biological_process="nucleosome assembly"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG60994.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006334"
FT                   /db_xref="HOGENOM:HBG058736"
FT                   /db_xref="HOGENOM:HBG398068"
FT                   /db_xref="InterPro:IPR002164"
FT                   /db_xref="UniParc:UPI00003B6AD7"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FP01"
FT                   /transl_table=1
FT                   /translation="MSDKEIVGKAFLDLAKYEEDVAKVEDDIEHYRLKMMQPMVERRDN
FT                   IIKNIPEFWKIVLSQHTSFADFIRASDFKYIDLIDKVKVDWLIIEDPKQYSVGDFRITL
FT                   HFNSIDDDFNEQTVSKVFKLIKGDINEGDTDDETEEERLVSEPVDIQWPKSYDSINPSL
FT                   IEDKHSKEGKKSYRQGMKSFFGWFKWTGKKPGKEFPHGDSLATLFSEDIYPYCVKYYTE
FT                   AQRDLEDEEEDDSEDNSSEEPLDLEVESESEESDKKRRKI"
FT   CDS_pept        complement(754822..757188)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000245252" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17441150"
FT                   /locus_tag="CAGL0J07744g"
FT                   /product="Similar to uniprot|P53852 Saccharomyces
FT                   cerevisiae YNL247w cysteinyl-tRNA synthetase "
FT                   /function="ATP binding"
FT                   /function="cysteine-tRNA ligase activity"
FT                   /biological_process="cysteinyl-tRNA aminoacylation "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAG60995.1"
FT                   /db_xref="GO:0004817"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006423"
FT                   /db_xref="HOGENOM:HBG021772"
FT                   /db_xref="HOGENOM:HBG327651"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015803"
FT                   /db_xref="UniParc:UPI00003B6AD8"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FP00"
FT                   /transl_table=1
FT                   /translation="MVNWSVLKRTVMSAANSKVVQPKWINPAQCSERTQAPVLKLYNSL
FT                   TRSKEVFAPSSGTKTVSWYSCGPTVYDASHMGHARNYVSIDINRRLIQNYFGYDIQFVQ
FT                   NVTDIDDKIIIRARHNYLFEEFVKQNDSETPLNESDEIVKKANDATISYINKNLADVLG
FT                   SSQESVNTFLVAAEKVNHEEAKLKDPKFPMHMTSVQNAISALSNVSKLPRRKFFDGVKD
FT                   VLVPVLDKELGSTINDPEIFRKLPAYWEKQYDSDMAALNVIPPNVTTRVSEYVPEIVSF
FT                   VEDIINNGYAYATNDGSVYFDTVRFDQNEKHDYAKCQPWNKGKLDLINDGEGSLSNFDN
FT                   NGKKSANDFALWKGSKPGEPAWDSPWGKGRPGWHIECSVMASDILGSNIDIHSGGIDLA
FT                   FPHHDNELAQSEAKFDNKQWINYFLHTGHLHIEGQKMSKSLKNFITIQEALQKYTPRQL
FT                   RLAFASVPWNNQLDFKESLIHEVKSFETSMNNFFANVRAHYNDYKSSLEDDSIIVSKKL
FT                   TNLEKDLLEEFKKSQEKVHAAFCDNLSTGQALKTLSDLVTTTNTYITNSGKDLKIEPVI
FT                   SICKYITKILDIVGFPGRPDGLGWVAQASSVSSGSESANQISGSIEEIAMPYVKCLSTF
FT                   RDSVRSMAIAKAQPQEFLKLTDTVRDNDLLNLNVSLDDRNGQSALVKFLTQHEKDEIIK
FT                   LNAEKKQREEEKLKKKLEQQKIKEAKEKERQEKAKVSPLEMFKDTTLYSAWDEQGLPTK
FT                   DKDGNDITKSMTKKLKKQWEQQKKLYEEFNGPLSS"
FT   CDS_pept        757665..758888
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000057118" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18501955"
FT                   /locus_tag="CAGL0J07766g"
FT                   /product="Similar to uniprot|Q01080 Saccharomyces
FT                   cerevisiae YNL248c RPA49"
FT                   /function="DNA binding"
FT                   /function="DNA-directed RNA polymerase activity "
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG60996.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003899"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="HOGENOM:HBG059675"
FT                   /db_xref="HOGENOM:HBG396363"
FT                   /db_xref="InterPro:IPR009668"
FT                   /db_xref="PDB:3NFF"
FT                   /db_xref="PDB:3NFG"
FT                   /db_xref="UniParc:UPI00003B6AD9"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNZ9"
FT                   /transl_table=1
FT                   /translation="MGEKRSIAIDSYQEDPSVVVSNFFKGVRVPKDTEFQLYKKRKQDQ
FT                   FVLHGENERLEYDGETDELTTKTNQYVVGLYDKQSGKINLYRAPVVTSKIVSKFSKNLK
FT                   GPEIKSKGDTRYGAMRNALGEAFGTKKAKKAIADLERNRVDSDKLTDVAIDIVDSVKTA
FT                   SKDLPTRAELQENVSASNRPTPVANLDATDVEQIYPVENIIPKKELQFIRVGPILKEKD
FT                   QEKKLELFPYTSSKYVAKKLETLTQASQMEKLQLLYYLSLLLGVYENRRVSNKDKLLER
FT                   LNSPPELLIDGILDRFTIARGGHFGKSKNRSYFIDPQNEDKLLCFILTIVMHLDNFLVE
FT                   ISPLAQELGIKPSRIVNLFRILGAIVKGATVSQAEAFGIPKSAAATYKIASLKVPFKLP
FT                   ELTRRGRR"
FT   CDS_pept        complement(759175..763092)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000192269" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17441151"
FT                   /locus_tag="CAGL0J07788g"
FT                   /product="Similar to uniprot|P12753 Saccharomyces
FT                   cerevisiae YNL250w RAD50 DNA repair protein "
FT                   /function="ATP binding"
FT                   /function="nuclease activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="DNA repair"
FT                   /cellular_component="Mre11 complex"
FT                   /protein_id="CAG60997.1"
FT                   /db_xref="GO:0004518"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006281"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0030870"
FT                   /db_xref="HOGENOM:HBG035702"
FT                   /db_xref="HOGENOM:HBG396580"
FT                   /db_xref="InterPro:IPR004584"
FT                   /db_xref="InterPro:IPR007517"
FT                   /db_xref="InterPro:IPR013134"
FT                   /db_xref="UniParc:UPI00003B6ADA"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNZ8"
FT                   /transl_table=1
FT                   /translation="MSAIYKLSIQGIRSFDSNDRETIEFGKPLTLIVGMNGSGKTTIIE
FT                   CLKYATTGDLPPNSKGGVFVHDPKITGEKDVRAQVKLAFTSTNGLSMIVTRNIQLLAKK
FT                   TTTTFKTLEGQLVAINKSGERTTLSTRSVDLDSHVPLYLGVPKAILEYVIFCHQEDSLW
FT                   PLSEPSNLKKKFDEIFQAMKFTKAIDNLKAIKKEMAVNIKLLTQSVEHLRIDRDRSRAT
FT                   KMKVKQLNEKINDYQSQVDDVEQELESINGSLDSLFKSNQNFQSVLSRIETLNASISAA
FT                   STQIERLSNSIEKLDMPKVDLENLLKNFSESIEQKELDVKRLESKIASDRQKLENCQKQ
FT                   SNRLMLQQGELTAKKLQNENTLKSFQDTIRQIKDEHKLDLNAEEPPQRNVDHILKKKAD
FT                   MESSVNEAISKLEETKMNLKEKSDSIRNSINLEEQKLSYYESDIKQLATKLDQKQKQIS
FT                   SIPADIEEQLKAKKAVWSKLSKELQEFEKENNITDINNQIKSNNEELSKSELLAQQIET
FT                   DLQNYSKKSELSTKLSVLIENMDEKQNEINKITTALLNDTMIKEWGLDDVKQLSFEFKT
FT                   HYIALQKNIATNLKAFNEISKSQTELEYELNTCKGKVNNLQHKKEKLILNINSVLPEDC
FT                   SIEDYDDVLLETEVSYKTALENLKMHQTTLEFNRKALEVAINNDCCYLCSRSFENTEFR
FT                   SKILKELKEKTDTKFEESLKTTLEDEKEYLNNLRLAEKDIYNLNSISSESKALQDRISQ
FT                   LSKELDNKKSEVAEANTTIEKLKEKRDHCDNYIKPKMDKIDYLQKEIYNHEEEKNSLND
FT                   VIRSSAENGDSVTMEQLQDNQKSTRELIWKIRSEIESLQEQRENISSKNNTLINQIRQA
FT                   NDDVAEIEKQFDMKVTIQEQIANDKKHIEELTNSKESIKLHINDLSKSVEMLNKENSEK
FT                   ISTLDKDAKRKKGEFQSFNELVLQVNQLHHQLMQYNTSDEQHLQECERSIKELEKEMNI
FT                   LKNGLEADNHVLNEQSQKLYDSTGEKRNLLQNIELIDLKEQLLSMNNELSSLNAQNAEA
FT                   ERDKYQQESARLRTQYERLSAQNAGKLGEIRQIQNQIDSLTQQLRSDYKDIDDKYQKEW
FT                   VELQTRSFANDDIDTYSKALDSAIMKYHSLKMEDINRIIDELWKRTYTGTDIDTIKICS
FT                   DEVGSTTKGKSYNYRVVMYKQDAELDMRGRCSAGQKVLASIIIRLALSETFGINCGVIA
FT                   LDEPTTNLDEENIESLAKSLHNIIEFRKHQKNFQLIVITHDEKFLNHMNAASFTDHFFR
FT                   VKRDDRLKSLIEWVDINKVTE"
FT   CDS_pept        764042..765856
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248757" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18501956"
FT                   /locus_tag="CAGL0J07810g"
FT                   /product="Strain CBS138 chromosome J complete sequence "
FT                   /function="nucleic acid binding"
FT                   /function="nucleotide binding"
FT                   /protein_id="CAG60998.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="HOGENOM:HBG191368"
FT                   /db_xref="HOGENOM:HBG202756"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR006569"
FT                   /db_xref="InterPro:IPR008942"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniParc:UPI00003B6ADB"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNZ7"
FT                   /transl_table=1
FT                   /translation="MSGDSEHQEFVETLESFHDLKTGISGSRIKKLTTYALEHVASEEQ
FT                   LISLIINYSRTCESSHKLGSLYIIDSIGRAYLDEARSGTVDTPAPAGTAAHAVATLGEV
FT                   IQELLSDALEKSNQDHKEKIKLLMDIWDRSALFQKECINSVRNKFFPTPTSSANKSIDD
FT                   DMVQLPNDPSERADKILETLKPIDIVPAVSLPSGLFSDVEHDQKRALVQLLVSIQKQYE
FT                   EDPRLSKQDSAAQPVPQSRRDENRQSRHVITEYGSRREREREREKNNRRNRSRSPKRDT
FT                   MNYGGDSAPSRYQNMPPVNNSNYNLGAPNMNFGVNNHHLYPDEVNVPANPHYRNKTVTF
FT                   EPSIPPDHIKVYSRTLFLGGVPMNMKEWDIANVLRPYSEVQSVILNNARKHAFVKVYSR
FT                   QEAENALLNFNKDGSLPLRTRWGVGFGPRDCCDYQHGFSIIPLHRLTDADKKWSVSAQW
FT                   GGTGGQPLTSGIAFEEPDIVVGEGVSSKAISQKMPTDSGRNGPRSNKAKNMAPQYGPPQ
FT                   AAVISPSQGYAGMQQGYPQQQQQQQMGMYGQPMMQQPINAYASPAQQQPIMQAPPPPAP
FT                   PSQQQQSSNYDPTAQLNSLMNILNQQQQ"
FT   CDS_pept        766589..767386
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248758" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17441152"
FT                   /locus_tag="CAGL0J07832g"
FT                   /product="Similar to uniprot|P36528 Saccharomyces
FT                   cerevisiae YNL252c MRPL17"
FT                   /protein_id="CAG60999.1"
FT                   /db_xref="HOGENOM:HBG059673"
FT                   /db_xref="HOGENOM:HBG397503"
FT                   /db_xref="InterPro:IPR021757"
FT                   /db_xref="UniParc:UPI00003B6ADC"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNZ6"
FT                   /transl_table=1
FT                   /translation="MLSVRGLATAAKATGSPAVKVGLILSRVPLVSPEKSELESSYYKY
FT                   MSELERRLMWTFPAYFYFKKGTLSEHRFYAAQKGPISKQEGVWFPKGVPDIKHGRERSQ
FT                   KQTINLPKSKQQEGQASDDISRPIIANSIVTEADKNNDLTSLERSLRRTLYLLIKDKKG
FT                   IWKFPNFDIGEEKSLHRAAEKGIREIGGENMNTWTVSRTPAAVLKDDPKSSQFLIKSHI
FT                   LMGRFDIQDKRILSDFAWLSKDEIKGKVEKNYYEKISFLLSDI"
FT   CDS_pept        complement(767587..768885)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000057113" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19349781"
FT                   /locus_tag="CAGL0J07854g"
FT                   /product="Similar to uniprot|P53851 Saccharomyces
FT                   cerevisiae YNL253w"
FT                   /protein_id="CAG61000.1"
FT                   /db_xref="HOGENOM:HBG123651"
FT                   /db_xref="HOGENOM:HBG202755"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="UniParc:UPI00003B6ADD"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNZ5"
FT                   /transl_table=1
FT                   /translation="MPATAIDSFNNISSKSHEYVNVVENVAVKFLQSAFENEHINAIED
FT                   DRYNHVITRIQSRFKNSLTPNEILAFEFHPAGHSLAYSRIDGSITIWPSIQATFIPGKM
FT                   IHIKDACGTDKLVTSISWNPNEITQLITSCNSDELDIWEYDELNLKASKVRSISVDHKT
FT                   KLNNALFDPTGEYILAITKSDSIYLFSAKDDYRLLHTIKLKSIMSSDTLYSVTWDSSGS
FT                   NIFLGTKNGSIIAMSINKENNEMFKVLEVTAHRFSVTCLKIDPLGRYLFSGSKDGSCSI
FT                   WELRTLICIKEISGLESNILSMDICHLGKMLGLCLEDERVCFCDVTTGKIIYESSLSGS
FT                   NSEPLLRFFPDKTMFILSGKNDTLEKHFYGSGKLSLLSVLSTESRKNGDSKGHSKGISK
FT                   KSSKKSNTDREKSQGPRSTRPNRKSRFLASKRR"
FT   CDS_pept        769398..770417
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18501957"
FT                   /locus_tag="CAGL0J07876g"
FT                   /product="Similar to uniprot|P53850 Saccharomyces
FT                   cerevisiae YNL254c"
FT                   /protein_id="CAG61001.1"
FT                   /db_xref="HOGENOM:HBG123652"
FT                   /db_xref="UniParc:UPI00003B6ADE"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNZ4"
FT                   /transl_table=1
FT                   /translation="MEDSIDLQRESLNKLIPESGSDDTSSSDEVNGLPTSSDGADDVSL
FT                   INSEDLNSSLLKSDPGGTNKSDQTKNDETDSNDDQRIVLSGGVELEEVQETVKVYNNVK
FT                   QALLEVETTDESQLILDKIKRDSQYSSDTECESRDADSELEDIQLEFRSKYPQLQIPYS
FT                   DELCVKIIPYLDIVYDILSGVVTSMYYTRAKRAAMDSKKAFLSAEDFRNLDINLFTAGY
FT                   FGLRRQLKVGNIIYEKFRDELARSKSPKIQWWGPIDFANYVLAPEVLVSFVLDTCQNKR
FT                   SVQLTSRQDVYELFDNTTYYGNTVTDNEPLESWELSRKKRKYGPTNNQKTHKTRKKKS"
FT   CDS_pept        770997..771464
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000186262" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20196618"
FT                   /locus_tag="CAGL0J07898g"
FT                   /product="Similar to uniprot|P53849 Saccharomyces
FT                   cerevisiae YNL255c GIS2"
FT                   /function="nucleic acid binding"
FT                   /function="zinc ion binding"
FT                   /protein_id="CAG61002.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG409440"
FT                   /db_xref="HOGENOM:HBG717773"
FT                   /db_xref="InterPro:IPR001878"
FT                   /db_xref="InterPro:IPR013084"
FT                   /db_xref="UniParc:UPI00003B6ADF"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNZ3"
FT                   /transl_table=1
FT                   /translation="MSQKACYVCGKIGHLADDCDSERLCYNCNQPGHVQSECTMPRTVE
FT                   HKQCYNCGETGHVKSECSIQRCFNCNQTGHVSRECPEPRKGRFGAASKNVSCYKCGGPN
FT                   HVARDCMQTDTKCYSCGRFGHVSRDCPNGPNEKVCYNCNETGHISRDCPVL"
FT   CDS_pept        complement(771900..774323)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000217511" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17441153"
FT                   /locus_tag="CAGL0J07920g"
FT                   /product="Strain CBS138 chromosome J complete sequence "
FT                   /function="2-amino-4-hydroxy-6-
FT                   hydroxymethyldihydropteridine diphosphokinase activity "
FT                   /function="dihydroneopterin aldolase activity"
FT                   /function="dihydropteroate synthase activity"
FT                   /biological_process="tetrahydrofolate biosynthetic process "
FT                   /protein_id="CAG61003.1"
FT                   /db_xref="GO:0003848"
FT                   /db_xref="GO:0004150"
FT                   /db_xref="GO:0004156"
FT                   /db_xref="GO:0046654"
FT                   /db_xref="HOGENOM:HBG052971"
FT                   /db_xref="HOGENOM:HBG754410"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR000550"
FT                   /db_xref="InterPro:IPR006157"
FT                   /db_xref="InterPro:IPR006390"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="InterPro:IPR016261"
FT                   /db_xref="UniParc:UPI00003B6AE0"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNZ2"
FT                   /transl_table=1
FT                   /translation="MSTLVVDKHASDRDHVHVIKLEASAHMGPDMWGQPTEQRCNITMN
FT                   MGTDFSKSSETDDLKYSLNYAVICKDMLKYIGLKNNRWGSVGAMTRDVAQFAMDSWLGI
FT                   NNLNLEVNVPSVHIRSKDIACEVNRSRAAVTEDLQDFIKIQNLRLLTLIGVFTFERKEK
FT                   QFVDLDIKIPWPRNREHHISIKKIVDKIVQHVENSNFKTVEALAENICGIIGHDSYFGH
FT                   NLKDLPISVKVIKLNAITDTEGVGVSCVRKPSELPHYDQKPFSNRSDPKSLDDSFNLPV
FT                   GTNVPLIEGAWNTAFLAFGSNIEPRRQQVERAINLLRENPNVKVKGFSSYFESEPMYFK
FT                   DQSPFLNGCIGIETTLSPHELLELCKDIEYTKLGRVKKFNNGPRTIDLDIIFYLSESGE
FT                   HVLVNDTDLTVPHPRMLERTFVLEPLCELLHPEFTHPVSAEPVFNHLENIYDNENPEDI
FT                   LWKLIPLPSKDGESEKFLKFKNVKVYDEILGISRWRTQSSALAMGVVNTTPDSFSDGSE
FT                   SYLDVNEKVEKVKKMINDGLRLSEQLIVDIGGCSTRPGSTQVSEEEEIERTIPLIKAIK
FT                   ACSDIPFDKVLLSIDTYRSKVAQSAIECGIDIVNDISAGSFDPTMFDVIANNPQIAYVL
FT                   SHIRGDIATMSTKTTYGEPDGTHYVNGRKNTSESTVLIRNIGKEMADRYCLAMKKGVQR
FT                   SQLILDPGIGFAKNAKQNLQIIKQTSLLKNYSYVQDNLSVNFRNIPVLVGPSRKKFLGT
FT                   ITKEDDPSKRDSATSSIAATCVGFDADIIRVHNVRECIQSIKLANELYRSATLT"
FT   CDS_pept        774882..778616
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000057112" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17441154"
FT                   /locus_tag="CAGL0J07942g"
FT                   /product="Strain CBS138 chromosome J complete sequence "
FT                   /protein_id="CAG61004.1"
FT                   /db_xref="HOGENOM:HBG203801"
FT                   /db_xref="HOGENOM:HBG252630"
FT                   /db_xref="InterPro:IPR001849"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="UniParc:UPI00003B6AE1"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNZ1"
FT                   /transl_table=1
FT                   /translation="MAPLEEHHNQRQLRLISVAFKEASIDSPSFRATVNFFHTRVDIFE
FT                   EWIDKSMAFYEKKYTHSYDDFKRTQNSLLSQLLPSPSMLSSGLVSNQGYTPSLVSNFLF
FT                   DFTEYSERIIKALKGNDILNSTPLSELISVAIDPYKACRKSFDYYQTKYDSMLSTFQAA
FT                   NIREVSIDPETTKNDTIHIFTLQKSYIQASLDLIEAIYTLRLQIDKFLLDTMNNMKSDS
FT                   IYSPKDGSRPLDLMPSMNEYMKDYTMWVQNAIDGARALERDIENAKKQAYEYTLSHITP
FT                   SEDINDYDIRTISTNTFVDQNIHINKTPEKSGWLFMKTYVGTPSREIWVNRWCFLQNGV
FT                   FGTLLLSPSKTYVEETDKFGIFLTNIRYKPEEYRKFCFEMKIFNGNNSASQDKRKMIEL
FT                   VFQASSLKELKSWINAFETTRKVVSQLDKNSLNYEIAYKRFSPKYIEFASSTTTKIDQQ
FT                   ITTFDDTTESLFQKYKCAFSEYEVLSVGSEKIFNFQTIITPISTKMTNLAFLADNSVYG
FT                   SYCTNAVVANIWGTTYWSDYSLILSTVPMNEERTTSKPTTRLVSPHDKIIYPKFYPNAM
FT                   KFYDLQFKNLFFSIDQRLSKITEEFLLFKFDAFWCPNKKQKFASTCYLTQYNLYSFINS
FT                   VGFICLTKVNLDDLVSIEKDKATRTLIRIYDSSGLQLRVNVLFTDPEAVALKLQYLLEK
FT                   KASGTNDSIMEIFARFSEIDKEMEEKRNLERANSDSSESVYDSQLVGSKHDHELTFWNI
FT                   TKESAELLNKRKMLQKESSVYFSHNYDIPCKGLMHLLFGDESQAFPKSLFLARKNGTQH
FT                   VNWYWKQKRTNKTGDVILSRKIEFVVDMTDNFLTTSKYSDNNVEELSLEQNIVKAIDNK
FT                   YYEIDQTPVRIKLPFARIMKITTKYIISEAYDPEKSTSENKSKSPRNGSCFQLFFNIDF
FT                   LDCKSGNPVKDLHFLERVYLDWAIHFAGTEFFLFRKVIRFYLEKMGKHGKVIKAMRLCG
FT                   LIGVSDEATNETEKHEVITEKDIGTNKDVNVDPIVDRKQYDARYTLNIISKVLLKRLVY
FT                   RVSNLFFFLFRVIISLFLGSSTVVQSLNRYLLFGLLLSIIVNLYLSGRSTLNFWSVHNA
FT                   EKKFNNFMSDSGKFTMQRSIKIDDLDLLTEYLAIDENNRAYNKFQEYLHDIDHDFKYKT
FT                   TRKDLAVKRNELLVELRILQNMERELVQGEYKRFLLEEVDRCEQALREVPDLFTNDENI
FT                   KSYCENCNDELTRVSRLLL"
FT   CDS_pept        779482..781719
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000112285" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17441155"
FT                   /locus_tag="CAGL0J07964g"
FT                   /product="Similar to uniprot|P53847 Saccharomyces
FT                   cerevisiae YNL258c"
FT                   /protein_id="CAG61005.1"
FT                   /db_xref="HOGENOM:HBG123653"
FT                   /db_xref="HOGENOM:HBG202753"
FT                   /db_xref="InterPro:IPR021875"
FT                   /db_xref="InterPro:IPR021876"
FT                   /db_xref="UniParc:UPI00003B6AE2"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNZ0"
FT                   /transl_table=1
FT                   /translation="MTYADKDHVITELLKDPVYLSRHNSLATHPKDENDLYALETKLEE
FT                   ELHDLKDLKIVSSLVKETQVNLDLMELENCYYSLYNLSKKLKSSRSFLKQSLHFQRSVA
FT                   VHVDELRIKLLSTIYDILATKFWSISESSFEFHPDIKWKEEEFMMKYEEFKSFVSKSFF
FT                   PDNAINNSHWLITDIIHSEEQERMRNKLKDIYINYIDFASLTKAVKDALFSDEYEFEWS
FT                   DNNYTKLLITKRGALCIQKRIESFNNLLSFLEKGISNSDKFKLLTNLGKAIGIEFLRFV
FT                   KSNATGIIDKNANSIKQQTLLLNDRLKTISEQSGAWNFDSDQISKLLNDEILYKSLLLD
FT                   GVLGRAISDVRKLIANESWKSKTKITLKNSEMLNDSKEKEISQDNVGDEWEWNEEEMDD
FT                   DVHNSTSKVPNSKSEDLNDDEDGWADEIDVDLEDEINTKETEPEDDAWNDEWDVEEDIK
FT                   STHSNKNSKSKHFINTTEEVTITELPKKFLNIMEKLLEDARAIDVNLPLTEDFKYKANL
FT                   LQTVFFSISSTKYGNEWWQFYNDMKFTFDQNNDMKRLQELIYNYMETNLQNTKKISKRI
FT                   LSSQLQQFQRNENNPSWNDTLDNFLPFLEEELANITTHITQEDSFRYITRLFSFIFEDV
FT                   IIQNILSWDIISEKNSENISELLKLIITSTQIDSLNTYPKYRELYERVNIVAKLLPLHL
FT                   KEIMEMFYNGDFYLFATEEIITWIKLLFAETPLRKDAIDDIYEIRNTPTED"
FT   CDS_pept        782059..782283
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000038877" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17441156"
FT                   /locus_tag="CAGL0J07980g"
FT                   /product="Similar to uniprot|P38636 Saccharomyces
FT                   cerevisiae YNL259c ATX1"
FT                   /function="metal ion binding"
FT                   /biological_process="metal ion transport"
FT                   /protein_id="CAR58047.1"
FT                   /db_xref="GO:0030001"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="HOGENOM:HBG744819"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="UniParc:UPI00017BD8CD"
FT                   /db_xref="UniProtKB/TrEMBL:B4UN31"
FT                   /transl_table=1
FT                   /translation="MSENQNHYQFDVVMTCSGCSSAVERVLKKLEPDVSHIDISLPQQT
FT                   VDVYTTLPYETILEKIKKTGKEVKSGTTL"
FT   CDS_pept        782640..783128
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000057111" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17441157"
FT                   /locus_tag="CAGL0J07986g"
FT                   /product="Similar to uniprot|P53846 Saccharomyces
FT                   cerevisiae YNL260c"
FT                   /protein_id="CAG61006.1"
FT                   /db_xref="HOGENOM:HBG059678"
FT                   /db_xref="HOGENOM:HBG202752"
FT                   /db_xref="InterPro:IPR019191"
FT                   /db_xref="UniParc:UPI00003B6AE3"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNY9"
FT                   /transl_table=1
FT                   /translation="MNTDELLFLEEQFYQEGYEEGRNENLKNNLIEGKEFGLQVGFQRF
FT                   VLLGQMVGMCDVLDSLQLKNNSLFKNIANVRELISSIELNNKEENVESLEKTLVKLKNK
FT                   FRLILLSFQREFKHNDRKPINFDNFEDLSRAIAGEIKGFVEDEDATDAKTTQDQAQAW"
FT   CDS_pept        complement(783310..784728)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000848" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19349782"
FT                   /locus_tag="CAGL0J08008g"
FT                   /product="Strain CBS138 chromosome J complete sequence "
FT                   /biological_process="DNA replication"
FT                   /cellular_component="nucleus"
FT                   /cellular_component="origin recognition complex "
FT                   /protein_id="CAG61007.1"
FT                   /db_xref="GO:0000808"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006260"
FT                   /db_xref="HOGENOM:HBG059680"
FT                   /db_xref="HOGENOM:HBG202751"
FT                   /db_xref="InterPro:IPR020796"
FT                   /db_xref="UniParc:UPI00003B6AE4"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNY8"
FT                   /transl_table=1
FT                   /translation="MSKSNLVVLFRDYQLELLDSLIDVDSTLTTPNLILQGYSGTGKTL
FT                   TLRKVFELKPDIINVWLDPIEVVSWKPLFQAIARSTQQRLMQKYPGLQDKEYDPMAVEE
FT                   PSFLVKYLIKLFSHYKELPEKIPLYIVYDGFDSLQDLDSQILYKLLKLHELLPNDNAIV
FT                   MKSIYTVRDLNFVNRYSSNAIPMVVFPRYNLDEIIKILILTRAQELVGSSFLVMQLELL
FT                   DECEYTNESLEKVAVNFIQLIVQAFHSYTGNDIYALNDLIDFKWPLYLKNLDKNNILDP
FT                   LALYRANVRLFITTDDSLKNDFNDTYEDYSDTAMTQTYELSNISKYLLIAAYFCSYIET
FT                   KFDIGIFSKRGSKAANSKRKKKEQNPRYLQPSFFYIERLLAIFQSIYPLEIEVPKGSLA
FT                   ALKVDDLMKSNVEVFQNLAELFSLKLITCSSSKNLDVLGNKIKWRVNIPWEIISEIASS
FT                   VSFDISEYFSGVHD"
FT   CDS_pept        complement(785064..791717)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000196287" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17441158"
FT                   /gene_name="POL2"
FT                   /locus_tag="CAGL0J08030g"
FT                   /product="DNA polymerase epsilon catalytic subunit A "
FT                   /EC_number="2.7.7.7"
FT                   /function="DNA binding"
FT                   /function="DNA-directed DNA polymerase activity "
FT                   /function="nucleotide binding"
FT                   /function="zinc ion binding"
FT                   /biological_process="DNA replication"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG61008.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003887"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006260"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG030622"
FT                   /db_xref="HOGENOM:HBG314239"
FT                   /db_xref="InterPro:IPR006133"
FT                   /db_xref="InterPro:IPR006134"
FT                   /db_xref="InterPro:IPR006172"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013697"
FT                   /db_xref="InterPro:IPR023211"
FT                   /db_xref="UniParc:UPI00003B6AE5"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FNY7"
FT                   /transl_table=1
FT                   /translation="MSTARFKRGNGQAGSLSNGYAVTAQQLLQAAKVDDIDAMMGFERY
FT                   VPPQYNGRVDPDRLDQVPGRTGWLVNMHPTLISEEIASGGGSDYNPSAAGIAGVDFYFL
FT                   DEEGGSFKSSITYDPYFFVTVTDDARLNDVEEFLKKYLETCLKDISTLKKEDLKLDNHL
FT                   LGLQKSLIKLSFVNSNQLFEARKLLRPILAENESNKQQRNVFKHSNISNGNGMLSSNVN
FT                   RFASSSVQDKKDAKQYIEDIREYDVPYHVRVSIDKDIRVGKWYKVTHEGFFVWPDKVAF
FT                   ADPVVLAFDIETTKAPLKFPEASVDQVMMISYMIDGDGFLITNREIISEDIEDFEYTPK
FT                   PELQGHVTIFNEVDELAVLQRFFEHIRDVRPTVISTFNGDFFDWPFIEKRASVRGLDMF
FT                   EEIGFAPDSEGEYKSSYCVHMDCFRWVKRDSYLPQGSQGLKAVTQAKLGYNPIELDPEL
FT                   MTPYAYERPQQLSEYSVSDAVATYYLYMKYVHPFIFSLCTIIPLNPDEVLRKGTGTLCE
FT                   MLLMVQAYQGNILLPNKHTDPLERFYDGHLLESETYVGGHVESLEAGVFRSDLATEFKI
FT                   DTSAIDELIEDLPHALKFAVEVENKAKMEDVTNFEEIKEQIKEQLLELKENNKRHEKPL
FT                   IYHVDVASMYPNIMTTNRLQPDSIKTEKDCASCDFNRPGKSCARRLKWAWRGEFYPAKS
FT                   DEYNMIKRALQNETFPNKNKFSKKPYLTFDELSYSEQVAHIKKRLTEYSKKVYHRIKVS
FT                   EIVEREAIVCQRENPFYVNTVKSFRDRRYEFKGLAKKWKGKMSSIDRNDKHGKDEANKM
FT                   VVLYDSLQLAHKVILNSFYGYVMRKGSRWYSMEMAGITCLTGATIIQMARALVERVGRP
FT                   LELDTDGIWCILPKSFPENFFLKLENGKKLFVSYPCSMLNYRVHQKFTNHQYQELVDPV
FT                   KHKYETHSENTIFFEVDGPYKAMILPTSKEEGKGIKKRYAVFNEDGSLAELKGFELKRR
FT                   GELQLIKNFQSDIFKVFLDGKTLEECYASVAAVSNRWLDILDNKGSMLEDEDLVSLICE
FT                   NRSMSKSLKEYEGQKSTSITTAKRLGEFLGEDMVKDKGLQCKYIISSKPHGAPVTERAI
FT                   PVAIFSSDINVKRSFLRRWTMDHSLDNFDIRTILDWGYYRERLASVIQKIITIPAALQN
FT                   VPNPVPRVEHPDWLKRRIAVKEDKFKQSKLERFLSKSSQEPQNRRIKDIEELFHEDDDI
FT                   KRIKLAKVTSRNKNKRNRDVQKNDEESLVLPATMPSMEEDYVSWLSYQKIKWKIQRRDR
FT                   IRRTQLFGKSGETNSRSVLGSMIRKQAEMFANGSWEVLQYRDNYEAGAVDAYVIINGKV
FT                   QVLKIYVPRTLYINFKTDSVPLKKIKNCEVERSNAILPNDARINNDSASPLFKLTLSEQ
FT                   VYLDELEDSGSVLNDESVLGIYESHISPAQKALMDLGTTISFKSKKVGSLGKSLQDGFH
FT                   LKDLTSVGNDRYLSHFDLNVCYLLHIDTNIDYEFFVIFRSWENKLSIFVKKPSNNAQEL
FT                   LESTIIGIFKEQYHKRKDRITKFNKYINLSDNVDMNSNHYTDKKKLFKAINQEFAMIKE
FT                   QKGQQVLLLMQSPFPSLIKKNIRYSTQIPIIELSMNILALPQLNWQNVMINKLCSYIIS
FT                   TSYWVSHLVSLSQHSNVPICNINLEKMDFVIDVIYARRLKLDNIILWWNEQSPLPDHGG
FT                   MENDFDQNTSWIMNDLDFPNINVPDVYDNVVLEVSIENLVVNTILCSTLINEAEGSDLV
FT                   DMNTVDVSDKPVGNNQGIVQDSFSHDALAVLKSLLKEWWDRALEKNITADLLVNSLVSW
FT                   VYSTDSKLFDGSLRYHIHNLTKKSLFQLMNEFNELGSFIVSADRNRLLIKTNKISPETC
FT                   YAYSHYMIKSIRSNPMFTYLDLNIERYWDLLIWMDKYNFSGLSCSQIEEREKQDYTAYS
FT                   NWQIKYYLPRIYQSEFEDWAMIILDSMVKTKRAFLESSYGTQRATQIVTGLTPQSDTED
FT                   ISPLSSFSKEIGKPLLQRVNKLFRNQREFILDPGFSEDYAFPILPGSHIKMDDPLLEFI
FT                   KSLFQILLLSKSTTLEVRQLRKEVLKFLEIREFAKEAEFQNPSDSLVINGILCEYCSYV
FT                   SDLDLCRDGLDGKFQCPRCDKSINDSLLQEHMIQNLAIEYQTYITQDLRCEKCHTVKRD
FT                   LMSTNCNCSGNWVCTTKPEKLSNIVKIYKQVAEFYNYSLVKNALESLY"
FT   CDS_pept        792654..793583
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000201672" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21045381"
FT                   /locus_tag="CAGL0J08052g"
FT                   /product="Strain CBS138 chromosome J complete sequence "
FT                   /protein_id="CAG61009.1"
FT                   /db_xref="HOGENOM:HBG380294"
FT                   /db_xref="HOGENOM:HBG745098"
FT                   /db_xref="InterPro:IPR005578"
FT                   /db_xref="UniParc:UPI00003B6AE6"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNY6"
FT                   /transl_table=1
FT                   /translation="MSYNPYSFQGEATANDRFRHGSQPSMEQGQPLFGAQQASQQQMPP
FT                   QQQQQQQQPGFNFQNPTQSMAFQLGQSAFSNFIGEQNFSQFQETVSKATSANGSLSLYF
FT                   QVTTNYVINKLRVILIPFTNKNWQRIPEAQQGSNGALSFMPPKDDINSPDMYIPIMGLV
FT                   TYILIWNTQQGLKGSFNPENLYYKLSSTVAFVLLDLVILKLGLYLLVSTNSRTTNIVEL
FT                   ICFVGYKFVPLILALFLPSSPIYLKMIVQVYLFIAFGVFLLRSVKFNLFTNTNSDMVTF
FT                   NKATVRKCNYFLFVYGFIWQSILMWLMG"
FT   CDS_pept        794667..795710
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000176881" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17441159"
FT                   /locus_tag="CAGL0J08074g"
FT                   /product="Strain CBS138 chromosome J complete sequence "
FT                   /protein_id="CAG61010.1"
FT                   /db_xref="HOGENOM:HBG055781"
FT                   /db_xref="HOGENOM:HBG327719"
FT                   /db_xref="InterPro:IPR001251"
FT                   /db_xref="InterPro:IPR008273"
FT                   /db_xref="InterPro:IPR011074"
FT                   /db_xref="UniParc:UPI00003B6AE7"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNY5"
FT                   /transl_table=1
FT                   /translation="MGIFSRKKKEATPVNRGDLIPCETMIEAPPKGSPPPKKPADLDAE
FT                   QTKKLAQMLEHFNKPDLVLPVSSTDDTGKTRPISSWEKFFLTRDCFLRYLRAQKWDVPK
FT                   AIKMLTETLVWRREVGITHGEEDEHPLKPEDIAVENETGKEILLGFDYDRRPLFYMKNG
FT                   RQNTESSFRQVQQMLFMMECATTLTPQGVEKMCVLVDFKHYKEPGIITDKAPPISIAKM
FT                   CLHIMQNHYPERLGKCILINIPWFIWAFLKMMYNFLDPATKEKVIFDEPFTNHIDPSQL
FT                   EATYDGRLDFKYNHAVYWPDMNAKIEAIRNKQYERFQKFGAVMGLSEWDLKGDHDELVY
FT                   PVDSIKA"
FT   CDS_pept        complement(796151..797149)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000212737" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21045382"
FT                   /locus_tag="CAGL0J08096g"
FT                   /product="Strain CBS138 chromosome J complete sequence "
FT                   /biological_process="ubiquitin-dependent protein catabolic
FT                   process"
FT                   /protein_id="CAG61011.1"
FT                   /db_xref="GO:0006511"
FT                   /db_xref="HOGENOM:HBG232237"
FT                   /db_xref="HOGENOM:HBG622162"
FT                   /db_xref="InterPro:IPR004854"
FT                   /db_xref="UniParc:UPI00003B6AE8"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNY4"
FT                   /transl_table=1
FT                   /translation="MFSGFGFGNTGSVPIPQEFEDFFRCYPIAMMNDRIRKDDANFGGK
FT                   IFLPPSALNRLSMLNIRYPMLFRLTSNESGKVTHGGVLEFIAEEGRVYLPQWMMETLNA
FT                   QPGSLMKINSTDVPLGQFVKIEPQSTDFLDITDPKAVLENVLRNFSTLTIDDIIEISYN
FT                   NKTYRIKVLEVKPESAAKSICVIETDLVTDFAPPVGYVEPDYKALKAEQDAKRKSAAID
FT                   PVKHSQGSMATRINYSNILNSTDSETIRFAGEGQKISGKPNKTSKGKQDISEIKISLDS
FT                   EPARLDLPEGQLFFGFPLVLPKDENADEEENDKKVFIGEGQSLRKSKKSKK"
FT   CDS_pept        join(797953..797985,798106..798978)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000205346" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19349783"
FT                   /locus_tag="CAGL0J08118g"
FT                   /product="Similar to uniprot|P53843 Saccharomyces
FT                   cerevisiae YNL265c IST1"
FT                   /protein_id="CAG61012.1"
FT                   /db_xref="HOGENOM:HBG340009"
FT                   /db_xref="HOGENOM:HBG739022"
FT                   /db_xref="InterPro:IPR005061"
FT                   /db_xref="UniParc:UPI00003B6AE9"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNY3"
FT                   /transl_table=1
FT                   /translation="MSKAMQQAPYNIRLKTCLKMCIQRLRYAQDKQQALAKQGRREVAQ
FT                   LLGNSKEQKARYRAESLIHDDLHIELLELLELYCELLHARVNILSNIENEVSLIESHTD
FT                   DGINEAVRALVYCTLAAPEVRELTQLRDLLILKFGHEFAKVIIDEKVGVPPKVLKKCDI
FT                   NLPNQDLVDLYLKEIARTYDVPFSLLTDSEDSSSGSDSENESDGGNFKVEEENKKGETD
FT                   KDGKPILAVNNGEEFTGDSEHPIKIRKPRKNSDTLKSELKIPKDVKKSVEVKHSKPKSI
FT                   AKKKDDELEALKKRFDALRR"
FT   CDS_pept        complement(799207..802329)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248748" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18501958"
FT                   /locus_tag="CAGL0J08140g"
FT                   /product="Strain CBS138 chromosome J complete sequence "
FT                   /function="binding"
FT                   /function="inositol or phosphatidylinositol kinase activity"
FT                   /function="phosphotransferase activity, alcohol group as
FT                   acceptor"
FT                   /biological_process="phosphatidylinositol phosphorylation "
FT                   /biological_process="phosphatidylinositol-mediated
FT                   signaling"
FT                   /protein_id="CAG61013.1"
FT                   /db_xref="GO:0004428"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016773"
FT                   /db_xref="GO:0046854"
FT                   /db_xref="GO:0048015"
FT                   /db_xref="HOGENOM:HBG059685"
FT                   /db_xref="HOGENOM:HBG397287"
FT                   /db_xref="InterPro:IPR000403"
FT                   /db_xref="InterPro:IPR001263"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR015433"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR018936"
FT                   /db_xref="InterPro:IPR021601"
FT                   /db_xref="UniParc:UPI00003B6AEA"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNY2"
FT                   /transl_table=1
FT                   /translation="MNIIENRPKNQNQASEEVIEAVNSPTFNVHRCIELLCKNANNIGI
FT                   HFFLCQRLENFPHSELQFYIPQLVQILLTIETESMALEDLLLKLRTENPHFALLTFWQL
FT                   QALLTDLSTDPESYGFQVARRVLNSLQANLFSTDVSEIEKKTKMHENVAPALVMSSMVF
FT                   SCMALPQLAESIEPLVRSQGRRQKSYVFKLAKNLMKDFTRNMTLKNTLHNKSHKKKTKH
FT                   ITQAAPVDIINPTTTKEDVMFRKSKSTEINLDFDMVDNVGQKVFEERISTSIRMPKRKT
FT                   RPTDGMQRTSTDTSIRTLGTSKPQRLRGFDAVSSPEESPRVSQTNTGQNSDESDEETDS
FT                   ESRIPMKTDRFISSMPDLIGNKPRNSGSSYTSLAKSSGGLSRSHSQSVKHDATRNYTNT
FT                   DSRFKELDPSKIPTTVKIKMLKANYFRCETQFAIALETISRSLAQVPTEARLSALRAEL
FT                   SLLNRDLPACVDIPTLLPPNKKGKLHKLVLITANEAQVLNSAEKVPYLLLIEYLRDEFD
FT                   FDPTTPENEEIIKKGNNHSNLIFDLNYITKNRKKFDEDTIFSSTDAIPSKNSRHASSTP
FT                   GEDTSKSNSSVNLLKEEDLGDMSMIRVKNLSDAEAYRSSLVLKRASNVPVLPTDSHDRT
FT                   PELNFSSTMQEFINQGNNLSDSFKSQTDDLADQMRVSAVMLAQLDQSPQQLSETTNQIR
FT                   AQIIASMKEVQDRFGYKDVENLHGKAGERKLENDLITAGISSSYLGEDWATKKERIRKT
FT                   SEYGHLENWDLCSVIAKTGDDLRQEAFACQLIQAMAQIWTSERVDVWVKRMKILITSAN
FT                   TGLVETITNAMSVHSIKKALSKKMIEDGELDANGGIATLKDHYLRMFGDPEGFKFKRAQ
FT                   DNFASSLAAYSIICYLLQIKDRHNGNIMIDNEGHVSHIDFGFMLSNSPGSVNFEAAPFK
FT                   LTYEYVELLGGLDGAPYKKFVQLTKDSFKALRKYADQIVSMCEIMQKDNMQPCFNAGQQ
FT                   TSIQLKQRFHLELTEEETDAFVDNFLIGRSLGNIYTRLYDQFQLLTQGIYS"
FT   CDS_pept        complement(803679..805472)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000261850" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20196619"
FT                   /locus_tag="CAGL0J08162g"
FT                   /product="Strain CBS138 chromosome J complete sequence "
FT                   /function="amino acid transmembrane transporter activity "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAG61014.1"
FT                   /db_xref="GO:0015171"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG492579"
FT                   /db_xref="HOGENOM:HBG522524"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004762"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniParc:UPI00003B6AEB"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNY1"
FT                   /transl_table=1
FT                   /translation="MKFRNILKNEKNEKNEASASTSHASEDIEIIPSRYDNEKFYSATE
FT                   ATHKKKTGSTGFDDTISLTHTLSRSRIPTSMEDEDAEEAEVHDTRVKRALKQRHIGMIA
FT                   LGGTIGTGLFVGISTPLSNSGPVGALIAYIFMGTIIYFVTQSLGEMATFIPVTSSITVF
FT                   SKRFLSPAFGVANGYMYWFNWAITYAVEVSVIGQVIQYWTFKVPLAAWIGIFWVLITLM
FT                   NFFPVKIYGEFEFWVASIKVIAIVGYLIYALIIVCGGSHQGPIGFRYWRNPGAMGAGII
FT                   SSDLGEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPRAINKVVFRIVLFYI
FT                   MSLFFVGLLVPYNDPRLSASSAVIASSPFVISIQNAGTKVLPDIFNAVVLVTVISAANS
FT                   NVYVGSRVLYALAQSGNAPKQFAYVTRHGVPYLGVICTALLGLLAFLVVNHNANTAFNW
FT                   LINISTLAGLCAWLFISLAHIRFMQALKFRGISRDDLPFKAKFMPWGAYYASFFVTVII
FT                   FIQGFQAFAPKFDVSEFFTAYISLILLVVLFAGCQLYYRCRFLWKLEDIDIDSDRREID
FT                   AIVWEDDEPQNLWEKFWAAVA"
FT   CDS_pept        806631..808349
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000261850" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17441160"
FT                   /locus_tag="CAGL0J08184g"
FT                   /product="Strain CBS138 chromosome J complete sequence "
FT                   /function="amino acid transmembrane transporter activity "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAG61015.1"
FT                   /db_xref="GO:0015171"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG492579"
FT                   /db_xref="HOGENOM:HBG522524"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004762"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniParc:UPI00003B6AEC"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNY0"
FT                   /transl_table=1
FT                   /translation="MEIGPSDLKEKSVIQDIDTIIDGNDSDSHNSNTGELGRRKRKTSV
FT                   SSTQYEDLATEKDELLEHHDVKRSLKQRHIGMIALGGTIGTGLFIGIATPLANAGPVGA
FT                   LVAYLFMGTVVFSVTQSLGEMATFIPVTSSFSVFAQRFLSPALGAANGYMYFLSWCFTF
FT                   ALELSVVGQIIQFWTFKVPLAAWISIFWVLLTAFNMFPVKFYGEFEFWIASIKVLALMG
FT                   FLIYSLCIVCGAGKTGPIGFRYWRNPGAMGPGIISSNTGEARFLGWVSSLINAAFTYQG
FT                   TELVGITAGEAANPRKAVPRAIRKVLIRILLFYIGSLFFIGLTVPYNDPKLTSTDSYVS
FT                   SSPFIITIQNAGTRVLPHIFNAVILTTIISAGNSNVYVGSRILFSMAKNGLAPKFLAKT
FT                   TLQGVPYLSVLAISAFGSLSYMELSTGGAKAFNWLLNITGVAGFFAWLLISCSHVRFMQ
FT                   ALKHRGISRDDLPYKALWMPWLAYYAIFFMVVIILIQGFTSFAPHFSGRDFVAAYISVG
FT                   LFLVFWGFFQIYFRCRIIWKLEDVDIDTDRREIESVVWEDDAPKTLWDKFWDFVA"
FT   CDS_pept        809506..815202
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000095244" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17441161"
FT                   /locus_tag="CAGL0J08206g"
FT                   /product="Similar to uniprot|P41832 Saccharomyces
FT                   cerevisiae YNL271c BNI1 regulator of budding "
FT                   /function="actin binding"
FT                   /biological_process="actin cytoskeleton organization "
FT                   /protein_id="CAG61016.1"
FT                   /db_xref="GO:0003779"
FT                   /db_xref="GO:0030036"
FT                   /db_xref="HOGENOM:HBG059686"
FT                   /db_xref="HOGENOM:HBG202749"
FT                   /db_xref="InterPro:IPR003104"
FT                   /db_xref="InterPro:IPR010472"
FT                   /db_xref="InterPro:IPR010473"
FT                   /db_xref="InterPro:IPR014767"
FT                   /db_xref="InterPro:IPR014768"
FT                   /db_xref="InterPro:IPR015425"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI00003B6AED"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNX9"
FT                   /transl_table=1
FT                   /translation="MLKGSNSKSSDGSGSGSNSGLFQNLRRLTTKDRDNRNKSPKRTSL
FT                   DNDNISQRSTKNINVSQAVSSRHGSIDQSRPLNKKSTLNSQNLSQYVNNGKALSPESGS
FT                   NHHRTDSTQSGFKYSYSRRSSGQVSMAPSSMGNINLTRHNTNTSFSSASVLSHGSITNL
FT                   SRFMTPDGKINLTMPSDPYEVESLFEDIMYKRNILQSLPQEKQNELMSYSIEKKWLIVK
FT                   QDLQNEFKRIKASNKGDSRTGMSMPDLGSDPSNSVSPPGPISSSGSSIFSSDVTSTAPS
FT                   TYSRSGKKNIPISKPIAATSTELYHIAERNTSSSTIQSDKANRPPIHYVKKIVDDKLSK
FT                   DEMKDLWVTLRTEQLDWVDAFLENQGHIAMANILMKSIYKTTPKDKVSEPLLDKENAFF
FT                   KCFRVLAVLSQGLHEFTIHSLMTDTIAQGLFSGRLATRKMATEIFVFLLEKKNKKRFES
FT                   VLSSLDKNFIIGQNSHMNESYKKLPQYFTHLTSNSNLKVIQAWLFAVEQTLDGRGKMGS
FT                   LVGASEDYKNAGGENAILEYCQWTMVFINHLCSSSENINQRTLLRRKLENCGILRIMNK
FT                   IKLLDYEKVIDQIELYENNKLDDFNALLESNKKNINVDLQDPVSLMKNLLDACKGTENE
FT                   KTLVSLVQHIFLPTSKLLDEKQDPNKVTKQLKLMDSLVTNVSVTSTEEGSNVNMAIQRL
FT                   YDSMQTDEVARRAILESRTLTKKLEEMEAERDMLVEKLSKAEHGLVGQLEMEVKERDRI
FT                   LAKNQRVMKQLESELEELKKKHLLEKHEQEVELRKMLTILNSRPAKTKEQKKKIGSIEA
FT                   SEKEDLQRALQSGLQKAKKDFKDDSKKFGMTIQPNQRLKVLRMQMESIENEARKLEMTN
FT                   FAEYEKKGLKPPANVQKKSKPISELNKEQRIQKLNELRDKLRRIQMESNDVSKFNVDER
FT                   VNELFNDKKRTALQRLKELETKYKGFGIDFKVEDFTHESTDSSNEGYSSLDPKVYQDKL
FT                   DEITKISEELLQQKNELETTQTSSSESNSDSESSSDSDDSMEDALTNNKDINGTSSNVS
FT                   DLASGSFLDTLTQKYGTGQAEPIQSPVGHYSNRNEKSFVDRMKRNSRVPSYVEELSKKM
FT                   RGNKDHEFEEDDHKNGNQSSDDFDSESKTNMDQDQLLATSAVSPTTSAPPPPPPPMPAG
FT                   LFGANNDNNTGDSDAISVSGTPAPPPPPPPPPFLKDSSPIPPPPMPTMLTPSESTTSLS
FT                   SIPPAPPMMTKDSKKKVVSSPLLPQSPSLFENYPRPQKKLKQLHWEKVESTDNSIWGSQ
FT                   KAEKFADDLYEKGVLSELEKAFAAREIKSLATRKKEDLQKISFLSHDISQQFGINLHMY
FT                   SNLTVNQFVEKVLKCERDFMNTPSVIEFLSKQEIVEVSTNLARNYAPYSTDWEGIKKIE
FT                   DAKAPEKDPNELQRADQIYLQLMVNLQSYWASRMRAIRMITSYEREYNELLAKLHRVDK
FT                   AVGSLQGSDNLKNIFNVILAVGNFMNDSAKQAKGFKLSTLQRLTFIKDADNSMTFLNYV
FT                   EKIVRSNYPEFNNFLIELEPVLEVVKVSIEQLVNDCNDFVQGINNVERSIEIGNLSDSS
FT                   KFHPLDKVLLKVLPNLSEARKKGELLADEMKLTIMEFEQIMQTYGEDYGDKFAKISFFQ
FT                   KFADFIAEYKKAQAQNIKVEEEEAAYERHKKMVEEQQRKAQEDASKLNENSSQTGNSDE
FT                   EEESEDRRAVMDKLLEQLKNAGQVKTDPTSARKRALLRKKIHSSEESESSPLAEMQVGG
FT                   DSLIYSPDAKEQIELEIHMASPTPKTKEDGKLGTGENSNGESPLKKINEDEEIGDRAKT
FT                   LLMELRGSDALMDRNTALDEHKERLRARRKRTDSNKIPSSNRLKFVDEKSPDEEQEEVS
FT                   SSSISTTGIVTAQESPVQIDENED"
FT   CDS_pept        815653..817911
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000057109" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20196620"
FT                   /locus_tag="CAGL0J08228g"
FT                   /product="Strain CBS138 chromosome J complete sequence "
FT                   /protein_id="CAG61017.1"
FT                   /db_xref="HOGENOM:HBG059687"
FT                   /db_xref="HOGENOM:HBG202748"
FT                   /db_xref="InterPro:IPR009449"
FT                   /db_xref="UniParc:UPI00003B6AEE"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNX8"
FT                   /transl_table=1
FT                   /translation="MSDPIEESNRISVQVSTLSTQLIESIDRQSELEKRLRDAQIIINK
FT                   QKHVMHEFETLKQKNKELSDGQQSFEEKIRALSAQLEEEKSKRLAAEKEVDKLGQEVED
FT                   LTASLFDEANNMVSDARREKHDIEIQNSRLQETLKEKDTVLETLNLQLKNLKKVLQTVD
FT                   SESSINANIRSPISTENSTTTSASGNKLTRRQSQLSISHNESPLFSPYVTTLRYDQSLY
FT                   NEFLKFLAVLPSSSSLKATSTESKLLKRLVSDEIQPVLKIDNASGIGWLVRKSLLTSMM
FT                   EGQVVVEPLSGINEAYQLGYETKEHVSQNEGEEMPHMFNFPLNSPPIAVRDPCAFCAEQ
FT                   RDDIIEHARMYVMKTFNKENDGSTTITNSFPLCHWCLMKVRQTCEIFAFLRSLKLGTWH
FT                   LEKVTLNTISKGESLSKFSEVTKSTNGSTSNEEKKSNRKSFIPSLPKGSPKKSSPVVET
FT                   HIDTTKAGQPTSNIQRAWVHLCKLRSMLHWAHVGIWNMEDSISLKMGPITDHPTHSQEL
FT                   LLPVLSESESLNMLEEYVPANDSESFNLKKTETSNTFDFEKSSNDAVDISSNQDINSQT
FT                   KVAPDVNENLKGQPSTGEASTIEPVNIKVDPATIGANVDAKKKNAISGNTLDTAKDTDN
FT                   LSKDKMEAKMIEKDTTEDSKKTTKSSKRTSEIIDQLNDIGSDAKELFGTVEESGKESQS
FT                   DDKQSDKHLNSDETKNGDATMPNEDDMTLDAKEVMRGLNDDDADSSSLDNFDDSKEFQ"
FT   CDS_pept        complement(818234..821764)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000057108" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17441162"
FT                   /gene_name="TOF1"
FT                   /locus_tag="CAGL0J08250g"
FT                   /product="Topoisomerase 1-associated factor 1 "
FT                   /biological_process="DNA repair"
FT                   /biological_process="meiosis"
FT                   /biological_process="negative regulation of DNA replication"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG61018.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006281"
FT                   /db_xref="GO:0007126"
FT                   /db_xref="GO:0008156"
FT                   /db_xref="HOGENOM:HBG059689"
FT                   /db_xref="HOGENOM:HBG202747"
FT                   /db_xref="InterPro:IPR006906"
FT                   /db_xref="UniParc:UPI00003B6AEF"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FNX7"
FT                   /transl_table=1
FT                   /translation="MSDTESPLTVLKARIALLATAIGGPDYTSQIDPPPYQIGDDCLAC
FT                   LKDLKRWFRLVDDNQRRWDVAMAVAEYKILTDDLLPILIDWENKCYLATKLSKGNSDIS
FT                   AHFKNKQYYDKIALNCLQLMVLMTWPLILTEQSSTNQINLYSELKKHQLTYKKAILSVE
FT                   NGKVLKAAIRIAIDVIKLDRLARTPRDNMVLKMVLNFIRNILAIEPGELTITARKNIAS
FT                   KGINSVDTLPPNVTQDDISQSTVISCFKKNKVFPFLLTLGSSMTKEFDQDFINIPLMEV
FT                   MFFLTKDISQDSLLFKSGELDTAQSENHLSKAGQELNDLLQKESQLKKKVIMNTSTRHS
FT                   RFGAMLSIQTLDQKRLTVSGSQNLLDNSKALQKIDDSKKSKGRRPMIRNETDNESLPTN
FT                   LLNVHKKSGTYLPLTISKYLNDFINDFIDSSFNYLLKSVTNYFVTEEDKIISLEKIEYL
FT                   LFFAWFNKYQILRCQVDKDADIMMISESIKETTFILVSSLLRSSYDSKAWAVVHSSMLA
FT                   FNELLKLVNSLKKFEDNEDIEYVLSRLFSDERIQLLSNLPRIASTHSLSFMKTSIELTH
FT                   TVLKILEMYSGDNSLVVESKRRAKKMKSISKEDYERLVNEEGYDPDEAIEILNPGHKTI
FT                   VINFKRVQSSFFHRNTIDLYINTLKRFNELEYSHIKMIISFLYRLFVENNEETLFYRLD
FT                   FIILLKDMLKQDGLPRTSKARTHINDFAKYYLSRLKRKLKSSPAWHVGILFPPLNDGVV
FT                   GYFQKYGEHKMTKESEIYAVQPSQFIPFEQQEMMSENMILDMQIGVLVSTLIDEGSQNL
FT                   VELVRENVQHLIAVFTSHLEVAGENEKTPNNEAFILKEEYDVNPLHYNRHIRALLQLVG
FT                   FEIPILKSDPCFYRGTTEFSRLVKCEESITKYLNIPFETPNGLPSSSYLKQQSEKNNSL
FT                   ESDGWKGNEDYDYTDPNIVPDNEVDDNDYFKDLDKSTNIRKEKRTVGIASKKTQSKNKT
FT                   SRNRKKASFRLPNAIEGKDKQPQENLEVFSKEYISDSDEDDEEILNPVFFENEMYMRWL
FT                   LDKYNGQLPNDKFLSFGRFVNERLSNNGKVVSDFTSLFDGPVPPIDALPLEGITRKGPD
FT                   KTLLTLSRVEINESNQDNENTQVNEQVDETSENLTINKNARNIGISHGHVESEADDDEP
FT                   ITKKRRTSAN"
FT   CDS_pept        822590..823642
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000136700" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17441163"
FT                   /locus_tag="CAGL0J08272g"
FT                   /product="Similar to uniprot|P53839 Saccharomyces
FT                   cerevisiae YNL274c"
FT                   /function="NAD or NADH binding"
FT                   /function="oxidoreductase activity, acting on the CH-OH
FT                   group of donors, NAD or NADP as acceptor"
FT                   /protein_id="CAG61019.1"
FT                   /db_xref="GO:0016616"
FT                   /db_xref="GO:0051287"
FT                   /db_xref="HOGENOM:HBG453194"
FT                   /db_xref="HOGENOM:HBG731446"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI00003B6AF0"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNX6"
FT                   /transl_table=1
FT                   /translation="MAKPIILRLGSLTFAQPQWKEVEEIADVITVDDSMTREQFLKELK
FT                   NPESKLSKVSVITRTVGSASQTGLFDEEIAKALPDSVIAICHTGAGYDQIQVQYFKERH
FT                   IQVANVPEIVSNATADTHVFLLLGALRNFAYGHHNILAGKWQEVTSAAETPFGYDPDGK
FT                   TVAILGLGRIGRAIVDRLKPFGFGKFIYHNRHRLPEDEENGCEYVASIDDFYQQADVIS
FT                   INIPLNTHTKHLVNKEAFDKMKEGVVIVNTARGPVVDEKALIAALKSGKVRGAGLDVFE
FT                   DEPHIPKELLELPQVLTTPHMGTHSVQTRWRMEKLVLDNAISALKTGKVITPVPEIQND
FT                   NWIEEIQPVI"
FT   CDS_pept        complement(823820..825613)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000197283" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17441164"
FT                   /locus_tag="CAGL0J08294g"
FT                   /product="Similar to uniprot|P53838 Saccharomyces
FT                   cerevisiae YNL275w"
FT                   /function="inorganic anion exchanger activity"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAG61020.1"
FT                   /db_xref="GO:0005452"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG053897"
FT                   /db_xref="HOGENOM:HBG324844"
FT                   /db_xref="InterPro:IPR003020"
FT                   /db_xref="InterPro:IPR011531"
FT                   /db_xref="UniParc:UPI00003B6AF1"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNX5"
FT                   /transl_table=1
FT                   /translation="MIIKRHSNMVKQPANLQATSINSMESSLRQPADGPYDLSSTPSDI
FT                   DGEKSALDSDEDSHKSKRRFPKPGIGIWLDLKDRLPWYWQDWTDSWDYRVIPSVVETYF
FT                   NNLLPAIAFAQDMFDRTDNAYGVNEVLLASAMGGIVFGALSGQPLCIVGVTGPISIFNY
FT                   TVYDIIKPLNTNYFGFMFWVYIWSMIFDLILAFGNAVCLLQYVTTFPCDIFGLFINIVY
FT                   LQKGVQILTHQFKDKNGNDDPAAGFANVIVAMAMTVFGTFFKLIKMTPLLTPKLRTIIS
FT                   DYSNALSVLFWSSFIHFGGYLNNVDFQKLPITKAYHPTSGTYRDRSTWLAYESIPVRDV
FT                   FIALPFGIILTLLFYFDHSVSSLMAQKEEYKLKKPSSFHYDFALLGLTTGVSGVLGIPA
FT                   PNGLIPQAPLHTETLLVHDKDEKVIRCVEQRFTNTAQGGLMLVTMSRGLLVCLGQIPQA
FT                   VLSGLFITMGIQGLTGNQIIHRLIWLFTEERKKDKSKLLQNVPKKKLILFLTFSLIGFA
FT                   GEFAITDTIAAIGFPIILLLTVVACLLFPYMFTKEELDILDSNVAQEFTIKNLLMKNIR
FT                   NANFFSNKDEVETDVEHVSSI"
FT   CDS_pept        complement(826640..828139)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000246301" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19349784"
FT                   /locus_tag="CAGL0J08316g"
FT                   /product="Strain CBS138 chromosome J complete sequence "
FT                   /function="homoserine O-acetyltransferase activity "
FT                   /biological_process="methionine biosynthetic process "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAG61021.1"
FT                   /db_xref="GO:0004414"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0009086"
FT                   /db_xref="HOGENOM:HBG055311"
FT                   /db_xref="HOGENOM:HBG692920"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR008220"
FT                   /db_xref="UniParc:UPI00003B6AF2"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNX4"
FT                   /transl_table=1
FT                   /translation="MGRRATNMLKEVDIAELSKTNPFVKLVKGQKIVEVPELVLESGVV
FT                   LNNFPIAYKTWGHLNSRGDNCMVICHALTGSSDVSDWWGPMLGNDLGFDPSRFFIVCLN
FT                   SMGSPYGSFSPLTINEETGRPYGPEFPLCTVRDDVRAHKIVLESLGVKSVACVIGGSMG
FT                   GMLALEWASLYGHGPEKYVHNLVALATSARHSAWCISWSEAQRQSIYSDPKYMDGYYTF
FT                   DEPPVTGLSAARMSALLTYRSRNSFENKFSRRKPSIEQAQKSNRKASAGEGQEATIPSS
FT                   VSEQSLRIHNDGYRSSTPQPRIEFNRNGRNGSVVSDVSSAESIKSASSLTSVSSVTGEA
FT                   KEVKPAQTYFSAQSYLRYQGAKFVNRFDANCYIAITRKLDTHDLARDRPEYDEDIERVL
FT                   ESIDIPSLIIGIKSDGLFTYSEQEFLAEYLPNSRLEKIESPEGHDAFLLEFKLINQLIL
FT                   EFLNKNVKDIMTAPPRQWTGEIGQDEHAGSVFGEAEEVTNW"
FT   CDS_pept        complement(829222..832233)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000057106" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19349785"
FT                   /locus_tag="CAGL0J08349g"
FT                   /product="Strain CBS138 chromosome J complete sequence "
FT                   /protein_id="CAG61023.1"
FT                   /db_xref="HOGENOM:HBG123656"
FT                   /db_xref="HOGENOM:HBG202745"
FT                   /db_xref="InterPro:IPR001849"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="UniParc:UPI00003B6AF4"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNX2"
FT                   /transl_table=1
FT                   /translation="MKRIFSGSKSPDGLPKSPINSPNIGKSILKTSGTFNQDNLTSKSA
FT                   VSPELVPILTLLTAHTHRRYHEGVLLFLQDLKGDGSVGGRKWKEVYAVLIGTQLALWDA
FT                   QELAELNQAERLDVNKVSAKLKEAVSKPTYINFTDSTIKPLGAGDRAVTESGKKLENVL
FT                   IVSSTLKNRYFLQFSNKDSFNEWHAALRLSLYECASLQMAYTGAFLSSRGAKLSDIKVL
FT                   LADVKYDYEDWVSVRFGAGMPWKRCYAVISQPTKKNSLGEINFYESDKKIKKSNSMAKV
FT                   ISAEFLYAIYPSAVQLIDDSTIIKLEGKISFNKKEDPQDTTVFIMPEKHNAVPGYDTVI
FT                   RFLLPAFNAFKLYGRPKKLKADKRDQDSLIFALPVLPHIYYLEVSDLIQLSSSMSSIGW
FT                   DNREWWNQIRGVLQRKLNEGSSGCGSIVEASTFLGSPLLGSNDLFDTSKSIASPRSVSQ
FT                   PLMSGKPGSASNSSESLTNSKDRSRGSPSKGSNQRRIVSEKASSQAKPANYVPTIPPLP
FT                   NNQNQRNFQPSVPAQHINNARDTNKSGKPRDLNIVDSNFNAYGKDHLTVKQDDSKKLSV
FT                   ASDLASLIEKYSDDELEHMTGNEVQGRNYNKLDRRFNDANPRQRGENDASSDEISEMAR
FT                   SINEFGFEHPQKVMKGNFGSSGTLPIQDGPDESNLFDPDYLVQDEAMSIGHNDAYGDFN
FT                   NPYSSKFKGELVSPKIGNNPLPYPAEGGDTPTKQEKTSNNHLNAMENTNLPVNPYDKPK
FT                   NIVPNKQAGYPSQSVQRPSNDLGNSAPVKPGYANTRPNMHTPPPQGVRTGAPSGSYVSP
FT                   NNKMGYANGPNPQQMYRPPAREQFNSGSPNVRGNSSSPVIGQQSPMNPQQHNMRPPPGP
FT                   GTNQMRMSPGSPNMPGQGYPPQQPPYPQNMPMQRPMGGHPQNMPMPPYGYNNAPPNQMG
FT                   GYGYNQRPGFGSPQYPMPNGGMPTGVQSAMGRGPMPQWGQGQAPGGKQRAKVKGGFSQF
FT                   MPPSNTATNPYSNQ"
FT   CDS_pept        complement(833113..834981)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000115701" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18501959"
FT                   /gene_name="PRM1"
FT                   /locus_tag="CAGL0J08371g"
FT                   /product="Plasma membrane fusion protein PRM1 "
FT                   /biological_process="conjugation"
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="plasma membrane"
FT                   /protein_id="CAG61024.1"
FT                   /db_xref="GO:0000746"
FT                   /db_xref="GO:0005886"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG059696"
FT                   /db_xref="HOGENOM:HBG202744"
FT                   /db_xref="UniParc:UPI00003B6AF5"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FNX1"
FT                   /transl_table=1
FT                   /translation="MRNYLLLRDRLTQVWLNKYSITVTILTAKIVLFNYFIIRILRYTE
FT                   KYAISSCNGLDQVNRKVYDDLPIFVNTLGNYMIRKSMLESVEASLRGLEILIDASEGLL
FT                   GFLVDLYLGTYACLLISAVDGAVDVATNTTEHILEAVNNTLIEATRGLDDGLNDLTSLI
FT                   NKGGNRLSSIFKSDNSVAASLSKVNFTVKGLRNIHLSSKINDQLQYMADKVPSFDDLKS
FT                   ETKDLISIPFYHVKREITKVNAESLLPDTKILYLRNNTDTTLYPICGQYIPNIKKVYEH
FT                   LIHILKVGNILVAILGIFIALFMAIPSIQKEYQESKRLNNVQDEVSQYIDNKEFMSSGD
FT                   NSSLNYSPFNDSKFNLAESYQRNFNPIARWMTIKMGKYFGNDETEYSERLQFCMLYIFS
FT                   SRSSTIMAMGLIGLITVAIQLIVIQIISNYLSNTGKVHIQLQASNDEINKMIKSDINLW
FT                   TSLANQYVNGTEANLNTQVFGWITNTTASVNATVAHAVDKIEYILASSFNNTPLYKPMK
FT                   TVVGCAILRKLISVENAMTWINNEAHIKLPRINTTELINIAGHTKMLPSSNESHMFDQV
FT                   EKIVNIARKTALNELYVPLALIGIWLTQIPMALLLSWRRCDTTGKT"
FT   CDS_pept        835623..837626
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000057105" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20196621"
FT                   /gene_name="LCD1"
FT                   /locus_tag="CAGL0J08393g"
FT                   /product="DNA damage checkpoint protein LCD1 "
FT                   /biological_process="DNA repair"
FT                   /biological_process="chromatin modification"
FT                   /cellular_component="cytoplasm"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG61025.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006281"
FT                   /db_xref="GO:0016568"
FT                   /db_xref="HOGENOM:HBG059698"
FT                   /db_xref="HOGENOM:HBG203329"
FT                   /db_xref="InterPro:IPR018622"
FT                   /db_xref="UniParc:UPI00003B6AF6"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FNX0"
FT                   /transl_table=1
FT                   /translation="MLRDKLKLLQAQIEQERSKSNYRVNEVKEEFDKEIQKLRQQLQSL
FT                   EDEKKFLVLESRGINAVNQRIKTSPPEAFSRVSSQHRALNTPDSSHIQEHIPKKRKTEI
FT                   STQPSIVLNPNRVIKDEVSAFFDCLYVHRIVGVELSTIEILNCIKFEHIDEFNYKLLKI
FT                   NKDTSIGSGIVDFLQSCKKNMKLNELVDSVLEHLATLIKAIIINDQELNFSVPFLVALM
FT                   VQTILFRPSAVSVNSLKDLFIFTCDLIRKFQIVLKKPLHKSPLEVDLGPQIFQYELIDN
FT                   LILVYSFDLLESTTKVIRIQQLSETLYMEFFDESLMKSLEAVYKLTLTISFKPVINVIY
FT                   SMVAVFVTITNIMNNDNLSKPFGSSKWWSDLLTRLYQLLGKRILNFHVFDDTNTNNMHI
FT                   DRFFDFYSLLRNMGTNSVSPLLAQLVTRGEIKGIPNIVLKDDIIDKYESKKEKGVLSDN
FT                   LELEKWFVYLKDDILSIIENLMGYFKKDSKITNGEILINLTKLISVEQSQFMDHLIDQD
FT                   TDVFAVRMNLVEHALSIIYRMWKYYEENITQESIKEVESELVMSLWRIIVCKHASKKIC
FT                   KDDLMEHRILINQMENLHLQDTIDLYEDAFEDMPEYIKEELECSINNGTQQKMQVQYDD
FT                   IYIEMARYILESKLTNFISVENTDSLYLSMGF"
FT   CDS_pept        complement(837967..839118)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000245710" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18501960"
FT                   /locus_tag="CAGL0J08415g"
FT                   /product="Strain CBS138 chromosome J complete sequence "
FT                   /function="ATP binding"
FT                   /function="magnesium ion binding"
FT                   /function="methionine adenosyltransferase activity "
FT                   /biological_process="one-carbon metabolic process "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAG61026.1"
FT                   /db_xref="GO:0000287"
FT                   /db_xref="GO:0004478"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006730"
FT                   /db_xref="HOGENOM:HBG443662"
FT                   /db_xref="HOGENOM:HBG444146"
FT                   /db_xref="InterPro:IPR002133"
FT                   /db_xref="InterPro:IPR022628"
FT                   /db_xref="InterPro:IPR022629"
FT                   /db_xref="InterPro:IPR022630"
FT                   /db_xref="InterPro:IPR022631"
FT                   /db_xref="InterPro:IPR022636"
FT                   /db_xref="UniParc:UPI00003B6AF7"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNW9"
FT                   /transl_table=1
FT                   /translation="MGNNRFLFTSESVGEGHPDKICDQVSDAILDACLEQDPLSKVACE
FT                   TAAKTGMIMVFGEITTKAHLDYQQIVRDTIKKIGYDDDEKGFDYKTCNVLVAIEQQSPD
FT                   IAQGLHFDKAIEELGAGDQGIMFGYATDETPEGLPLTILLAHKLNMAMADARRDGSLEW
FT                   IRPDTKTQVTVEYEEKDGRWIPLRIDTIVISAQHAEYISTEDLRSQLKTEIIDKVIPSD
FT                   MLDENTKYYIQPSGRFVIGGPQGDAGLTGRKIIVDAYGGAAAVGGGAFSGKDYSKVDRS
FT                   AAYAARWVAKSLLAAGLCKRVQVQFSYAIGIAEPLSISVDTYGTSSKTDEEIIEIIKKN
FT                   FDLRPGVLVRELNLARPIYLPTATYGHFTNQEYPWEKPKKLQF"
FT   CDS_pept        complement(839669..840472)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000057102" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18501961"
FT                   /locus_tag="CAGL0J08437g"
FT                   /product="Strain CBS138 chromosome J complete sequence "
FT                   /function="catalytic activity"
FT                   /cellular_component="membrane"
FT                   /protein_id="CAG61027.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG123657"
FT                   /db_xref="HOGENOM:HBG203330"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR016118"
FT                   /db_xref="UniParc:UPI00003B6AF8"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNW8"
FT                   /transl_table=1
FT                   /translation="MKVSFGLALEYTRMYSPQLLATVFCSILFLFTEFKLVPRLENKRF
FT                   RLDDKSIGKSHISNELISGFEVITMSALISGLIVVWFCTFGKDSLRKFHGNWTNMKPES
FT                   SSTRGHFFFISVLCLYLILSLNGAVTGCLKLVIGNFRPDFIARCEPALDKASDLTKYYG
FT                   LDICQQQNKRLLYEGLKSTPSGHSSFITSGLGFAYYWQKQFVSSHHTRHIWCIVLILLV
FT                   MMSRITDHRHHWYDVVSGCIIGIAMIAASWRWVFSPRSSTYELPA"
FT   CDS_pept        complement(841369..843774)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000142001" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18501962"
FT                   /locus_tag="CAGL0J08459g"
FT                   /product="Similar to uniprot|P50896 Saccharomyces
FT                   cerevisiae YDR505c PSP1"
FT                   /protein_id="CAG61028.1"
FT                   /db_xref="HOGENOM:HBG059702"
FT                   /db_xref="HOGENOM:HBG203332"
FT                   /db_xref="InterPro:IPR007557"
FT                   /db_xref="UniParc:UPI00003B6AF9"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNW7"
FT                   /transl_table=1
FT                   /translation="MELPSISSTTSISDNADLRNYYEKLLFKNSSGKSLTDLQNRAHRS
FT                   NEDDENKERKFDFINGFKSNKNGIKLEQGRNRMPTFSGLKMTSMDTERKIPTSNFFNSQ
FT                   GQLQQQNHPSQNNNQNNLDPNSNGNYQDIFSNYNMSDKMGNGNDVSNSNSHSSPFSEFA
FT                   LPTLHKYQSNPGQDHMDYSNGNQSAGAWNNPKTALSGFEAQQDRNDGRRSSYISDTLIH
FT                   GQYDIHNNPIPNGIAALRHHSSAAGAMDPFMQVNPSQIYGQMPNQTATVQNTMPYGYKN
FT                   TSNIIPLLNNLNLKGENNYNPQNRSLNNQRFPHQNNPGSRQGQKDIQQYPYNASKQQQD
FT                   QYNSRFNHYNNGSNFENVKSSHLNDGAHQNTSKNHISESSLDFSICKDNYEELQNETGL
FT                   LLLAGRQIVSTPKLHQFYLECGANYFSSKEVFKFADFIKEQLVITNDNENTSSSVLSFL
FT                   DFLKSRNSNYFNKGSKQSNGEENGNLNENGNDPTNGGNASYKPLVLVALKNGKLELLST
FT                   PQTTNLLMKRGDLVIIDGDRGKDLVLVVEPSVDLNLALFVNFLKKKIHFDSLITNRNQH
FT                   ISNDNFIGLLEASKSGETPDINPKLYDVVELTELIIPSKQVLRFATPWEVSTNLHNKFQ
FT                   DELRAMHIARSKLSSLNETINGSQQGEKENDNSNQRSKMALNIKILNAEFQFDRKKLTF
FT                   YYLCEERNDFRDLIKELFKYYKTRIWLCALPNNLEVDTKYYDKDHKELNMYQNMIDGEN
FT                   QMEVQDAPLKSDNSSVLAPPLNKLELDNFQIGVYKELVNQLFKTHFDY"
FT   CDS_pept        complement(844215..845966)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000057101" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19349786"
FT                   /locus_tag="CAGL0J08481g"
FT                   /product="Similar to uniprot|Q04399 Saccharomyces
FT                   cerevisiae YDR506c"
FT                   /function="copper ion binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAG61029.1"
FT                   /db_xref="GO:0005507"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG123658"
FT                   /db_xref="HOGENOM:HBG203333"
FT                   /db_xref="InterPro:IPR001117"
FT                   /db_xref="InterPro:IPR002355"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR011706"
FT                   /db_xref="InterPro:IPR011707"
FT                   /db_xref="UniParc:UPI00003B6AFA"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNW6"
FT                   /transl_table=1
FT                   /translation="MLMYFWFLVNLYVCVASTTHELVFNVASATNRDGRRIISINGRRN
FT                   TYGPQIRVKSGDTINLKVVNNICSAEELVSMETDEQLREYCHTALHFHGLIGIGNELDG
FT                   VPGITQDPIAPGEEFWYNITIPETICGTYWYHSHSSVQYGDGLRGVLLVDCDRYHTYLD
FT                   RILATIDGDPSVLDTNGVMTLSDAKKKLRTGMTEQIITLSDWYNSWNLDINSKIVLSPD
FT                   GTRDPRLDDSLINGKRSTFQVIDIPESTKYALIRFVNSGMSGTQIVNFPNHKIVVFETD
FT                   GVLIKPYVLDTLSMAVGQRYSVVVVKGENEALQMINGCNKMMGYYAKQAWLASKHVAGT
FT                   LTAETSIPRINSLPGLDKLEKYRDFQPVEDEVKGLEVAEKANTTVELSYDYYRDPEIQE
FT                   KYGTGMFLLNGKALSDYFKEPIELPEGKGNVVDIVLNSVEHMRHPWHLHGHRFQVISIG
FT                   KGGEGKFDSREAQQKYREDMEYWETHPEQSPMFRDSINLPGRSFVVLRIRTSEPGDWLL
FT                   HCHVDWHVSKGLGAMFRVKGNAKSDPTTEEATEYANPIKHNKTKVLLIYISIMVCVDIL
FT                   MYYTIMR"
FT   tRNA            join(complement(846299..846337),complement(846218..846262))
FT                   /gene_name="tRNA-Leu (CAA)"
FT   CDS_pept        846742..847881
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000113358" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17441165"
FT                   /locus_tag="CAGL0J08547g"
FT                   /product="Similar to uniprot|Q12405 Saccharomyces
FT                   cerevisiae YOR084w"
FT                   /protein_id="CAG61030.1"
FT                   /db_xref="HOGENOM:HBG202838"
FT                   /db_xref="HOGENOM:HBG253144"
FT                   /db_xref="InterPro:IPR000801"
FT                   /db_xref="UniParc:UPI00003B6AFB"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNW5"
FT                   /transl_table=1
FT                   /translation="MEARVNEKYEREVKTTAAVWPRSRNAVLNPDVDRLCVVYEVFTRC
FT                   TGNGGSKKKKVNLVFCHGSGMNRAIWEYHADRIADLNSNWVVDKIVVIDQVNHGDSALL
FT                   NKGRLGLEFDWFDGARDICKVAEEEFNFMNNYNVIVGHSMGGFQTLAAVAHNPNLFQLA
FT                   IVIEPVIIKDPSQLEPKTEYLFFPPNFYRALTAKMTDNFDSMQEFEEFMEKKSFYVKVH
FT                   PEIRKRLTEFEAIQRPDGSVVTKMKKVHNFMCYATDNTSAKRMVQLMPFIGIPVVSLVG
FT                   ASSRWTPPVNNEYVRTRIPNCKEVSVANGDHLMNLEMPDTIVDYISKHISQYVANPPQR
FT                   SEGDYVLDHNGSLAERNQFLDNSYKHFLNKIRLPQKSKL"
FT   CDS_pept        848348..849391
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000065997" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20196622"
FT                   /locus_tag="CAGL0J08569g"
FT                   /product="Strain CBS138 chromosome J complete sequence "
FT                   /protein_id="CAG61031.1"
FT                   /db_xref="HOGENOM:HBG052798"
FT                   /db_xref="HOGENOM:HBG202839"
FT                   /db_xref="InterPro:IPR006844"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR021149"
FT                   /db_xref="UniParc:UPI00003B6AFC"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNW4"
FT                   /transl_table=1
FT                   /translation="MQMFNFSRLVALLLVLVNVSLALSPKQFNKERLKYKDSIIDLNDR
FT                   NWGRLLANPKESYLVTVFTATGRQYGCTMCTELAEHYETVVRSWFADHPDGISKNDGSK
FT                   SLFFAKVDAVDQNVPELFQKFNVEQVPRIIIYEPGKGDPQYKFLDIQLSGENVVETLIA
FT                   GIKESTDVQDFEIHEEINWSSVTITGVATFATVLLVKKQSTLALKIFTSRYVWGFGTIF
FT                   FIIAMLGGHMFNRIRNTPEAGMDKLKNVIYILPGQISGQYAIETQIVGLLYAVLCALIV
FT                   ALVMVVPNVSKKLSGPENAKETAQVIVTILTAVFIYMFFAAFTKVFEVKYTGYPYTLLK
FT                   LFNFFGK"
FT   CDS_pept        complement(849629..853219)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248700" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18501963"
FT                   /locus_tag="CAGL0J08591g"
FT                   /product="Strain CBS138 chromosome J complete sequence "
FT                   /protein_id="CAG61032.1"
FT                   /db_xref="HOGENOM:HBG059238"
FT                   /db_xref="HOGENOM:HBG398380"
FT                   /db_xref="InterPro:IPR000008"
FT                   /db_xref="InterPro:IPR008973"
FT                   /db_xref="InterPro:IPR017147"
FT                   /db_xref="InterPro:IPR018029"
FT                   /db_xref="UniParc:UPI00003B6AFD"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNW3"
FT                   /transl_table=1
FT                   /translation="MVDEASTSGYKSSQHDEGIMFKGIGEITMSSSRETQDDMLKADKK
FT                   EADGDIKEIAAKQELKVSKNIQVSAGDLVDEFERQRKRAAYVGWKQMGGWEEKDELTLE
FT                   DELMDANSDTLLNNVLPEPLYGDWYHNVAIYFLAGVLSFAVGHFKFSLAPVFFITLFSA
FT                   LYYRTSAKKNRASIRELVQKEFTVQKIEDDYESLEWLNTLLDKYWPIIEPAVSQMVCEQ
FT                   VNDILATNDSIPAFIKALWIAQFTLGIKPPRVDYAKTFPNTDSDVVVMDWGLSFTPHDL
FT                   SDLNAKQMKNYVNQKILVKAKLFGMTIPVTVANVAFKAKTRIRFKLMTPFPHVETINIQ
FT                   LLEIPDIDFVANFMGNNLFGWEILAIPGLMPLAKALARKYAGPILLPPFSLQLNVPQLV
FT                   SESPLSVGVLEITVKNATDLKRVNNMIDTSVDPYITFQMGGKEVARTRTVRDTLNPVWN
FT                   ETIYMLLPSFTDPMTITVYDRREKLKDKILGRIEYNANSLHDKPTQRNVSQQFLRNSKP
FT                   VGKMTMDLRFFPTLSSKKLPDGTVEDAPDLNTGLAKIIVDEGSSIVDKDGSASVEVYFN
FT                   STMVLSTAKGSPKRGVITWGDMYEAIITDRRKARFRFVVKDKNGENINSTLQSLSDLID
FT                   RTQIGQKNIPLAHGNARLTVTTYWKPVMLDVGNKSIAYTPPIGALRVFVNKASNLKNLE
FT                   KIGKIDPYAKILVNGIQRGRTDFDAQTTNPVWNTGVYVALTSPNQRITLECMDVETSNK
FT                   DRTLGQFDIKLNDFFQKNSLDRYDTKVDSTQRQGRLTAKKFSKGVVTYSISFYPTLPVL
FT                   TLEEIQDIESAEKRKAKLDEKRKLLTDGKLSKEEKQKLEEEELEIKEIEEMHNNKRKLS
FT                   LDQLLEHKIGILAISVLSGDVPDIGVYVQSFFDGNAHARFISPKLTSRTINSGWTGDVM
FT                   IKELDNSVVTFKVTRDKFSGKTSDKLCDVTLSTIDLLRESYYKPSILTLSGQHTAKLML
FT                   QVQWFPMDIEDLPPEDLMSNSGDLTIIAKNAENLLSADTNGYSDPFLKFYYNDEDDACF
FT                   KTKTIKKTLNPTWNEKGVIEVRNRVYDVLYLKVMDWDAASADDVIGRATIPLSKIDPHN
FT                   TTTLDVPVVDDEGRDGGIVHLEFQFSPRFVTLTDSEQKTVADAPVKSIGSGLKAGTTVV
FT                   SSGLGSVGKIGKGIGRGLGLKKSKKHNEDD"
FT   CDS_pept        853530..855743
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000199455" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21045383"
FT                   /locus_tag="CAGL0J08613g"
FT                   /product="Similar to uniprot|Q12324 Saccharomyces
FT                   cerevisiae YOR088w"
FT                   /protein_id="CAG61033.1"
FT                   /db_xref="HOGENOM:HBG123659"
FT                   /db_xref="HOGENOM:HBG324192"
FT                   /db_xref="UniParc:UPI00003B6AFE"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNW2"
FT                   /transl_table=1
FT                   /translation="MLKYNPPHSTVLYHTLPVLYTWGLLEQLMSEQLPVDNEGCQPANS
FT                   GYNVEAPTSRQVLRVALNLKYLVDKVVPVTYGCDEIESDHSSVVTPAVVQLALEACGGD
FT                   PEDKKNRDKYRAVVVFALLKVYGWYSQLAATELHNAELYESRGVAAQQLCKIIIDQEEM
FT                   NDLHFMFMQMLLRRYTINENDEDSEPANAIELASDMHCTIVIGSGGFQRCLTWLWRGWI
FT                   IQNRRDPTTFIRDETVSSPYFIDHFNPDRIKTPKYQNLLNIFFSILFLVLYTVVVNGKN
FT                   SVTVSPIDLPELVFYLFTLGNILEEMTKMYYIGAAYFSFWSSFNLTMYSIISVSFVLRI
FT                   LSVAPLKLHNPSEYWDKISYRILSCAAPFVWSRMLLYLESEPFVGVMLVVLKHMMKESA
FT                   VFFVLLVLIMVGFCQGFLGLDSADGHREITGTIMENLTIAVLGLGSFDKFKRFAPPYAE
FT                   ILYYSYYFIVSVILLNILIALYANAYQRVVDNAADEYMALMVQKTLRFIRAPDEDVFVA
FT                   PLNLIELLFSPVFAFLSKAKKSQLSYYVMMVIYSPTLVLVALSEVRTSKRIKYNRLKNL
FT                   PDDANEVDTAWDLTDGYVDEEDTLFTRSHTSGIRATNKKNKFSLQVQREAEAKDPKFSV
FT                   PREWYSKVKHICHKHEQEKCASDDGSNDLSEKVSELLVKLSKVGLSVNSSGSSTLPDEV
FT                   FKEFKTDVEKLGNMVQELNDLKRELKDISDMKSLLKEIVNQKK"
FT   CDS_pept        complement(856102..856728)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000233968" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20196623"
FT                   /locus_tag="CAGL0J08635g"
FT                   /product="Similar to uniprot|P36017 Saccharomyces
FT                   cerevisiae YOR089c VPS21 GTP-binding protein "
FT                   /function="GTP binding"
FT                   /biological_process="protein transport"
FT                   /biological_process="small GTPase mediated signal
FT                   transduction"
FT                   /protein_id="CAG61034.1"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0007264"
FT                   /db_xref="GO:0015031"
FT                   /db_xref="HOGENOM:HBG527536"
FT                   /db_xref="HOGENOM:HBG745225"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR003579"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR013753"
FT                   /db_xref="InterPro:IPR015599"
FT                   /db_xref="InterPro:IPR020851"
FT                   /db_xref="UniParc:UPI00003B6AFF"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNW1"
FT                   /transl_table=1
FT                   /translation="MNNNITSLKLVLLGEAAVGKSSIVLRFVSNDFSENKEPTIGAAFL
FT                   TQRVTINEHTVKFEIWDTAGQERFASLAPMYYRNAQAALVVYDVTKPQSFIKARHWVKE
FT                   LQEQASKDIIIALVGNKIDVLENGTERSVSREEAEKLAEEENLLFFETSAKSGENITDV
FT                   FLAIGEKVPLKTANQANVPNNANENQRVDLTSVVNNPAANSSCSC"
FT   CDS_pept        complement(857192..858865)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000209682" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17441166"
FT                   /locus_tag="CAGL0J08657g"
FT                   /product="Similar to uniprot|Q12511 Saccharomyces
FT                   cerevisiae YOR090c PTC5"
FT                   /function="catalytic activity"
FT                   /protein_id="CAG61035.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="HOGENOM:HBG058329"
FT                   /db_xref="HOGENOM:HBG676973"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR014045"
FT                   /db_xref="InterPro:IPR015655"
FT                   /db_xref="UniParc:UPI00003B6B00"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNW0"
FT                   /transl_table=1
FT                   /translation="MSSLSRIVNLKKSSKLAKGALRVGSRGLHMRPMARLGSSTLLLRE
FT                   LNLALVSGGLMYLTYSYFSEKRNPLEVFKAFKEYSTIHNDGGKLISSSGGSQNSNADFK
FT                   ILSQEEVDRRLRAREQSFFVKRNKGLVRYDVAQLPSNNPIEDNHVEKLITFPSPDGSKP
FT                   LKDREDEAFDNDLYFFGIFDGHSGAFTSAKLSTDLVPYVAHQIADVYQQHNKALTSDYT
FT                   HNMNFDVALEKGFVQLDNDIVYHSLGKLLKEPTNDNMLAALPAISGSCALLAVYNSYES
FT                   TVKVAVTGDSRALIGGLDSNGEWYVKSLSTDQTGDNLEEVQRIRSEHPGEDNVVRNGRV
FT                   LGSLQPSRAFGDYRYKVKEIDGKKLSDLPDHLKLYFRKEPRDFKTPPYVTAKPVVTTAK
FT                   VNDNTKFMVLASDGLFELLSNTEIAALVVKWMEKHSDDTKVKSLSFKKQLPKVKDLSTD
FT                   SESQRPAFRYRKDQSLENMSYFLEDANVATHLIRNALSAGGQNEYVSTLVSIPAPMSRK
FT                   YRDDLTVTVAFFGENNSSVVPDTQTILPNLDATTPVQSKL"
FT   CDS_pept        859191..860210
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000177574" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20196624"
FT                   /locus_tag="CAGL0J08679g"
FT                   /product="Similar to uniprot|Q12000 Saccharomyces
FT                   cerevisiae YOR091w"
FT                   /function="nucleic acid binding"
FT                   /function="zinc ion binding"
FT                   /protein_id="CAG61036.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG296671"
FT                   /db_xref="HOGENOM:HBG737197"
FT                   /db_xref="InterPro:IPR000571"
FT                   /db_xref="UniParc:UPI00003B6B01"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNV9"
FT                   /transl_table=1
FT                   /translation="MPPKKKQQQPAKKKDNVDKTFGMKNKNRSTKVQRFIKQVQAQADP
FT                   AKEEMKRKKLEEKKMREAAEAERRALFGNVADQRIRAGVDPKTVVCALFKMGNCNKGAK
FT                   CKFSHDLNVGRKVEKKDLYQDTRDEKEKDTMDDWDEEKLRKVILSKHGNPRTTTDKVCK
FT                   YFIEAVENGKYGWFWVCPNGGDKCMYKHSLPEGFVLKTKEQRRLEREALENQPKITLEE
FT                   FIETERERLDKSKLTPITMQNFAEWKKKHVIERLNAMKEENSKKKPSGREVVQKLLADN
FT                   KSFDDSSVAETAGTEGTAWDLTEFTEALRKADHADDANIKDYGDGSNPTFEITKKIEA"
FT   CDS_pept        860867..862108
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000190304" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17441167"
FT                   /locus_tag="CAGL0J08712g"
FT                   /product="Similar to uniprot|P31381 Saccharomyces
FT                   cerevisiae YAL022c FUN26"
FT                   /function="nucleoside transmembrane transporter activity "
FT                   /cellular_component="membrane"
FT                   /protein_id="CAG61038.1"
FT                   /db_xref="GO:0005337"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG058509"
FT                   /db_xref="HOGENOM:HBG397208"
FT                   /db_xref="InterPro:IPR002259"
FT                   /db_xref="UniParc:UPI00003B6B03"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNV7"
FT                   /transl_table=1
FT                   /translation="MNHDAIDSLENVGLWKKLSNLEYFTFCMIGIGLLWPWNCVLSAVL
FT                   YFKHSFFQDVTNWAKVFASSMMAVSTITSLVFNVWLANRQRNYTQRVVRGLVWQVMAFV
FT                   VLAIICMVHNMLPMWFSFLFIMVVILFSSVATALTQNGILAIANVFGSEYSQAVMLGQA
FT                   VAGVLPSVVLFGISYIGDSTAAETGEQSQAGIIVYIITTAIVCGISTTLFKFTGIGGQF
FT                   MAIMREESIDVDDNDEQIPFRVLFDKLRLLVLSILLTFVITLIFPVFASTVRSTGLGMK
FT                   DEHYMPLIFTLWNLGDLYGRVLADLPYFQSPSFTPLKTFIYALLRFLHIPFFFYFSSRN
FT                   DGHSVALDIGYMLLQFVFGLTNGHVISLSFMKVPQVLDNDLEKEAAGGFTNIFVSVGLA
FT                   LGSLVSYIFVFLIN"
FT   CDS_pept        862513..864741
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000157526" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17441168"
FT                   /locus_tag="CAGL0J08734g"
FT                   /product="Strain CBS138 chromosome J complete sequence "
FT                   /function="mannosyltransferase activity"
FT                   /biological_process="protein O-linked glycosylation "
FT                   /cellular_component="membrane"
FT                   /protein_id="CAG61039.1"
FT                   /db_xref="GO:0000030"
FT                   /db_xref="GO:0006493"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG026546"
FT                   /db_xref="HOGENOM:HBG332413"
FT                   /db_xref="InterPro:IPR003342"
FT                   /db_xref="InterPro:IPR003608"
FT                   /db_xref="InterPro:IPR016093"
FT                   /db_xref="UniParc:UPI00003B6B04"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNV6"
FT                   /transl_table=1
FT                   /translation="MSSTGFQGSEKSDAELKARKQTSVDDVLIEEKEDTSKLKDAKVSQ
FT                   SPLLQLEAYLMPLVFTGLALFVRMYRIGINGNVVWDEAHFGKFGSYYLRHEFYHDVHPP
FT                   LGKMLVGLSGYLAGYNGSFDFESGHEYPEYVDFVKMRLFNASFSAMCVPLAYFTAKAIG
FT                   FSLPAVWLFTCMVLFENSYSTLGRFILLDSMLLFFTVASVFSFVMFHNQRSRPFSRKWW
FT                   KWLLLTGINLGCTISVKMVGLFVITLVGIYTVIDLLQMLNEKKMSWKSYTGHWLARIVA
FT                   LICVPMAVFMICFKLHFDLLWHSGTGDANMPSLFQAGLVGSDVGGGPRDVAIGSSVSIK
FT                   NQALSGALLHSHVQTYPEGSNQQQVTAYSYKDANNNWVFHRVREESLWDINETDIEYVV
FT                   DGAVYRLVHANTQKNLHTHSIAAPVDKKNWEVSGYGNHTIGDAKDYWVLEIVDQKGSEN
FT                   TTQVHPLTTSFRLRNKELDCYLAQTGNHLPEWGFRQHEISCVKDPFRRDKRTWWNVESH
FT                   ENEKLPTPEEFKYPGSGFLKDFIHLNLAMMATNNALVPESDKFDYLASSAWEWPTLHVG
FT                   LRLCGWGDNNPKYFLLGTPVTTWASSVAVISFMILFVVLLLRWQRQYNDFSNKDDFNLF
FT                   LMGGFYPILGWGLHFVPFVIMSRVTYVHHYLPALYFALIILTYIIDATTKRWMKSKCGS
FT                   IMRLVVFAISIASVVGCFWYFSPISFGMTGPAINYHYLKWVKTWHIHD"
FT   CDS_pept        865291..867792
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000112949" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19349787"
FT                   /gene_name="HRD3"
FT                   /locus_tag="CAGL0J08756g"
FT                   /product="ERAD-associated E3 ubiquitin-protein ligase
FT                   component HRD3"
FT                   /function="binding"
FT                   /cellular_component="endoplasmic reticulum membrane "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAG61040.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0005789"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG123661"
FT                   /db_xref="HOGENOM:HBG202495"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniParc:UPI00003B6B05"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FNV5"
FT                   /transl_table=1
FT                   /translation="MLLSTYLNWASVLLTIAGAESNIDPWDEVSSFLQGKLRKLDVTNP
FT                   NAYDMNDNEQDATFYVSMDYHEEEERSEYESVWQYYNENSDQDWHKSVYDKLQVSADQF
FT                   NNTEAMYKLSQINLWGQYGYPHNKSVAFQYLQKFNDMTSYENSSALFDLAVAYSTGLFG
FT                   TLPVDVARGLLYFQRSARLGDLKAKQVLAYRYFSGYSVARDVDKALLLYKEIAEEIKKK
FT                   YSEEQWNMVFPYIESYIVRIPDFDEGLLGKGLSTVPQSVRRKKTTRPPFAGSSNLKPIG
FT                   DVGYGEVVMQFKFNAGNGNPGSFVISDSEHEDRLVELFYTAWDLYKGTYTRGRDCDKAK
FT                   RLLLQVYKTYDAEVKYMDNLQKFFYVKSLDLLAHMYFTGEGFERPNVQAALDLFDRSEK
FT                   ILEGAEISRTASEVDKGLISQYYFNNTLGALKHYKKAKESGNAHGILFYQLGKLSEKNP
FT                   ELKIGDPYLYMQEASSQQYLPAQYEFAKMVESNELRKYSVEDITRLYKAFVEENENIMA
FT                   PHLRLGFSELLGGSSEVSLYAYAQAAEQGYEAAQISAAYLLYQLPYKFDDPPETTIERK
FT                   TMAISYYTRAFKQGNTDAAVVAGDIYFQMKNYTKALSLYQSAALKFSAQALWNIGYMYE
FT                   HGLGVEKDFHLAKRFYDQILEHNQKLYFAVKASVMKLQLKSWFMWLNGKELDNISIDQE
FT                   QESTVVRPFFDRLVQLLKNLSRETRGDNKKKNQHRILKEKKTPSQGIMERFGLQTEDLL
FT                   TMVCVLIIFAISMFFRTVAPRGQWNVRINGVNIAGGNALGEEGNPENENEEDDENDDEG
FT                   RARARNNFGFGNNFDVQVFAI"
FT   sig_peptide     865291..865347
FT                   /gene_name="HRD3"
FT                   /locus_tag="CAGL0J08756g"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FNV5 "
FT   mat_peptide     865348..867789
FT                   /gene_name="HRD3"
FT                   /locus_tag="CAGL0J08756g"
FT                   /product="ERAD-associated E3 ubiquitin-protein ligase
FT                   component HRD3"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FNV5 "
FT   CDS_pept        868299..869195
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000216895" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21045384"
FT                   /gene_name="SEC131"
FT                   /locus_tag="CAGL0J08778g"
FT                   /product="Protein transport protein SEC13-1 "
FT                   /biological_process="mRNA transport"
FT                   /biological_process="protein transport"
FT                   /biological_process="transmembrane transport"
FT                   /biological_process="vesicle-mediated transport "
FT                   /cellular_component="ER to Golgi transport vesicle membrane"
FT                   /cellular_component="endoplasmic reticulum membrane "
FT                   /cellular_component="nuclear pore"
FT                   /protein_id="CAG61041.1"
FT                   /db_xref="GO:0005643"
FT                   /db_xref="GO:0005789"
FT                   /db_xref="GO:0012507"
FT                   /db_xref="GO:0015031"
FT                   /db_xref="GO:0016192"
FT                   /db_xref="GO:0051028"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG144577"
FT                   /db_xref="HOGENOM:HBG590901"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="UniParc:UPI00003B6B06"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FNV4"
FT                   /transl_table=1
FT                   /translation="MVEIANAHNDLIHDAVLDYYGKKLATCSSDKTIKIFEVEGESHKL
FT                   VDTLVGHEGPVWRVDWAHPKFGTILASCSYDGKVIIWKEENDRWSQIAVHAVHTASVNS
FT                   VQWAPHEYGALLLAASSDGKVSVVEFKENGTATPLIFDAHAIGVNAASWAPATVEGGNN
FT                   PGEAPKEVRRFVTGGADNLVKIWRYNPETQSYLVEDTLEGHSDWVRDVAWSPSVLLRSY
FT                   IASVSQDRTCNIWTQEDNTGPWVKTQLTPEEFPDVLWRASWSLSGNILAISGGDNKVTL
FT                   WKENLNGKWESAGEVNQ"
FT   CDS_pept        complement(869388..870335)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000045183" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19349788"
FT                   /locus_tag="CAGL0J08800g"
FT                   /product="Similar to uniprot|Q05788 Saccharomyces
FT                   cerevisiae YLR209c PNP1"
FT                   /function="purine-nucleoside phosphorylase activity "
FT                   /biological_process="nucleoside metabolic process "
FT                   /protein_id="CAG61042.1"
FT                   /db_xref="GO:0004731"
FT                   /db_xref="GO:0009116"
FT                   /db_xref="HOGENOM:HBG205650"
FT                   /db_xref="HOGENOM:HBG292914"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR001369"
FT                   /db_xref="InterPro:IPR011268"
FT                   /db_xref="InterPro:IPR011270"
FT                   /db_xref="UniParc:UPI00003B6B07"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNV3"
FT                   /transl_table=1
FT                   /translation="MNTNWDLGEERVKIEKASEYLSERFQERFQNEKFEPRALIICGSG
FT                   LSGIPDKLNKDKLEPLVIPYELIPGFKRSTVPGHSGNLVFGIMNDYPVVLMSGRLHGYE
FT                   GNTMQETVFPIRVLHHFSKGGIKTLIVTNAAGGINSEFKPGDIMCIYDHINFPGLAGLH
FT                   PLKGPNFDDIGPRFLALSDAYSHDLRKLLFQTHNELKMDRPLHEGTYFFASGPTFETRA
FT                   ESRMIRILGGDSVGMSTVPEVIVARHCGWDVLALSLITNVAVIDHPPSGKIDTPVPMDY
FT                   GKASHAEVLENGRIASKDVETLISTFVGKLHYRE"
FT   CDS_pept        871867..873198
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000167672" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17441169"
FT                   /locus_tag="CAGL0J08822g"
FT                   /product="Strain CBS138 chromosome J complete sequence "
FT                   /biological_process="cell cycle"
FT                   /biological_process="cell division"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG61043.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0007049"
FT                   /db_xref="GO:0051301"
FT                   /db_xref="HOGENOM:HBG436276"
FT                   /db_xref="HOGENOM:HBG750484"
FT                   /db_xref="InterPro:IPR004367"
FT                   /db_xref="InterPro:IPR006670"
FT                   /db_xref="InterPro:IPR006671"
FT                   /db_xref="InterPro:IPR011028"
FT                   /db_xref="InterPro:IPR013763"
FT                   /db_xref="InterPro:IPR014400"
FT                   /db_xref="InterPro:IPR015454"
FT                   /db_xref="UniParc:UPI00003B6B08"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNV2"
FT                   /transl_table=1
FT                   /translation="MNNTEDMFRDVENASQNMASTVNTSRMDQRQRRALTDLTSQKVNR
FT                   IHTSKTIKDIPAYLSNYTADGENKNIDQAFNHSNDQDIGLVNQINSGYANVENEPGKET
FT                   DHIFIDQDDLSDLDIVQEDSLREQLEEFEHDFENFVEPLSPIFNDEIQDTLDRAFKEYY
FT                   RATPDMEDDDTFDAVMVTEYGSDIFRYMRKLELKYRPNPYYMAGQPELKWEYRKTVIDW
FT                   IVQVHERFQLLPETLYLTINIIDRFLSRKNITLNRFQLVSATALLIASKYEEINCPTIK
FT                   DIVYMVDNTYSRDDIIEAEKYMIDALDFEVSWPGPMSFLRRISKADDYEYRTRNLAKYL
FT                   LETTLMESSLISALPSWLAAGAYFLSRIILGYEEWTLKHVYYSGYTHEQLYPLATLILD
FT                   NCQNYEESHQAIWTKYSQPQYHQVSILVTKFLGRVSSDDMSEIY"
FT   CDS_pept        complement(873456..875855)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000157224" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19349789"
FT                   /gene_name="NOP14"
FT                   /locus_tag="CAGL0J08844g"
FT                   /product="Probable nucleolar complex protein 14 "
FT                   /function="snoRNA binding"
FT                   /biological_process="rRNA processing"
FT                   /biological_process="ribosomal small subunit biogenesis "
FT                   /cellular_component="nucleolus"
FT                   /protein_id="CAG61044.1"
FT                   /db_xref="GO:0005730"
FT                   /db_xref="GO:0006364"
FT                   /db_xref="GO:0030515"
FT                   /db_xref="GO:0042274"
FT                   /db_xref="HOGENOM:HBG202617"
FT                   /db_xref="HOGENOM:HBG737435"
FT                   /db_xref="InterPro:IPR007276"
FT                   /db_xref="UniParc:UPI00003B6B09"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FNV1"
FT                   /transl_table=1
FT                   /translation="MAGSQLKELKATLKAHGLTGQTNVKKSKKGKREAKKYDHEEKART
FT                   IAKIRDRFNPFEVKTTKNKRKGGDPGLLNSDRVAVGKPGISKQIGEEARRRAFEAKKLM
FT                   KKRKGGVIDKRFGERDKTLTEEEKMLERFTRERQAGSQRKKNLFNLEDDDEDGPIELDM
FT                   FGNKLTHLGESLSLADDLNVQAEDTEDLEEGQPQRKKTKLEVMKEIIAKSKFHKQERQA
FT                   AQRKLEDNIDELDEDFDDVMAELMTTQTLKQDDIEVPAEEKDYDIKVKELNLEKRAAPA
FT                   DRTKTEEELQKEAEERRQKLEEQRLNRMQGMLEDEEGEERGVEDLDDGFWGSDSEVEEG
FT                   ENIANSDEDIEVESSSEEAISYKSKKLVAISCPQTHPEFLNDLKGLSLLEQPIHVKAII
FT                   KAYQPKLAEGNKVKLANFSKVLLKHMIYLANQRYDKDLIKFDKTQNEFLIILKRLSEKY
FT                   NQAISEVSREYILDIQERFKKQNFHALNNGDILFFIIVGVLFSTSDQYHLVVTPAQIIL
FT                   CEFLEQIRFKSLKRIAVGSVLLRIILQYQRLSKRYIPETVYFLQKALLSLVVNPDDIES
FT                   DMTLPIRLDTFDCGLKLKEPSLPDDAVVHLHELFTKSTTNEEDLKINVLSNLFEDLEKL
FT                   IGSHWNNEAAFPEICEIFEPILSVYKVRYPSITTVESIEEKIKRMKKLNKHYPLALQAH
FT                   RPTAIPSYAPKFEENFNPAKKSYDTDVARNEVNKMKAQLKKERKFVMKELRKDTKFEAR
FT                   QRIDEKKKEAEAYHSKMSNIINTINTEEGAEKNKYEREKRLRAGKK"
FT   CDS_pept        complement(876226..876906)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000001129" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17441170"
FT                   /locus_tag="CAGL0J08866g"
FT                   /product="Similarities with uniprot|Q05789 Saccharomyces
FT                   cerevisiae YLR211c"
FT                   /protein_id="CAG61045.1"
FT                   /db_xref="HOGENOM:HBG123662"
FT                   /db_xref="HOGENOM:HBG202497"
FT                   /db_xref="UniParc:UPI00003B6B0A"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNV0"
FT                   /transl_table=1
FT                   /translation="MSDLNTVYEHIRRAEQKCRSGDLSDALDLYVSALEGLDLKSPNFD
FT                   LQGLDDTIIEAVKLLRDDIQLRIKELQICVIESSKDEKDSKNNKASMALVQSSAGNNNN
FT                   LAASKYWDSTRNITDITSSTFIDPYTSSMLSKLQNSMVDLIKEAKNQKTDVNDLVSTAL
FT                   FQIDQFKKEMLIYEQRRTREYQIKVEHLNKDVKKLSSQNSKLKERWDSLVESARQRKNR
FT                   QQGL"
FT   CDS_pept        complement(877386..878783)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000165714" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17441171"
FT                   /gene_name="TUB4"
FT                   /locus_tag="CAGL0J08888g"
FT                   /product="Tubulin gamma chain "
FT                   /function="GTP binding"
FT                   /function="GTPase activity"
FT                   /biological_process="microtubule-based process "
FT                   /biological_process="protein polymerization"
FT                   /cellular_component="microtubule"
FT                   /cellular_component="nucleus"
FT                   /cellular_component="spindle pole body"
FT                   /protein_id="CAG61046.1"
FT                   /db_xref="GO:0003924"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0005816"
FT                   /db_xref="GO:0005874"
FT                   /db_xref="GO:0007017"
FT                   /db_xref="GO:0051258"
FT                   /db_xref="HOGENOM:HBG496287"
FT                   /db_xref="HOGENOM:HBG750007"
FT                   /db_xref="InterPro:IPR000217"
FT                   /db_xref="InterPro:IPR002454"
FT                   /db_xref="InterPro:IPR003008"
FT                   /db_xref="InterPro:IPR008280"
FT                   /db_xref="InterPro:IPR017975"
FT                   /db_xref="InterPro:IPR018316"
FT                   /db_xref="InterPro:IPR023123"
FT                   /db_xref="UniParc:UPI00003B6B0B"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FNU9"
FT                   /transl_table=1
FT                   /translation="MTGEIITIQVGQCGNHVGKYFWNQLLKEHGIDKDGYSKYNDDLTH
FT                   IREDDTNPFFKQITNNRYVPRAIMIDLEPAAVTDVQSSFNDLFNPRNTWVSSEGLGAGN
FT                   SWSTGYDRGVQNQDRIMDIIDRELDSTDNFEGFQLLHSVAGGTGSGLGSSLLEALTDRY
FT                   SKSFITTYSVFPSKQSEVVVGPYNTVLTLRRLCEDADASIIFDNNALLNLTARTFRDPN
FT                   TSYEHTNQLISSALSSITNSLRFPSYMYNSMASIFSTLIPTPELHFLTPNFTPFTPDYI
FT                   IGGQRYKKNTAYDVLLDLLDPFNSLVTQRSDMVTHFNVFSTVIGEVDQNHILRALPKMQ
FT                   QRLNMPSWSTSALNVNIGRRSPYLPPLESRENSVSGLMLSNTSAITSVFERSASAFDKL
FT                   FYKGAFLNQFESGQLFQNGLDEFVESREVITRMMEEYSNAEQDTYLDDILNEDDIMIGG
FT                   FDNEGDS"
FT   CDS_pept        complement(879267..880751)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000001130" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19349790"
FT                   /locus_tag="CAGL0J08910g"
FT                   /product="Similar to uniprot|Q05790 Saccharomyces
FT                   cerevisiae YLR213c CRR1"
FT                   /function="hydrolase activity, hydrolyzing O-glycosyl
FT                   compounds"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /protein_id="CAG61047.1"
FT                   /db_xref="GO:0004553"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="HOGENOM:HBG058731"
FT                   /db_xref="HOGENOM:HBG736732"
FT                   /db_xref="InterPro:IPR000757"
FT                   /db_xref="InterPro:IPR008985"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="UniParc:UPI00003B6B0C"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNU8"
FT                   /transl_table=1
FT                   /translation="MAKQLKLLIIIRFLLSINFSRGIDLHKPETPVRCSIRDGSCPAEW
FT                   PCCSPYGVCGSGPTCIGGCNPQYSFREDSCVPSPVLIPYNAIEFSTEGTKLIRIASGNL
FT                   QKGDAFLKKGARMKEREMELKRNKMIHFSDFLITEDATEANKMLMDYDFIYSGMTQMDP
FT                   TTSEIQLTMPKRSTGSLVASVRSFLYGKVSVTMKTARSGGVITALVLMSAVGDELDFEF
FT                   VGSELNQVQTNHYYQGELDFTKMKKHEIKDNTWLNYHNFEIFWTEDKVDWVIDGVVVRT
FT                   LYKKDTWDPNAKVYKFPDSPMRLEIAIWPGGSEKNEIGTIMWAGGLVDWDNPPDMLEKG
FT                   YFSANVKVIRIEPSANRHLPRIYHCLTRKSHKDINDLTSRDLSMATFYYNSSRDNRYNE
FT                   NSLEWDCFNDIYLSNSSSSGTDLYYGNKGKQTNSLEKSPNSEYSNENDSEEINVEEWYR
FT                   RSMMFRPKRQKSSAAHKTKSSTLPLIIFLIISLFIK"
FT   CDS_pept        complement(881038..882105)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000231938" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19349791"
FT                   /gene_name="CDC123"
FT                   /locus_tag="CAGL0J08932g"
FT                   /product="Cell division cycle protein 123 "
FT                   /biological_process="cell cycle"
FT                   /biological_process="cell division"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAG61048.1"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0007049"
FT                   /db_xref="GO:0051301"
FT                   /db_xref="HOGENOM:HBG189908"
FT                   /db_xref="HOGENOM:HBG609337"
FT                   /db_xref="InterPro:IPR009772"
FT                   /db_xref="InterPro:IPR016525"
FT                   /db_xref="UniParc:UPI00003B6B0D"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FNU7"
FT                   /transl_table=1
FT                   /translation="MSEEYAVLSELPVTCSQIDNCAFSFWYEKFKKHVPKSRVIKPLPE
FT                   QFIQYLEQDGIKLPMSSTELSTYTDDVARTEDNEYSDWEGDEDTATEYEPGIEPLNDFP
FT                   ELHNQIKEIIVELGPVTPKLNWSAPKDATWILPNNTTKCNEVNEIYLLLNASNYIVHDL
FT                   NHAYDECIDKKEGFSTPEYELVLRQWFAINPALEFRVFVKDGKVAAVSQRDLNYYDYLD
FT                   KLTDTFKDLIDEFVEDEMVPQFPDKSFVTDLYIPRPFNRVFLIDINPFSRKTDPLLFTW
FT                   NEIININAQPDRDYELRLITENNIGRFASKEHSQNHVPKDVVDASLDPERIRELSQKWS
FT                   ELLLQQEKESSDEEK"
FT   CDS_pept        complement(882437..883552)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000065980" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19349792"
FT                   /gene_name="CPR6"
FT                   /locus_tag="CAGL0J08954g"
FT                   /product="Peptidyl-prolyl cis-trans isomerase D "
FT                   /EC_number="5.2.1.8"
FT                   /function="binding"
FT                   /function="peptidyl-prolyl cis-trans isomerase activity "
FT                   /biological_process="protein folding"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAG61049.1"
FT                   /db_xref="GO:0003755"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="HOGENOM:HBG022580"
FT                   /db_xref="HOGENOM:HBG610621"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR015891"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR020892"
FT                   /db_xref="InterPro:IPR023114"
FT                   /db_xref="UniParc:UPI00003B6B0E"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FNU6"
FT                   /transl_table=1
FT                   /translation="MTRPKAYFDISIGGTPKGRIVFELYKDVVPKTAENFLKLCEGKSG
FT                   MAKSKPDVPLSYKGSIFHRVIKDFMIQFGDFTNFDGTGGESIYGEKFEDENFEIKHDKP
FT                   FLLSMANAGPNTNGSQAFITCVPTPHLDGKHVVFGEVIEGKRLVRLIEKQQTEDGTDKP
FT                   MHDVKVEGCGLLPDDYEVPADAEQTPTDEFGDNYEESLKDDAKVDLKKVETVIKAIETV
FT                   KDIGTKQFKEQNYEVALAKYKKCDKFLKEYFPDDLNEEDMKKINDFKVTVPLNIAIAAL
FT                   KSKDYRSVMVACSEVLYAEAADAKAKAKALYRRGLAYYHVNDTDMALADLEMATTFQPN
FT                   DAAIAKAINDTIKKRKQETEKQKKSLSKMFG"
FT   CDS_pept        complement(883894..884154)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093840" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17441172"
FT                   /locus_tag="CAGL0J08976g"
FT                   /product="Similar to uniprot|Q05809 Saccharomyces
FT                   cerevisiae YLR218c"
FT                   /protein_id="CAG61050.1"
FT                   /db_xref="HOGENOM:HBG058733"
FT                   /db_xref="HOGENOM:HBG448039"
FT                   /db_xref="UniParc:UPI00003B6B0F"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNU5"
FT                   /transl_table=1
FT                   /translation="MSESRYYKEALEQYKEMVEEEQDGSERDSWDKRITDTGCYVENLA
FT                   LQLCHAETNDWRQCFPEMAKFKECWESNGNRDRVKTVDRDS"
FT   CDS_pept        884779..888624
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000048339" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17441173"
FT                   /gene_name="SEC31"
FT                   /locus_tag="CAGL0J08998g"
FT                   /product="Protein transport protein SEC31 "
FT                   /biological_process="RNA splicing"
FT                   /biological_process="protein transport"
FT                   /biological_process="vesicle-mediated transport "
FT                   /cellular_component="ER to Golgi transport vesicle membrane"
FT                   /cellular_component="endoplasmic reticulum membrane "
FT                   /cellular_component="spliceosomal complex"
FT                   /protein_id="CAG61051.1"
FT                   /db_xref="GO:0005681"
FT                   /db_xref="GO:0005789"
FT                   /db_xref="GO:0008380"
FT                   /db_xref="GO:0012507"
FT                   /db_xref="GO:0015031"
FT                   /db_xref="GO:0016192"
FT                   /db_xref="HOGENOM:HBG061074"
FT                   /db_xref="HOGENOM:HBG735654"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR004098"
FT                   /db_xref="InterPro:IPR009917"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="InterPro:IPR021614"
FT                   /db_xref="UniParc:UPI00003B6B10"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FNU4"
FT                   /transl_table=1
FT                   /translation="MVRIAEYSRTATFAWSNDRIPYLVSGTASGTIDADFSNESKLELW
FT                   SLLGTDADKPSHSVSTDAKFKDLDWSADNKYIAGAMDNGAVEIYEFNSSKQELKKQGSF
FT                   KNHSTVVRTVKFNSKQNNVLLSGGNSQEIFIWDLNKLLDSKANYQPLTPGVSMSPIDEI
FT                   HSLSWNKSLAHVFASASNSSFASIWDLKAKKEVIHLSYTSQNTGLKSDFSAVEWHPLNS
FT                   TRVATATSNDNEPLILVWDLRNSNTPLQTLSAANNQGHGHSKGILSLDWCQQDENLLLS
FT                   SARDSSVMLWNPQSGEALTEYNTTGNWCFKSKFAPQAPDLFAFATLDGKKIEVQTLQNY
FT                   ETTLDEEVSKTKQQESETDFWNHVSEEKAEIKSTVVHLQAPSWYGNKSASAQWAFGGKL
FT                   VQVTKDGKGVEVNKPEITDLKSDDTLKNALASKDFQPLINQRLVKVVNETNEEDWNLLE
FT                   KLSMDGKEEFLKEALELDEEEDEEKDQEGKDGDEFFQKIESNFQPSGSFKIDSNEESVI
FT                   NNILSGNNSKAVSELLKSGSILEAFVVAVTCNDEKLKEDVKDAYFAAHGKESSLSRVLF
FT                   SSSKKNSDDIVENLDISQWKYITKSIYNFHANDEVERTNKLLQLGDRLLANKNRQDALV
FT                   IYIAAGSLDKIATVWLNEFSTLENKIKDQEKTIYEAHIECLTEFVERFTILSNFVGKKQ
FT                   KITNESLISKFLEFINITSATGNFDLALLFLDILPEDNEYVIAEKKRVMVASGKVVDQS
FT                   QSRKGKYGSHANLASAGFSGHAKQPVNLPPTAAPFAAQTMGGYAPQAVGAVPTPAVPVP
FT                   QTRNASVSIKSNPYGPAGTNVGTSDNKFNAYAPPTHTQVPVATPVTSSFIPPANPYSNV
FT                   AAQSLAMAAEQNAMSPNLAGSAPPVKSPSVYSGQTPHLNKKANDGWNDLALPVKEKPQR
FT                   AKPVTVAPSPILAPATNGAAAAVPTKSIGTVFPPTGGNSRVPSSMVSPPPPQKRASRTP
FT                   SLINIDDVVNARPKAHTSIYAPQTTQAGPAPVAPQSDIPLAPTANPYAPNQSVGSTPLQ
FT                   KPVNPYAPPAQQAGIPSAANPYASQIPSKAPVNAPPPMSSKKAPVGPPPMSSRKKAHEG
FT                   KTLSHEAASVLDSSKPVQTQPIASELSREPAPVPTSASQTQVPPPVQETPARNTISPID
FT                   MAAPAVEQGISAAQQPIRDFFSSELARVTPLTPKEYNKQLKDCDKRLKILFTHLEKNLL
FT                   SQPTVDKLLHIIELLKEKKYHEAMEVHKDIATNHAEEGGNWLTGVKRLISISEATA"
FT   CDS_pept        889269..891839
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000202870" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17441174"
FT                   /locus_tag="CAGL0J09020g"
FT                   /product="Strain CBS138 chromosome J complete sequence "
FT                   /function="substrate-specific transmembrane transporter
FT                   activity"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAG61052.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0022891"
FT                   /db_xref="HOGENOM:HBG534647"
FT                   /db_xref="HOGENOM:HBG744444"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI00003B6B11"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNU3"
FT                   /transl_table=1
FT                   /translation="MTIISEDEKSVARDREGVLARAIKVVNRKFRRKDVRREKLERALS
FT                   CDNQMTLNSTNLYAAQQQEYQRREENDIEENQEPEGGNDDIDYDISILSDEMSTVDDAS
FT                   LLFAEPPQKQSHMMSIVVGAFVAVGGFLFGYDTGLINSIVDMRYVRENIAPNHVGFTAQ
FT                   QLAILVSFLSLGTFVGALSAPVISDKYGRKKTIMFSTAVVFSLGNSLQVGAHNIQLLIA
FT                   GRVISGLGVGLVSAVVPLYQAEAAHKSLRGAIISTYQWAITWGLLVSSAVSQGTHNRND
FT                   ASSYRIPIGLQYVWAYILAAGMLWLPESPRYYVLRDQLDKAAQSLSFLRGVPIHDSGLL
FT                   EELVEIKATFDYESSFGKTTFWDCFKSNKSRPKQTLRMFTGIAIQAFQQFSGINFIFYY
FT                   GVSFFNRSGVENSYIVSLITYAVNVGFSVPGMFLVEYFGRRSVLLYGGAIMTLSNFIIA
FT                   IVGSSTQSVVANKVMIAFICLFIASFAATWGGVVWVISAELYPLGVRAKCTAICAAANW
FT                   LINFVCAFITPYIVDTGERRALIGPKIYFIWGSLNALGILVVYFTVYETRGLTLEEIDE
FT                   LYTKSPNGIVSAKWNRRIRHREKTYGHKEQQNRDRNQQTTKENLRKNVVNEDMLSDDLT
FT                   PRNDSINTHHSVDSNEKYQSENTDNTLAPAVNDRSMMDFGNDMILHICNRGPPSISTAA
FT                   SVEEFGGNSTQMENLSYNESNSVEKKKVGLFSKFKLGSRKSSINGTEEDSKPKSPQLGQ
FT                   AEFSPSPLDVKVSDDDHNDFVDLGNGFGLYSVTRRLSSGVPDTSDEESAYDLGNAPSST
FT                   NTYRNRGNLDSINTYMSQLIQSNTYTSQNTGYSQNDNDQTQHHQ"
FT   CDS_pept        892829..893920
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000169041" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17441175"
FT                   /locus_tag="CAGL0J09042g"
FT                   /product="Similar to uniprot|Q12063 Saccharomyces
FT                   cerevisiae YDL193w"
FT                   /function="transferase activity, transferring alkyl or aryl
FT                   (other than methyl) groups"
FT                   /protein_id="CAG61053.1"
FT                   /db_xref="GO:0016765"
FT                   /db_xref="HOGENOM:HBG396737"
FT                   /db_xref="HOGENOM:HBG435291"
FT                   /db_xref="InterPro:IPR001441"
FT                   /db_xref="UniParc:UPI00003B6B12"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNU2"
FT                   /transl_table=1
FT                   /translation="MVEIRDDLVEDIVELTRRIPILHIEESGPLLVDLAPEKECLTNGS
FT                   ANTKIRYAQAILDSVLTEFGGGNSGSSFYEIQVPDGDVKKGRLIFRQFSKLEKFVYKIL
FT                   LAIIFFVFGMLRYALYQYNQMRLSLLHLIYNPSRIPHLIRRDTLRLKKMPTRVAFILEA
FT                   KPIGQVGGGLYGLLSNAAEVVSWSVYAGVKEVILYDMDGYFQKNIFHLEDEIYSSLTNY
FT                   SSRNSIPNFTIYVPHSGKTYKRYHTGNNESREHISITVLSHIDGRPTVVNVVKSIIQLC
FT                   KESKMSVGEISMELVNSVLTRLVCDEPDLLVYFGPTLDLQGFPPWQIRLTELFWEQDNN
FT                   RVSYSVFIRALNHYSNCKINLGK"
FT   CDS_pept        894680..895225
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000163691" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17441176"
FT                   /locus_tag="CAGL0J09064g"
FT                   /product="Strain CBS138 chromosome J complete sequence "
FT                   /function="GTP binding"
FT                   /biological_process="small GTPase mediated signal
FT                   transduction"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAG61054.1"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0007264"
FT                   /db_xref="HOGENOM:HBG527536"
FT                   /db_xref="HOGENOM:HBG745225"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006688"
FT                   /db_xref="InterPro:IPR006689"
FT                   /db_xref="UniParc:UPI00003B6B13"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNU1"
FT                   /transl_table=1
FT                   /translation="MGLFASKLFSNLFGSKEMRILMVGLDGAGKTTVLYKLKLGEVITT
FT                   IPTIGFNVETVQYKNISFTVWDVGGQDRIRSLWRHYYRNTEGVIFVVDSNDRSRIGEAR
FT                   EVMQRMLNEDELRNAVWLVFANKQDLPEAMSAAEITEKLGLHSIRNRPWFIQATCATSG
FT                   EGLYEGLEWLSNNLSNQS"
FT   CDS_pept        join(897205..897207,897835..898194)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000207749" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20196625"
FT                   /locus_tag="CAGL0J09086g"
FT                   /product="Strain CBS138 chromosome J complete sequence "
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="CAG61055.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG246662"
FT                   /db_xref="HOGENOM:HBG323932"
FT                   /db_xref="InterPro:IPR001854"
FT                   /db_xref="UniParc:UPI00003B6B14"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNU0"
FT                   /transl_table=1
FT                   /translation="MAGVKAYELRTKSKEQLENQLLSLKKELAELQVQKLSRPSLPKIH
FT                   TVRKDIARVLTIINEQQREAVRQLYKGKKYQPKDMRAKKTRALRRALTKFEATRVTEKQ
FT                   KKKQIAFPQRKYAIKA"
FT   CDS_pept        complement(898456..901299)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248797" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17441177"
FT                   /locus_tag="CAGL0J09108g"
FT                   /product="Strain CBS138 chromosome J complete sequence "
FT                   /function="ubiquitin-ubiquitin ligase activity "
FT                   /biological_process="ubiquitin-dependent protein catabolic
FT                   process"
FT                   /cellular_component="ubiquitin ligase complex"
FT                   /protein_id="CAG61056.1"
FT                   /db_xref="GO:0000151"
FT                   /db_xref="GO:0006511"
FT                   /db_xref="GO:0034450"
FT                   /db_xref="HOGENOM:HBG058734"
FT                   /db_xref="HOGENOM:HBG398467"
FT                   /db_xref="InterPro:IPR003613"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR019474"
FT                   /db_xref="UniParc:UPI00003B6B15"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNT9"
FT                   /transl_table=1
FT                   /translation="MELIIEDIFQVKLPGSETNNPQYTVLSDEIDRNIDGIILAQLTEN
FT                   EQLLEPFAYLNNCYNRTLTRRRKNKNAKELQSSFDEIETLLVGYGLVAFQIEEFCMNGN
FT                   FKNYIKKIIEKVDDYTNFIPKIIERANQEGSLLEFLTNVFTNLQFYLTKDMAMFDINDS
FT                   MTYNNTLSIYEMFLTFKPVAAIFTKVEGFFADYNCKANEFEKVTILGPILTLSPLNPNV
FT                   ALRNYGDNLERSKQQTMIIHESLQAEHKVIIERLFFVIDKIIRGSEESRSDMISYFAQI
FT                   VNKNHLRRGDHANQNKLASNAFMTNITLILVKFSQPFLDVSYKKIDKIDVNYFNTLNLY
FT                   LDLSQETRLNSDFKEADEFYDRNKKDAEMKPNFISDCFFLTLTYLQYGLGGTLLYDEKI
FT                   TPQLKRLREEIERVKEAANSQDMFASFANMQLKQMEKTLKITQSIRSALQGFFTHRNMQ
FT                   LEVFDFICGASTFLMRVIDPNHQYPAQAFKLPLIPDQVGFENVDNAEYLRKNAPVPFKY
FT                   YPEFCVEGPINYALYIAQYSTSPLFRNPRLQSFLEFGTTILRCPELVSNPHLKGKLVQL
FT                   FSVGAMPLTDGSPGFMMEIFEHDELIKENLLYALLDFYVIVEKTGSSSQFYDKFNSRYS
FT                   ISIILEELYSRIPLYKNQLIWQSQKNSDFFIRFVARMLNDLTFLLDEGLSSLADVHNIQ
FT                   NEIENRAKGNQPTREENDQELQSKLMSAERQAKSSCGLAGKSLKLFEIFTADIPSAFCS
FT                   SEIVDRLASMLNYNLVSLVGPKCGELKVKNPEKYSFHPKQLLKALTTVYVNLAGEDEFI
FT                   SAIARDSRSFDTALFERAVHILQSKIGLVSPEFCDKLMNLALKAEERKNAEEEEDMEYG
FT                   DAPEEFLDPLMYTIMKDPVTLPTSKVNIDRATIKAHLLSDSTDPFNRMPLKLEQVIPNT
FT                   ELKQKIEEYKKNKKMKK"
FT   CDS_pept        902880..904658
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21045385"
FT                   /locus_tag="CAGL0J09130g"
FT                   /product="Similarities with uniprot|Q05672 Saccharomyces
FT                   cerevisiae YDL189w"
FT                   /function="nucleic acid binding"
FT                   /protein_id="CAG61057.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="HOGENOM:HBG123663"
FT                   /db_xref="InterPro:IPR001374"
FT                   /db_xref="UniParc:UPI00003B6B16"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNT8"
FT                   /transl_table=1
FT                   /translation="MEEKPNVSNSESSSKNVNDLDCEELGLSPAMITALFKRPHDRQFI
FT                   IDKEQAIINFIDSNQNSLELRPMNSYYRMLSHQIAEYHHLRHVIARSNDVSVILFKVED
FT                   THKFRNKKPLLKSLEPLYVTENKSTVSEEESKPANNSAGNTKKFKILKRSKSKDDAITD
FT                   NSSQENIQLTSETPETPLQESNNSSSSALLEEQRLKKEEEYNQIRQNLFENVNGDEVID
FT                   DNSLNDEDDGVHTDLSEVFGDVKTNNDSENQDTANGKDESTSAPYYRVKIVQEKFGGIN
FT                   DSKNGASPQPDEFQTSRNSLLTNQEYQYHYKGYQNRNSRRSFHSSNSASSLGNDMNPGY
FT                   KSKNRSGSFTRRSSNSSINSRRSSYNNNSEYGGLHYGKYMQQIPQGTPAGFPMPYMMYP
FT                   PHQMMQYQQIPHLGMFAGAGTIPIDGAGVPFSTSAPYMYPIPIPPTTDGINVPGNAAGS
FT                   MTANFTPFSPSLPNGVHMSPIMVPSVPRYNLNSTNHRSHYSSNNSESKGYTRNNKYQKN
FT                   SYRNKITTEGGSNESFDGSESEKSIDNGSNNNDREGNAPSYRSRGNEKGNSVSGDNSPK
FT                   GEDILSLNQNLKTLSI"
FT   CDS_pept        complement(905105..905707)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000175765" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17441178"
FT                   /locus_tag="CAGL0J09152g"
FT                   /product="Similar to uniprot|Q12434 Saccharomyces
FT                   cerevisiae YDL135c RDI1"
FT                   /function="Rho GDP-dissociation inhibitor activity "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAG61058.1"
FT                   /db_xref="GO:0005094"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="HOGENOM:HBG016290"
FT                   /db_xref="HOGENOM:HBG329264"
FT                   /db_xref="InterPro:IPR000406"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="UniParc:UPI00003B6B17"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNT7"
FT                   /transl_table=1
FT                   /translation="MSEPDFNDFEESTNDDKYKVSEKKTVDEYKKLDAEDESLAKWKES
FT                   LGLSSDVLPLEFPGDTRKVVIQKIQLLVDTEKEPITFDLTNETTIKELASKRYKVKEKS
FT                   IYKLRITFKVQHEIITGLRYVQYIKKAGIAVDKIDDHLGSYAPNTKQKPFYEVELPESE
FT                   APSGFLARGNYSAVSKFIDDDKTTHLTLNWGVEIVKK"
FT   CDS_pept        906232..907293
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21045386"
FT                   /locus_tag="CAGL0J09174g"
FT                   /product="Similarities with uniprot|P48568 Saccharomyces
FT                   cerevisiae YDL186w"
FT                   /protein_id="CAG61059.1"
FT                   /db_xref="HOGENOM:HBG123664"
FT                   /db_xref="UniParc:UPI00003B6B18"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNT6"
FT                   /transl_table=1
FT                   /translation="MSKFARINLETASPLDLVFNLDSNDSQRGVDGTLDHGLSKNKYFL
FT                   PQDANVSSVRELVIDSQSKRKLRLGNRFVEKMEDNLVKWRPPLSSNRGTVMAIEGKHPY
FT                   QIAAEIYAPNCDPELFRTADQNNGNATQRQMSHTMFDSFTHWWKENARGALELRRQQFE
FT                   EEILGLSDLQDMDQVVEVTVAPAIKEEPQLEDTGMNTETQSALTNNTAELARLISQEDE
FT                   RRLEISDLSNSGISSGVSSQGTFLARPIVKTPPAAVVRRRQQLQQELKRTGAVPQIYEE
FT                   VYNAPVPVAYLPVSNNDPRYSQQLSQRQREHVSQNDGPLWSCSQTDIVSKLNEWSVAIM
FT                   NCLTPITQDHINP"
FT   CDS_pept        907869..909281
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093837" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17441179"
FT                   /locus_tag="CAGL0J09196g"
FT                   /product="Similar to uniprot|Q12516 Saccharomyces
FT                   cerevisiae YDL133w"
FT                   /protein_id="CAG61060.1"
FT                   /db_xref="HOGENOM:HBG058741"
FT                   /db_xref="HOGENOM:HBG396570"
FT                   /db_xref="UniParc:UPI00003B6B19"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNT5"
FT                   /transl_table=1
FT                   /translation="MERMVKDVVGHPQDPDERSDNSVSDQPRVDGGKQSNKGNVGHGNG
FT                   VSDHKRQMVSLNPYGLYPSTVPPFVLESDFRRLHGINDDFNDREVRWANFIGNVGSNVA
FT                   YSTEQRLPSRGIANNATLRHNYSVGNIKDQPNRHIEDIIDPLVSTGNNSINESASLDHE
FT                   EMERKRKIQEEILYDLDSEWKGGERLDAVFNFSVNKDFEFKNEKDRIDWVNYISKVKNA
FT                   YYAPNKESSGINDESSSSLSQQQEGNRGDRQNYDWIEELNKEKEKWKKLKQRKIQKWKP
FT                   ALSNLLFYNQYLPLGFRIVIGILCLISLGLSVRIYQNSDSSIEQVEGGGADLDTGIPQQ
FT                   ASTIMAICVNTIAIAYTFYIAIDEFSGKPLGLRNPLGKLKLILLDLLFIIFASANLALA
FT                   FNTRFDKEWVCTGLGVTIAEEEVYYPKIPYICRKQKALASFLFVLLFAWVVTFSVSIAR
FT                   VVDKVHSSATRD"
FT   CDS_pept        910167..912635
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000176713" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17441180"
FT                   /locus_tag="CAGL0J09218g"
FT                   /product="Strain CBS138 chromosome J complete sequence "
FT                   /function="ubiquitin protein ligase binding"
FT                   /biological_process="ubiquitin-dependent protein catabolic
FT                   process"
FT                   /cellular_component="cullin-RING ubiquitin ligase complex "
FT                   /protein_id="CAG61061.1"
FT                   /db_xref="GO:0006511"
FT                   /db_xref="GO:0031461"
FT                   /db_xref="GO:0031625"
FT                   /db_xref="HOGENOM:HBG472518"
FT                   /db_xref="HOGENOM:HBG622322"
FT                   /db_xref="InterPro:IPR001373"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR016157"
FT                   /db_xref="InterPro:IPR016158"
FT                   /db_xref="InterPro:IPR016159"
FT                   /db_xref="InterPro:IPR019559"
FT                   /db_xref="UniParc:UPI00003B6B1A"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNT4"
FT                   /transl_table=1
FT                   /translation="MSENLPRSDDLDATWNFIQPGIDQILGNDSTEVTNKKVQKILSPT
FT                   MYMEIYTAIYNYCVNKSRSSGHFNADRQQSGSSGQSSILVGSEIYERLKKYLRHYISNF
FT                   KKDSNETFLQFYVRRWKRYTIGAIFLNHAFDYMNRYWVQKERSDGKRHIFDVNTLCLMT
FT                   WKEVLFDPHSDELITEILDQITAERNGEIIQRDHITTSIKSLVALGIDPQDLKKLNLNV
FT                   YIQVFEKKFLKKTETYYQQYSEDYLTTHSVTEYIFKAHEIISREEKGMAMYWDDHTKKP
FT                   LSETLNEVLVKSHIEKLESEFIVLLDSRDNSKISALYSLILRDFSLLPRLANVFEEYIR
FT                   KSGENEVSQLISAHKAAVMEASADGNGTKKMAMATTQSLPPKDYIKALLKVYNTFKNID
FT                   RECFPTDPLFAKALDNACRAYININEFALPSGSSRSATSKTSEMLAKYSDQLLKKSTKP
FT                   EVANDMSDDDIITIFKFITDKDAFESHYRRLFAKRLIHGTSTSSDDEESIIKRLQTENS
FT                   MEYTGKITKMFQDVRLSKMLESDFDVMIKSQSDYSREKFPELQPFVLAENMWPFSYQEV
FT                   DFRLPEELVASHKKLESMYIGKHNGRILKWLWPLCRGELKADIGKPGRVPFVFTVTLFQ
FT                   MSILLLFNDKDVLTFEEIQEGTNLNIQNIASSMVPFIKFKLVQQLPPGLDNLVKGDTQF
FT                   KLNRPYKAVKTQINFAAGVKNDILGTISKSSNSVSNGVSGISDEKLSESEKIEKELNAE
FT                   RQMFLEACIVRIMKTKRNLPHSTLVNECIAQSHQRFKAKISMIKRAIDSLIQKGYLQRG
FT                   EDGESYTYLA"
FT   CDS_pept        913793..915106
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000046858" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17441181"
FT                   /locus_tag="CAGL0J09240g"
FT                   /product="Strain CBS138 chromosome J complete sequence "
FT                   /function="transferase activity, transferring acyl groups,
FT                   acyl groups converted into alkyl on transfer"
FT                   /biological_process="carboxylic acid metabolic process "
FT                   /protein_id="CAG61062.1"
FT                   /db_xref="GO:0019752"
FT                   /db_xref="GO:0046912"
FT                   /db_xref="HOGENOM:HBG262099"
FT                   /db_xref="HOGENOM:HBG701974"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR002034"
FT                   /db_xref="InterPro:IPR011872"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniParc:UPI00003B6B1B"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNT3"
FT                   /transl_table=1
FT                   /translation="MDQYQQVTESTPTVETSNPYGPNPADFLSNVKEFQLIDSTLREGE
FT                   QFANAFFDTEKKIEIAKALDDFGVDYIELTSPVASEQSFRDCKAICNLGLKAKILTHIR
FT                   CHMDDAKVAVETGVDGVDVVIGTSKFLRQYSHGKDMNYIAKSAIEVIEFVKSKGIEIRF
FT                   SSEDSFRSDLVDLLNIYKTVDKIGVNRVGIADTVGCANPRQVYELVRTLKSVVSCDIEC
FT                   HFHNDTGCAIANAYTALEGGAKLIDVSVLGIGERNGITPLGGLMARMIVAAPEYVKSKY
FT                   KLHKIRDIENLVAEAVEVNIPFNNPITGFCAFTHKAGIHAKAILANPSTYEILDPHDFG
FT                   MKRYIHFANRLTGWNAIKSRVDQLNLNLTDDQVKEVTTKIKKLGDIRPLNIDDVDSIIK
FT                   DFHADLATPMVRPTEDGADNEEPLQLDEPAKKKSKLSQ"
FT   CDS_pept        915500..915799
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18501964"
FT                   /locus_tag="CAGL0J09262g"
FT                   /product="Strain CBS138 chromosome J complete sequence "
FT                   /function="enzyme inhibitor activity"
FT                   /biological_process="negative regulation of nucleotide
FT                   metabolic process"
FT                   /cellular_component="mitochondrion"
FT                   /protein_id="CAG61063.1"
FT                   /db_xref="GO:0004857"
FT                   /db_xref="GO:0005739"
FT                   /db_xref="GO:0045980"
FT                   /db_xref="HOGENOM:HBG429440"
FT                   /db_xref="InterPro:IPR007648"
FT                   /db_xref="UniParc:UPI00003B6B1C"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNT2"
FT                   /transl_table=1
FT                   /translation="MPKNTLRSNDKFQSIKKMLAARTGSRAILRIRPQAVIRQYSDGFM
FT                   ATGNGIFDQREKAKEDYFIRQHEREQLQKLKEQLEHHKSKVKDIQEKIDKLSKK"
FT   CDS_pept        916357..917022
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17441182"
FT                   /locus_tag="CAGL0J09284g"
FT                   /product="Similar to uniprot|Q07555 Saccharomyces
FT                   cerevisiae YDL129w"
FT                   /protein_id="CAG61064.1"
FT                   /db_xref="HOGENOM:HBG123665"
FT                   /db_xref="UniParc:UPI00003B6B1D"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNT1"
FT                   /transl_table=1
FT                   /translation="MSESSKFRPPIAETKKLESDILAIIQRLRDDEAGEGQVAKDEVIS
FT                   VLNRSLTALSHWVLQAQLMELDPNNQDRVAVENSLLKKEVEFLSGKASQKRLHPIQIPP
FT                   SQLKEPSERPYKVDVHTPVKEKRKKKIDISQITPKRGEFSPKQQNTGTKYDAEKSPTGR
FT                   SLNTRRTSGEPLSPKGLHEPGTQFKLVENKKPHPRMRRTSDNPSRNEYVRVFHLEKEK"
FT   CDS_pept        917765..918973
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000083011" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17441183"
FT                   /locus_tag="CAGL0J09306g"
FT                   /product="Similar to uniprot|Q99385 Saccharomyces
FT                   cerevisiae YDL128w VCX1"
FT                   /function="cation transmembrane transporter activity "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAG61065.1"
FT                   /db_xref="GO:0008324"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG328108"
FT                   /db_xref="HOGENOM:HBG738140"
FT                   /db_xref="InterPro:IPR004713"
FT                   /db_xref="InterPro:IPR004798"
FT                   /db_xref="InterPro:IPR004837"
FT                   /db_xref="UniParc:UPI00003B6B1E"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNT0"
FT                   /transl_table=1
FT                   /translation="MDSTAPLLGPNSRQTALSTYSAAKRDLIYVCASSPLHLLLIFVPL
FT                   GIIWGYMELSHTWTFVFNFLAIIPLAAILAHATEELADKAGSTIGGLLNATFGNAVELI
FT                   VSVIALKEGQVRIVQASMLGSLLSNLLLVLGFCFLFGGYNRIQQTFNQTAAQTMSSLLA
FT                   ISCASLLIPAAFKATLPHGKEDWIVDDKILHLSRGTSLILLMIYVLFLVFQLGSHHAMF
FT                   EQQHEETDEVVSELSIKPHQSLSIRSSLWFLLLSTVIVSICADYLVGTIDNVVESTGLS
FT                   KTFIGLIVIPIVGNAAEHVTSVMVAMKDKMDLAISVAIGSSLQIALFVTPFMVLVGWWI
FT                   DVPMTLNFSTFETTTLFIAVFLSNYLILDGESNWLEGVMSLAMYVLIAMAFFYYPDVMA
FT                   DAA"
FT   CDS_pept        920703..921596
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000000866" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20196626"
FT                   /locus_tag="CAGL0J09328g"
FT                   /product="Strain CBS138 chromosome J complete sequence "
FT                   /function="protein kinase binding"
FT                   /biological_process="regulation of cell division "
FT                   /biological_process="regulation of cyclin-dependent protein
FT                   kinase activity"
FT                   /protein_id="CAG61066.1"
FT                   /db_xref="GO:0000079"
FT                   /db_xref="GO:0019901"
FT                   /db_xref="GO:0051302"
FT                   /db_xref="HOGENOM:HBG192607"
FT                   /db_xref="HOGENOM:HBG203067"
FT                   /db_xref="InterPro:IPR006670"
FT                   /db_xref="InterPro:IPR006671"
FT                   /db_xref="InterPro:IPR011028"
FT                   /db_xref="InterPro:IPR012104"
FT                   /db_xref="UniParc:UPI00003B6B1F"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNS9"
FT                   /transl_table=1
FT                   /translation="MSDIEALLQFNRKPVSQEMITYLARSTESIIQVRETHSMIDVAIP
FT                   APKLELFIKKLVKYSNVQTPTLMATTVFLTKLRSIIPANVYGIETTRHRIFLGCLILSA
FT                   KTLNDSSPLNKHWAQYTDGLLHLKEVNTIERELLEYFDWNLTLSTNDLIQSLAPFLKPI
FT                   KDQIIRSRQQELLLFNAPTPSQLKSYMNSPQSRSSSYNSIPSLSSSNTISTINSSRSRS
FT                   SLNYSANIQTIPEGESDVVSQRKTSLSNLDPNKYANTSVSEKRKSSRPIILKTGLDKPM
FT                   VAGQTKIKRSNWTNFF"
FT   CDS_pept        complement(922018..924510)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000223224" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18501965"
FT                   /locus_tag="CAGL0J09350g"
FT                   /product="Similar to uniprot|P25694 Saccharomyces
FT                   cerevisiae YDL126c CDC48"
FT                   /function="ATP binding"
FT                   /function="nucleoside-triphosphatase activity"
FT                   /protein_id="CAG61067.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0017111"
FT                   /db_xref="HOGENOM:HBG460402"
FT                   /db_xref="HOGENOM:HBG597299"
FT                   /db_xref="InterPro:IPR003338"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR004201"
FT                   /db_xref="InterPro:IPR005938"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="UniParc:UPI00003B6B20"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNS8"
FT                   /transl_table=1
FT                   /translation="MGEEHKPLLDGSGAEPTVEDSTATAILRRKKKDNTLIVDDATNDD
FT                   NSVIAINSNTMDKLELFRGDSVLVKGKKRKDTVLIVLIDDELEDGACRINRVVRNNLRV
FT                   RLGDLVSIHPCPDIKYASRISVLPIADTIEGITGNLFDVYLKPYFVEAYRPVRKGDHFV
FT                   VRGGMRAVEFKVVDVEPEEYAVVAQDTIIHWEGEPINREDEENNMNEVGYDDIGGCRKQ
FT                   MAQIREMVELPLRHPQLFKAIGIKPPRGVLMYGPPGTGKTLMARAVANETGAFFFLING
FT                   PEVMSKMAGESESNLRKAFEEAEKNAPAIIFIDEIDSIAPKRDKTNGEVERRVVSQLLT
FT                   LMDGMKARSNVVVIAATNRPNSIDPALRRFGRFDREVDIGIPDATGRLEVLRIHTKNMK
FT                   LADDVDLETLAAETHGYVGADIASLCSEAAMQQIREKMDLIDLEEDEIDAEVLDSLGVT
FT                   MDNFRFALGNSNPSALRETVVESVNVTWDDVGGLDEIKEELKETVEYPVLHPDQYTKFG
FT                   LAPSKGVLFYGPPGTGKTLLAKAVATEVSANFISVKGPELLSMWYGESESNIRDIFDKA
FT                   RAAAPTVVFLDELDSIAKARGGSLGDAGGASDRVVNQLLTEMDGMNAKKNVFVIGATNR
FT                   PDQIDPAILRPGRLDQLIYVPLPDEPARLSILKAQLRKTPLEPGLDLTAIAKATQGFSG
FT                   ADLSYIVQRAAKYAIKDSIEAHRESLAAAEAEVKTEGGDVDMTSEDVKKEPVETVDPVP
FT                   YITREHFAEAMKTAKRSVSDAELRRYEAYSQQMKASRGQFSNFNFGDSNQGTTETGNDG
FT                   NSGANFGSAGDDDDDLYS"
FT   CDS_pept        join(complement(925522..925576),complement(924990..925372))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000061063" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17441184"
FT                   /locus_tag="CAGL0J09372g"
FT                   /product="Similar to uniprot|Q04344 Saccharomyces
FT                   cerevisiae YDL125c YHI1"
FT                   /function="catalytic activity"
FT                   /protein_id="CAG61068.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="HOGENOM:HBG123543"
FT                   /db_xref="HOGENOM:HBG743217"
FT                   /db_xref="InterPro:IPR001310"
FT                   /db_xref="InterPro:IPR011146"
FT                   /db_xref="InterPro:IPR011151"
FT                   /db_xref="InterPro:IPR019808"
FT                   /db_xref="UniParc:UPI00003B6B21"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNS7"
FT                   /transl_table=1
FT                   /translation="MSASVAHDAACIFCKIIKGEIPSFKLIETKHVYSFLDIQPTSQGH
FT                   ALVIPKWHGAKLHDIPDEYLHDVLPTAKKIAKALNLDADGNYNILQNNGRLAHQEVDHV
FT                   HFHLIPKPDEKTGLIVGWPAKQADMDQLAKFHKELVAKLES"
FT   CDS_pept        925839..926774
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000250272" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19349793"
FT                   /locus_tag="CAGL0J09394g"
FT                   /product="Similar to uniprot|Q07551 Saccharomyces
FT                   cerevisiae YDL124w"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAG61069.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG416388"
FT                   /db_xref="HOGENOM:HBG605727"
FT                   /db_xref="InterPro:IPR001395"
FT                   /db_xref="InterPro:IPR018170"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="UniParc:UPI00003B6B22"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNS6"
FT                   /transl_table=1
FT                   /translation="MVKQEFFKLNNGHEMPGVAIVGTGTKWHKVNETDENFSQTLVDQL
FT                   KYALSLPGVVHLDAAEFYMTYREVGRALAETSKPRDEIFITDKYWTLSKVTENPIVGLE
FT                   TGLKRLGLEYVDLYLLHSPFISKETNGFSLEEAWGMMEELYHSGKAKNIGVSNFAKEDL
FT                   ERVLKVCKVKPQVNQIEFNAFLQNQTPGIYNFCKQNDIQLAAYSPLGPLQKKPADGNSQ
FT                   PFYSYINKLAQHYNKTPGQVLLRWVTKRGVVAVTTSEKKERIKQAQEIFEFDLKDDEVT
FT                   EITKLGLDHEPLRLYWHDQYNKYNSESQKA"
FT   CDS_pept        complement(926972..927418)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000175185" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17441185"
FT                   /locus_tag="CAGL0J09416g"
FT                   /product="Similar to uniprot|Q07549 Saccharomyces
FT                   cerevisiae YDL123w"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAG61070.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG123666"
FT                   /db_xref="HOGENOM:HBG741476"
FT                   /db_xref="InterPro:IPR000612"
FT                   /db_xref="UniParc:UPI00003B6B23"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNS5"
FT                   /transl_table=1
FT                   /translation="MCCCTFPDFLLMLLAFIFPPAAVVIRSGIASSDLVLNMLLTMCGF
FT                   VPGCIHAIYYISMTSPLRNDDYSTRYQQGWIDSERLVSSNSDTRPVPLATHDPTPQVES
FT                   SQGETPQATNDEVSRGYDVQTPLLNDPGYIVDNKKGGMPPPYSP"
FT   tRNA            928134..928207
FT                   /gene_name="tRNA-Ile (AAT)"
FT   CDS_pept        complement(928455..929489)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000966" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17441186"
FT                   /locus_tag="CAGL0J09460g"
FT                   /product="Strain CBS138 chromosome J complete sequence "
FT                   /function="nucleic acid binding"
FT                   /function="zinc ion binding"
FT                   /protein_id="CAG61071.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG123667"
FT                   /db_xref="HOGENOM:HBG203314"
FT                   /db_xref="InterPro:IPR001878"
FT                   /db_xref="InterPro:IPR013084"
FT                   /db_xref="InterPro:IPR016713"
FT                   /db_xref="UniParc:UPI00003B6B24"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNS4"
FT                   /transl_table=1
FT                   /translation="MTSLSEVETMDTLPFVKDTTPMSNDDIKVVAPSIEQVGNDPNELR
FT                   FLRGEGRYFGLDDSEGIKEPEPKCRNCSQRGHFKRDCPHVICTFCGSMDDHYSQHCPKA
FT                   IKCANCNKVGHYRSQCPNKWKRVFCTLCNSKLHDRDRCPSLWRSYLLREELTGKGNKKK
FT                   LDLDTDAIYCYNCGGNGHFGDDCNQRRSSRVPKDDGSAFAGNNLRDELRTKYYKKLDQE
FT                   RGKKGRKNNSKVKGNHKRFDDNNNFNYDDYEYDDSIYDEWDNSQLDRKYSGSTKKKNTN
FT                   KKQKKNNNSHRDPLEFPRSKRNDFNDNSKRGNFSRNDDKAKAKNMRWNNSKKNRKSYRS
FT                   TERN"
FT   CDS_pept        929926..930627
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000994" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19349794"
FT                   /locus_tag="CAGL0J09482g"
FT                   /product="Strain CBS138 chromosome J complete sequence "
FT                   /protein_id="CAG61072.1"
FT                   /db_xref="HOGENOM:HBG059578"
FT                   /db_xref="HOGENOM:HBG203931"
FT                   /db_xref="UniParc:UPI00003B6B25"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNS3"
FT                   /transl_table=1
FT                   /translation="MSLSDILPNDITTITSLGSFKATPGTRENTIYQALCNVPWLDGLG
FT                   RAQIIETKMLAVDRDLLFQIMMVENISKSKVTQIDDMKTTIDPRNQRVDRLHNSNPNGP
FT                   SKKYKVINEVNIEEDDGNGSTESNGVIGGEKVMYKLTLQSRSGQIFYAINLKPISWPLA
FT                   VLGSKIVIKKGTKFSRGMFLLAEDNAIFVGGMVKKWNEDKDLKILEYLETKANKENERL
FT                   QALKDSRKRKR"
FT   CDS_pept        complement(930802..932739)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000246234" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17441187"
FT                   /locus_tag="CAGL0J09504g"
FT                   /product="Strain CBS138 chromosome J complete sequence "
FT                   /function="methylenetetrahydrofolate reductase (NADPH)
FT                   activity"
FT                   /biological_process="methionine metabolic process "
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAG61073.1"
FT                   /db_xref="GO:0004489"
FT                   /db_xref="GO:0006555"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG068938"
FT                   /db_xref="HOGENOM:HBG649727"
FT                   /db_xref="InterPro:IPR003171"
FT                   /db_xref="InterPro:IPR004621"
FT                   /db_xref="UniParc:UPI00003B6B26"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNS2"
FT                   /transl_table=1
FT                   /translation="MSICKTFSDRDGPLISLEFFPPKTESGKRNLLERMERMSALDPLF
FT                   ITVTWGAGGSTSEKTLELAQIAQRDLNVPICMHLTCTNMDTTLIKEALDACRSYGIKNI
FT                   LALRGDAPIEDQWDDKTINSSEGPEFRYAVDLVRYIKENYGDEFCIGVAAYPEGHCEGE
FT                   AEGNEQDPLKDLVFLKEKIDAGAQFVITQLFYDVSKFLDFEKMFREQISETIPVFPGLM
FT                   PINSFSLFHRAARLSHASIPKAVLDRFPQEIQNDDGIVKSIGVDVLIDIIEEIYSKTNG
FT                   RVKCFHFYTLNLEKAVAQIVSQSSTLSKILEESDNEEDQVVSQDEDGDIVLVDQHEENP
FT                   LKFKRRRQSSSVSADVIFNRAIINRGKTDRNESSELASKKLVVSISRGSGVLGRDATWD
FT                   EFPNGRFGDSRSPAYGEIDGYGPSLKVSNKRAYELWGSPTSIRDLKAVFVKYLEGSIQS
FT                   LPWCDLGLSPETALIQEELIQLNYRGYLTLASQPCTNASSSTDKIFGWGPSKGHVYQKA
FT                   FIEMFVHRQQWKTILKPKLDYYGRRKFSYYAGDSKGSFETNLDPHSSNVVTWGVFPNSQ
FT                   VIQTTIIEEESFKAWRDEAFSIWSEWAKLFPRNTPSNTLLREVHSDYYLVSIVHHDFIE
FT                   TDELWDLLLD"
FT   CDS_pept        933145..936360
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000202204" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20196627"
FT                   /locus_tag="CAGL0J09526g"
FT                   /product="Strain CBS138 chromosome J complete sequence "
FT                   /function="DNA binding"
FT                   /function="endonuclease activity"
FT                   /biological_process="DNA repair"
FT                   /protein_id="CAG61074.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0004519"
FT                   /db_xref="GO:0006281"
FT                   /db_xref="HOGENOM:HBG113141"
FT                   /db_xref="HOGENOM:HBG396488"
FT                   /db_xref="InterPro:IPR006166"
FT                   /db_xref="InterPro:IPR006167"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR020819"
FT                   /db_xref="UniParc:UPI00003B6B27"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNS1"
FT                   /transl_table=1
FT                   /translation="MQLFVQDDSDDELQLELSQQEEQKQKQFNDSRRLIDETQQKNDEQ
FT                   VSVVSETTVYSPNDEDAILYPLIPDDLDESTEFKPNIEDIRPVDIQLNLSLPFQQQIIE
FT                   DVLATDDPLVIMGKGLGMVPIVSNLLHVLATPTVIKGQLKRSLVVVLNATGSENRQISE
FT                   ELEELNWLVNADDNAGPFASIDEDDDDDPKYSIFNEVTAETLSVEKRRQLYLKGGIVSV
FT                   TSRIFIVDLLSGTIHPNRITGFVVLNADNLRNFSNESFILEIYRSKNRWGFIKAFSNNP
FT                   ESFSMSFSPLINKMKELHLKNVLLWPRFRIEVSASLNNEKVINGQIRSDKVIEVRINPT
FT                   NAMSQIQFGLMGCLKKCIEELTRKNTEISIEYWNIENILDANFIRSIDAIMVPNWHRIS
FT                   FESKQLVKDIKYLKRLLKMLYSSDAVDFYEEVQLSLEANKPSLGRKYSESPWLMAEESQ
FT                   LVISYARQRIFNGQDYVLEELPKWDQLLSILDDIAYEKTTRNIEGSTLIVCNNNTTVLQ
FT                   LRRVISKYDNEFGMRNIMLSKLEWYKMKREERKRIVRDFKKEETEPEVQLSVSSSFAKE
FT                   EVVTKRRRTRGAAAVAAVQKLHSAGSGIDIEDVIENYDFNAEAQGTMKSTSDDLIEDYR
FT                   VEEQEGYYNVEDEGEYDDFENSTLFKEFMKREADLIDQTMQKKKENFEYLDRQDQLLIE
FT                   TFSRIGDDVLFEEMMPSYIIMYEPDLAFIRKVEIFRALKRENPPKIFFLYYGDSAEEQT
FT                   HLLSIKKEKDAFSKLIRENATLAQRFEAQTDLSHFKNLAERKLKLSNIRKTNTRTAGGQ
FT                   LGLRELTQDVVLVDTREFNAALPGLLFRYGVRVIPCMLTVGDYVLTPDICVERKSISDL
FT                   IGSLQNHRLEAQCKKMSKHYKYPTLMIEFDEGQSFSLEPFSERRLYRSRDSSTTHPISN
FT                   KLSQDDIQMKLCKLVMKFPGLRIMWCSSPLQSVNIILELKLGREQPDPNIAIELGLHRK
FT                   MGLSEKSIDNEQSFKKLLSIPVLSKIDYFNIRKKVKTFRKLTKMRLIDIQNVVGNEMVA
FT                   TKVYEFLHNDDNDDDDYDISDLD"
FT   CDS_pept        complement(936524..940777)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18501966"
FT                   /locus_tag="CAGL0J09548g"
FT                   /product="Similar to uniprot|P09547 Saccharomyces
FT                   cerevisiae YPL016w SWI1"
FT                   /function="DNA binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAG61075.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="HOGENOM:HBG123668"
FT                   /db_xref="InterPro:IPR001606"
FT                   /db_xref="UniParc:UPI00003B6B28"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNS0"
FT                   /transl_table=1
FT                   /translation="MDFFNSGAPEGDDNNMDSPFFNNEMNSTQFLFGDLMDTSNSGNQK
FT                   MDDSQFYNNKPFNDGDIRTQSNNSNMNMNMNISNTSNNNGNNNSNNMNNFVSNPNTPYT
FT                   VPGNFVTNQSPMGSVGSNFDAAPPQNSSAMNNFQASGSLSPQAILAKNSMVDNQILGLN
FT                   FNGADNSNNNMNANMTNTLSPQMTMSNIQSSANTPQQILMFNQSANTPGSSNNMNLSGS
FT                   NSTPGAVGANQDNMNMQFGSNMPSNSIMSTHGSPNIPNQMQQNNLPMNQNSGRSSSNNS
FT                   KISGKDALALQNASPQDRAAILAALQQRQQRRFQALQQQQIRKQQSQQQLQKQAQQQVQ
FT                   QQVHAQKQAQMQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQA
FT                   QAQAQAQAKAKAQAQAQAQAQAQAQAQAQAQAKAQAQAQAQAQARFKAQNRQAMQQPNS
FT                   PNPANGNLQQQKKSILQNLHPALQQKISMELNNKQYELFMKSLIENCKRIHMPLQSIPE
FT                   IQGKKVNLFYLFMFTQRLGGGEQISRNQQWNFLAQKLQISNAQELEGVYYKLIYPYEKF
FT                   LESPEGQKETQAKKFFLQQFLQELLKKVQQQQGLQQQQGLQQQPSQQPGQIQNQNQGQT
FT                   PTQLQQQAIPQKNQMHFSNQSQNMVGSFDTTNSPMINQQTTFDSKQRKENRRKKASTDT
FT                   PTGTPIATPVPSTSIINLDQNAKKAVKKPRKPRQKKKTKKELELEKKQLEEMQKKQQQY
FT                   IEEQQLQQKMVIEQKLKDQYKKELEKLPKVYKRSLCRNYTPLKRVIQRSNGYDIEYVAK
FT                   VGEKVNANKPIFLFAPELGTVNLHALSMSLQAGNIGEINVALNTLLVTSSDAVLELNIE
FT                   MYPELIESLCILGINLLSNLCENKSDLRLLQTNLFSYVLSDEVESFLSNDTCTFSKTNH
FT                   NIDQIFDKLAKNTVESGNSVRVDSLTGTDILQNSSLNDNQDSKDTIPPMTSEISDLLKP
FT                   IYNNTWDLLPTPVKYLQNQFPNKLHVPSYLLSLRAVKDEVDCPLTKVNTKGAENARILI
FT                   TDQLSTICMILRNASFSEANARILASNPFLRRFFADMLWAVFLDHEKFVFERKRLNFRK
FT                   DIAITLSNIAHLMPFHSSVDGFLLLILILSFGEPKKNSGSLRSDELSYNEYSLTWGKYQ
FT                   SFGVDVLSKLLSTEQSTKNIIMRLLFSFSSATRDDSLSKDELLTKKLVDAYCKGDQYKL
FT                   LNDVVSFLLSVIPFEQINETSSLLYSMTPLISQSITSLLLIVDQVCDEKSVNEYTLKKN
FT                   MPLIWLTTAENYGYKLRSLGKLYNDISGDTNELSKANGNSVMENMEFKKLAPLIGSSCL
FT                   KLVNLMIDKALEIDEKVKTNDKDEIASKTLAAVPELFPGEIESIEIITNQYLHPDILQQ
FT                   TQCLIELKDEILSRA"
FT   CDS_pept        complement(941571..943220)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17441188"
FT                   /locus_tag="CAGL0J09570g"
FT                   /product="Strain CBS138 chromosome J complete sequence "
FT                   /function="binding"
FT                   /protein_id="CAG61076.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG123669"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniParc:UPI00003B6B29"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNR9"
FT                   /transl_table=1
FT                   /translation="MDCRGGNSVLQLTRRIDSSLRFGKKLENKVSPRDEASAFLYTNVP
FT                   NAPNVQPTPLAIPSITLNKAASSSTCSSTSSHAHNNVNYCANNDSGYDLVREFKKINEP
FT                   APPTNNYNFTRHVPVSHRPIGFSPRTMGLQQPLNLDGSFDWEREFAQIEGELGESQNVL
FT                   EGTTVSYGGEREHQESVHSTSTVGYHYSSDLEEDCLNIYDYVSSKATSVHSEGNTCSAG
FT                   PGLARSPSYRNPLTRDAYVFNTENKYLNSSPSAYEIACILMENNCNLSEIILAFEAALQ
FT                   EHEQQHMVDCWYRLGIVQLQNEQEESAMDAFQHALELEPGHLEALKLLAVSHINQGNAV
FT                   EATVCLSRALELKGVTISNWPQELSILNVRETMENVLLDIPSTAINITRDKDILTVLAL
FT                   FNYLLGRSDNAIKCFEKLLEQDPKDEITWNHLGATLANSKRYDTAIQVYMNTIELKPSF
FT                   VRARYNLGSTLVKNGELQRGIESLLTALVMQGSPIPPIATNLESFIEHLIFTEAQGKNT
FT                   IVTSLKNALLKIPDDDIELKTNIENRIRLILS"
FT   CDS_pept        complement(944110..945030)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000172735" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18501967"
FT                   /gene_name="CWC2"
FT                   /locus_tag="CAGL0J09592g"
FT                   /product="Pre-mRNA-splicing factor CWC2 "
FT                   /function="RNA binding"
FT                   /function="nucleotide binding"
FT                   /function="zinc ion binding"
FT                   /biological_process="RNA splicing"
FT                   /biological_process="cell cycle"
FT                   /biological_process="mRNA processing"
FT                   /cellular_component="spliceosomal complex"
FT                   /protein_id="CAG61077.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0005681"
FT                   /db_xref="GO:0006397"
FT                   /db_xref="GO:0007049"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0008380"
FT                   /db_xref="HOGENOM:HBG177791"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR000571"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniParc:UPI00003B6B2A"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FNR8"
FT                   /transl_table=1
FT                   /translation="MDSDKGWRQRKARVQLAEVSGELAAAQQTHSVNIWYGKWQSSRHV
FT                   SVHRLDPERDSGVTRGDSSGTWKFCLYFARGLCALGHKCEYLHHIPEQSDFDRYLVEGT
FT                   PLLDCFGREKHAENREDMAGVGSFNQQNRTLYVGNIGNAAVMKNGKPLNSRQVESRIRY
FT                   MFGRLGPMDRVRYLPEKNCAFVRYRHHITAEFAKEAMRDQSLSLSMAQDAALGAQDSTG
FT                   LLVKWAREDPDPQSRAHKEEDLVNALLSLLPPQQTQTPSRTTSRTTNKTTNEATSKVRK
FT                   LHRKVYRTTTAAMSHKNILTSYDSD"
FT   CDS_pept        945660..946055
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000055227" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17441189"
FT                   /locus_tag="CAGL0J09614g"
FT                   /product="Strain CBS138 chromosome J complete sequence "
FT                   /biological_process="ribosome biogenesis"
FT                   /cellular_component="ribonucleoprotein complex "
FT                   /protein_id="CAG61078.1"
FT                   /db_xref="GO:0030529"
FT                   /db_xref="GO:0042254"
FT                   /db_xref="HOGENOM:HBG125288"
FT                   /db_xref="HOGENOM:HBG739027"
FT                   /db_xref="InterPro:IPR002415"
FT                   /db_xref="InterPro:IPR004037"
FT                   /db_xref="InterPro:IPR004038"
FT                   /db_xref="InterPro:IPR018492"
FT                   /db_xref="UniParc:UPI00003B6B2B"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNR7"
FT                   /transl_table=1
FT                   /translation="MPAVLPFAKPLASKKLNKKVLKTVKKASRAKNVKRGVKEVVKALR
FT                   KGEKGLVVIAGDISPADVISHIPVLCEDHGVPYLFVPSKQDLGSASATKRPTSVIFIVP
FT                   GSNKKDKSKEEEYKESYNEVVKEVKAL"
FT   CDS_pept        946436..948028
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248676" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17441190"
FT                   /locus_tag="CAGL0J09636g"
FT                   /product="Similar to uniprot|Q12315 Saccharomyces
FT                   cerevisiae YDL207w GLE1 RNA export mediator "
FT                   /biological_process="poly(A)+ mRNA export from nucleus "
FT                   /cellular_component="nuclear pore"
FT                   /protein_id="CAG61079.1"
FT                   /db_xref="GO:0005643"
FT                   /db_xref="GO:0016973"
FT                   /db_xref="HOGENOM:HBG123670"
FT                   /db_xref="InterPro:IPR012476"
FT                   /db_xref="UniParc:UPI00003B6B2C"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNR6"
FT                   /transl_table=1
FT                   /translation="MRFVLDELYSDEESSLDLGVGSDSDSSNDPDYSNIADPHDLYSPK
FT                   LRIPKKKDVPTKTRTAKEEEVTLLPEIARILEGKQFKSSVIAANTVPSVIHLSREEEQN
FT                   TESLIDKRKDNKLAHSLAPDVNIEQMEAQFSKVMLGKLDSLETLNRKRIEEVRAEKKRI
FT                   EEEQKRKLEEEKRRKELEDKRLKEEEERAKKEQEKQEKERLAALEAEKKREQEEKAKKQ
FT                   AQAQEKDKAQKAVTDFDSISKTFWKYKAKIKSIKEEIVIPVKNADKELRNILSKHKRKI
FT                   NPKFGQLTNTFSQLQSIQNELSHLIDETKGQQLAYLWILNFIAKAIVHQAETEVRAKPE
FT                   SSVPLARLALYIMVRYPEFKELLLARFVKKCPFVMGFTCDIGTEDGRGNMGWKRDSSGK
FT                   WEEPTSYNERIGAMVTLFSVITRLELPQEFIQTSNHPLPISHSWHLVARIANTPLKLIQ
FT                   DTHFVVLGSWWDAAAKEFLQAYGVQAAKLLQLVGDNLTSAVADRKYVGAARLRILLESW
FT                   QENKLESFPEMVP"
FT   CDS_pept        948675..950921
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000141961" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17441191"
FT                   /locus_tag="CAGL0J09658g"
FT                   /product="Similar to uniprot|Q12424 Saccharomyces
FT                   cerevisiae YDL206w"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAG61080.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG123671"
FT                   /db_xref="HOGENOM:HBG203187"
FT                   /db_xref="InterPro:IPR004837"
FT                   /db_xref="UniParc:UPI00003B6B2D"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNR5"
FT                   /transl_table=1
FT                   /translation="MAVIPRLLAVCLFYSINLIAVIRYFDYDDRSGFGFYSKLILLTEC
FT                   FMMLGILTSDYLIPSLSFISRDILKISDRVSGMTLLALGNAIPDITTTYQSMKRNETSL
FT                   ALGELIGGVFFLLTVILGVVGIVSTVKFEPSTSPFADYPESCETYRESMQSHSYSREIF
FT                   LQDMKIFLTMIVVSTLFLYDGRLFVWECLIMVVTYVACAAYMVSSHLNYGLENNSAVLN
FT                   GDDHSSLRDIIYDNLSTITEENENSSLLGDNDHIVSPLTNENVNIRLFEAGIAERRKYI
FT                   RRGIQRYMRTHYTGWVRMTLNDCLDLWEHSDMLKSQENLGKQDQDDIVDRTREIGSNEM
FT                   DQTEISDTLSELPLPEQLPISKRIKRRSTSLTSNLERLEIPKIVYSDFSQGLVSDRFEQ
FT                   TATPAPVPIFSTPQPLHAPVFDGRPPTYRSLSYDHLGDIIQERNYRSVSDNRSELGEDL
FT                   ENMISRVSGTGREKKWYTASKLITYLIDAEVTLPISELITLLFSFPITLLLAILIPNDV
FT                   FRSAVGDNSFITALQLSIAPMVFSFTLDNMFNIYWLSLVSIILLFSLLIFEAPLKDYQK
FT                   HITSCFAFVLSLGGISFTVHLILDVLTSWADSFNLSPSVLGLTIFAWGNSIGDLVSNIT
FT                   FVQLGVIDVALGACFGSPLLYILFGIGIDGILVMLNKHGFRMPEKWYSLLFNCIQFKID
FT                   AHLISSSIGIIVAFFILIVGVPVNKWRLDFKVSILLLGLYVAVTVINIIFALKS"
FT   CDS_pept        complement(952083..953072)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000228587" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20196628"
FT                   /gene_name="HEM3"
FT                   /locus_tag="CAGL0J09680g"
FT                   /product="Porphobilinogen deaminase "
FT                   /EC_number="2.5.1.61"
FT                   /function="hydroxymethylbilane synthase activity "
FT                   /biological_process="heme biosynthetic process "
FT                   /biological_process="peptidyl-pyrromethane cofactor linkage"
FT                   /protein_id="CAG61081.1"
FT                   /db_xref="GO:0004418"
FT                   /db_xref="GO:0006783"
FT                   /db_xref="GO:0018160"
FT                   /db_xref="HOGENOM:HBG127626"
FT                   /db_xref="HOGENOM:HBG624842"
FT                   /db_xref="InterPro:IPR000860"
FT                   /db_xref="InterPro:IPR022417"
FT                   /db_xref="InterPro:IPR022418"
FT                   /db_xref="InterPro:IPR022419"
FT                   /db_xref="UniParc:UPI00003B6B2E"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FNR4"
FT                   /transl_table=1
FT                   /translation="MTRESINIGGRRSKLAVVQSNHVRDLVQAKFPQYDCTVFTLQTLG
FT                   DQIQFKPLYSFGGKALWTKELEDYLYCEDQEKRLDLIVHSLKDMPTLLPDGFELGCVTK
FT                   RVDPTDCIVMPRGSPHRCLADLPEGAVVGTSSVRRSAQLKRKFPHLKYQSVRGNIHTRL
FT                   EKLDDPEGPFQCLVLASAGLVRMGLEDRITQRLHSDIMYHAVGQGALGIEIRQGDKKIL
FT                   QILDEIADLESTVCCLAERSLMRTLEGGCSVPIGVESSYDHKTKKLLLKGIVVNVEGTM
FT                   AIEDQQEVVVNDIREDSIKCGVLLAHKMIKDGAKKILDEINLERVIQQ"
FT   CDS_pept        complement(953621..955708)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000033781" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21045387"
FT                   /locus_tag="CAGL0J09702g"
FT                   /product="Similar to uniprot|Q07622 Saccharomyces
FT                   cerevisiae YDL203c"
FT                   /function="binding"
FT                   /protein_id="CAG61082.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG123672"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniParc:UPI00003B6B2F"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNR3"
FT                   /transl_table=1
FT                   /translation="MFNARDTQSGNRYETHINMYPVADSGVRDGTVSGAGASASASAKT
FT                   PYPIEDTAIGTLNRIPVFTKASMSPSPSPDELADESHGAGDKRYELPFMLSTGSTGSLG
FT                   GSASGGVMGGVIGGVSGSNAGTQPGVPRGDDAAGAEPVRREAHAKAANPFRQMIDYQDV
FT                   ETPPPPYVEKERKERDVLREKMYRTESRSPRKDTAGARPAEPDTGASVQPELAQPELVK
FT                   PELVKQRSESSTTTTGSSSSSKSKRDLTVFSREAVEFYEVYCSVVADQGNFTPSVQLKW
FT                   CETLLEYVFKPDFISHYNINAERLKRALKPEEAQKNQKVILEHAFKVLKKLISSRYAPA
FT                   IYLMGTLYSHQPYLDIKNKTIVTRNDEKALEFYCKAAALSHPESCYRAAVCYEFRRGCD
FT                   AALSHYECLQRAFQYYTQGAEQSTSCMYKLGMTHLYGLTSMNYAHEEDPRELERIVRQD
FT                   VPQALMWLSKATEQGSPQACYELGKIYEFTNMPLPIQQVLAESGIQRDTAKALAYYTRC
FT                   AREYDYPLAQWKLGHCYETGDLDVAVDPHKSIAWYYRSASDSSTLTTTGSTTGSTTTSE
FT                   GKTRRGNPMAMLALSGWCLTGSPGVLRSNDGEALRWAQRSSETAQGKLPRGVRARVLLR
FT                   ARHRHPWRHPGHPAGHRPLPPRAAVPQGRPGPPPPGPVESPHPPPPHTHTYIPSQSHTH
FT                   Y"
FT   CDS_pept        956118..956774
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000248019" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18501968"
FT                   /locus_tag="CAGL0J09724g"
FT                   /product="Similar to uniprot|P36521 Saccharomyces
FT                   cerevisiae YDL202w MRPL11"
FT                   /biological_process="ribosome biogenesis"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAG61083.1"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0042254"
FT                   /db_xref="HOGENOM:HBG059992"
FT                   /db_xref="HOGENOM:HBG396975"
FT                   /db_xref="InterPro:IPR001790"
FT                   /db_xref="UniParc:UPI00003B6B30"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNR2"
FT                   /transl_table=1
FT                   /translation="MNSVGLVWQCVRRYSRVAVESGLKRQTWKPIDSRKTFLLDSYRYM
FT                   MDNNSMVLFAHYNNLTKNEDHHFREQIKQAGGKLTRIRNNIFKVCLRTLDREDPAVYIK
FT                   NKKELPHHPLIPLLKGPTAVISFQDTDPQGVAKVFKLLKNAQDKLLVMGAKVDKEVYDF
FT                   AKLDQFKTLPTKEVLQGQLAGLLQMLGGAGLVQVLEANKQHLYLTLKSHEDNIKE"
FT   CDS_pept        957247..958104
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000260965" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17441192"
FT                   /gene_name="TRM8"
FT                   /locus_tag="CAGL0J09746g"
FT                   /product="tRNA (guanine-N(7)-)-methyltransferase "
FT                   /EC_number="2.1.1.33"
FT                   /function="tRNA (guanine-N7-)-methyltransferase activity "
FT                   /function="tRNA binding"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG61084.1"
FT                   /db_xref="GO:0000049"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0008176"
FT                   /db_xref="HOGENOM:HBG021827"
FT                   /db_xref="HOGENOM:HBG324627"
FT                   /db_xref="InterPro:IPR003358"
FT                   /db_xref="UniParc:UPI00003B6B31"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FNR1"
FT                   /transl_table=1
FT                   /translation="MKAKPLSNDPGSKRYAYRVNKEENRKELKHVKIDESSLVEGHQVD
FT                   LPKKRFYRQRAHSNPFSDHQLEYPGSPEEMDWTKLYPHYVDPESGKMTKKVTIADIGCG
FT                   FGGLLVDLSPEFPDDLILGMEIRVQVTNYVEDRIIALRTNHVKEQGYQNINVLRGNAMK
FT                   FLPNFFQKGQLSKMFFCFPDPHFKQRKHKARIITNTLLSEYAYVLREGGIVYTITDVKD
FT                   LHDWMVKHLTEHPLFERLPEEWEEEDSCVRIMRHATEEGKKVERKKGDKFVACFRRLPT
FT                   PEII"
FT   CDS_pept        complement(958467..959090)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000244137" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18501969"
FT                   /gene_name="MGT1"
FT                   /locus_tag="CAGL0J09768g"
FT                   /product="Methylated-DNA--protein-cysteine
FT                   methyltransferase"
FT                   /EC_number="2.1.1.63"
FT                   /function="DNA binding"
FT                   /function="methylated-DNA-[protein]-cysteine S-
FT                   methyltransferase activity"
FT                   /biological_process="DNA repair"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG61085.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003908"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006281"
FT                   /db_xref="HOGENOM:HBG533762"
FT                   /db_xref="HOGENOM:HBG752398"
FT                   /db_xref="HSSP:1WRJ"
FT                   /db_xref="InterPro:IPR001497"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR014048"
FT                   /db_xref="UniParc:UPI00003B6B32"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FNR0"
FT                   /transl_table=1
FT                   /translation="MEDLLYSFVVTDITSALVFVRRQTDALVYASLGLNKKQLLKGART
FT                   AFNQLSKKSAIHYNFKQIEVESEQEHVEKFQDTVNKFTKLLEGHIVKDLHYEYMFGTSL
FT                   QHRIWDELVKIPHGKVTTYKEIADKLKIKNGSRAIGSGIGSNNIAIVIPCHRVVCSNGT
FT                   LSGYKWSTSLKRKLLEREHVYASNKKDALNKDTKISLMKYKYSA"
FT   CDS_pept        complement(959883..960785)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000209259" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19349795"
FT                   /locus_tag="CAGL0J09790g"
FT                   /product="Similar to uniprot|P38988 Saccharomyces
FT                   cerevisiae YDL198c YHM1"
FT                   /function="binding"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAG61086.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG323910"
FT                   /db_xref="HOGENOM:HBG541806"
FT                   /db_xref="InterPro:IPR001993"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="UniParc:UPI00003B6B33"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNQ9"
FT                   /transl_table=1
FT                   /translation="MAHNDRKQSGVARLLGSASAGILEIGVFHPVDTISKRLMSNHTKI
FT                   TSGAQLNSVIFRDHAAEAFGKRVFTLFPGLGYAAVYKILQRVYKYGGQPFANEFLNKHF
FT                   KKDFDSAFGDKTGKALRSATAGSLIGIGEIVLLPLDVLKIKRQTNPEAFKGRGFLKILK
FT                   DEGIFNLYRGWGWTAARNAPGSFALFGGNAFAKEYILGLQDYSQATWSQNFISSIVGAS
FT                   ASLIVSAPLDVIKTRIQNRNFDNPESGFKIVKNTLKNEGFTAFFKGLTPKLLTTGPKLV
FT                   FSFALAQSLIPMFDNMLKK"
FT   CDS_pept        961496..962971
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000191477" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17441193"
FT                   /locus_tag="CAGL0J09812g"
FT                   /product="Strain CBS138 chromosome J complete sequence "
FT                   /function="alpha,alpha-trehalose-phosphate synthase (UDP-
FT                   forming) activity"
FT                   /biological_process="trehalose biosynthetic process "
FT                   /protein_id="CAG61087.1"
FT                   /db_xref="GO:0003825"
FT                   /db_xref="GO:0005992"
FT                   /db_xref="HOGENOM:HBG287181"
FT                   /db_xref="HOGENOM:HBG559076"
FT                   /db_xref="InterPro:IPR001830"
FT                   /db_xref="InterPro:IPR012766"
FT                   /db_xref="UniParc:UPI00003B6B34"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNQ8"
FT                   /transl_table=1
FT                   /translation="MTQIDKKEVSGNIIVVSNRLPVTISKDDTGKYQYKMSSGGLVTAL
FT                   QGLKKTATFKWYGWPGLEIPDDEKEQVKQDLLEQFNAVPVFLSDEVADLHYNGFSNSIL
FT                   WPLFHYHPGEINFDENAWLAYNEANRAFAEVIFETMQDDDLIWVHDYHLMLLPQMLQEE
FT                   ITKRKLRNVKLGWFLHTPFPSSEIYRILPVRQEILRGVLSCDLLGFHTYDYARHFLSSV
FT                   QRVLNVNTLPNGVEYQGRFVNVGAFPIGIDVSTFQDGLLKQQVKDRISQLKETFKGQKI
FT                   IIGVDRLDYIKGVPQKLHAMEVFLSEHPEWRGKVVLVQVAVPSRGDVEEYQYLRSVVNE
FT                   LVGRINGQFGTAEFVPIHFMHKSVPFEELISLYAVSDVCLVSSTRDGMNLVSYEYIACQ
FT                   EETKGSLILSEFAGAAQSLNGAIIVNPWNIDEMSDAINEALTLPEVKREVNWEKLFKYI
FT                   SKYTSAFWGENFVHELYNTSSSSGSIKSSEEKH"
FT   CDS_pept        963886..965109
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000233896" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21045388"
FT                   /locus_tag="CAGL0J09834g"
FT                   /product="Similar to uniprot|P38089 Saccharomyces
FT                   cerevisiae YBR125c PTC4"
FT                   /function="metal ion binding"
FT                   /function="protein serine/threonine phosphatase activity "
FT                   /biological_process="protein dephosphorylation "
FT                   /cellular_component="protein serine/threonine phosphatase
FT                   complex"
FT                   /protein_id="CAG61088.1"
FT                   /db_xref="GO:0004722"
FT                   /db_xref="GO:0006470"
FT                   /db_xref="GO:0008287"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="HOGENOM:HBG394483"
FT                   /db_xref="HOGENOM:HBG747569"
FT                   /db_xref="InterPro:IPR000222"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR014045"
FT                   /db_xref="InterPro:IPR015655"
FT                   /db_xref="UniParc:UPI00003B6B35"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNQ7"
FT                   /transl_table=1
FT                   /translation="MGQLLSHPLTEKTIEYNDYKTKSSAAGSVPRFYNCVGSMQGYRLS
FT                   QEDAHKVQNEDTILRVRFFNPFTGKHEKMMISMFAVFDGHGGDSCSKFLSGTSNPHLRA
FT                   GLAKWVVYSFENHRYGAKKNISSVDNGGANNYTNTPNNSINGSNADNSTSYTRHFRTME
FT                   GLISQIIKDAYIKQDQELHQHFANSACGSTAVVALIINGTMLYVANCGDSRCILSSKAR
FT                   GIKTMSYDHKPQNIGELIRINDNGGTVSLGRVGGVLALSRAFSDFQFKRGVVYKNTNPM
FT                   RISANGNHNSPTPPQEAQVSVEPDVLMHKLDFNKDEFLVLACDGIWDIYNNTRLIQFIK
FT                   YHLMQGMKLDGIMTKLLDHGIAQANSSTGVGFDNMTAIVVVLNRPDESLHDWMNKMKLR
FT                   LEREKGII"
FT   CDS_pept        complement(965386..965919)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248746" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20196629"
FT                   /locus_tag="CAGL0J09856g"
FT                   /product="Similar to uniprot|P36531 Saccharomyces
FT                   cerevisiae YBR122c MRPL36"
FT                   /protein_id="CAG61089.1"
FT                   /db_xref="HOGENOM:HBG123673"
FT                   /db_xref="HOGENOM:HBG397282"
FT                   /db_xref="UniParc:UPI00003B6B36"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNQ6"
FT                   /transl_table=1
FT                   /translation="MLRNLIWKRLASTGGHPNATKISLPRRPLKKIRPGKARPAIYHQF
FT                   NVKVELSDGSVISRRSQFPKDEFRLISDQRNNPLWNPSRDDLVVIDVNSGGSKDKFKQK
FT                   YSSIFSVDDAVDTKAEEKEVKSSKETKTEDKKEVKKDVEEDAFGVDDYLSLLDDSSKQI
FT                   KTGKLAQKKKKDKK"
FT   CDS_pept        complement(966181..968085)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000142016" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20196630"
FT                   /locus_tag="CAGL0J09878g"
FT                   /product="Similar to uniprot|P32367 Saccharomyces
FT                   cerevisiae YBR123c TFC1"
FT                   /protein_id="CAG61090.1"
FT                   /db_xref="HOGENOM:HBG058610"
FT                   /db_xref="HOGENOM:HBG204166"
FT                   /db_xref="InterPro:IPR019136"
FT                   /db_xref="UniParc:UPI00003B6B37"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNQ5"
FT                   /transl_table=1
FT                   /translation="MESNDTPAMEDVSQAVSSKYARYHTLDLPRISSVEFPLAISTKKH
FT                   SIVRAIEMCGGIEDVKQALDNSTEPSVTDKGLELFLNNGLSPVDPWDDATSSARKPFFN
FT                   EHPIIGKRVPFRDDSIVLKITMPEGTLEKNGNDVAKALRSLDSKDVCATPVAVVNNTIK
FT                   FREMSDFQVILDNVPAAREFQKSFGSLDWQNIKKFIDSVPDNDSRPQDNINNIILDRSV
FT                   KSPNCDFQLPPPPRFSMVGYPLQYKYKGNPFAVKKENGDHEVKGSYLKNYQLFVHDMSP
FT                   ELKVPVEPQDKLLEIYNQAKQSGVYPGTKKESKFFEALEECLAILRSLFEKRPIWVKRH
FT                   LDGLIPKNVYHTLKIALALLSYRFTMGPWRNTYIKFGVDPRSSSEYAKYQTEYFKIERK
FT                   LLESATVRKNIPKPPPLVFESDTKDGIDSRFRFDGTRIPWYLMLQIDLLLDEPNIAEVY
FT                   EKVEYLDKPNEVTGWFTALDLAKIRRIVKYELGCMVQGRYEFNKYKLKYFKSMLFFKES
FT                   MMNNNGENTDVDGDTNMDRDKNPDDITQDDDEENNGVEAGEDEETLQEKEDAESDNMKV
FT                   SVMKDISDDEQDEPEDDFDVNNATFQDIIGKIRRLDPELADKYSRDLSGLVNIAKLYD"
FT   CDS_pept        969083..969934
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000188277" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20196872"
FT                   /locus_tag="CAGL0J09900g"
FT                   /product="Similar to uniprot|P04840 Saccharomyces
FT                   cerevisiae YNL055c POR1"
FT                   /function="voltage-gated anion channel activity "
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="mitochondrial outer membrane "
FT                   /protein_id="CAG61091.1"
FT                   /db_xref="GO:0005741"
FT                   /db_xref="GO:0008308"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG058559"
FT                   /db_xref="HOGENOM:HBG396026"
FT                   /db_xref="InterPro:IPR001925"
FT                   /db_xref="UniParc:UPI00003B6B38"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNQ4"
FT                   /transl_table=1
FT                   /translation="MAPPFFSDIFKSVNDLLNKDFYHSTPAAVDLESVAKNGVKFNVKS
FT                   KQLVKEGPLAATVDAKFTDKATGLTLTQGWSNANNLNTKIELNNITPGLKTELMTSFVP
FT                   NISKVANLNLSFVQPFFTARGAFDLLKGPGFVGDMTLAHESGVVAGAQFGYDIAAGSLS
FT                   KYAIALGYAAQDYHLGLNINNDQVTTATFFQNVSPQLQIGSRATLNPRQTVSNVNIEFA
FT                   TKYLPDPNSQVKAKISDAGIVALSYKQALRPGVTLGVGTSFDALKLSEPVHKIGWSLSF
FT                   VI"
FT   CDS_pept        973259..974542
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000180870" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18502233"
FT                   /locus_tag="CAGL0J09922g"
FT                   /product="Strain CBS138 chromosome J complete sequence "
FT                   /protein_id="CAG61092.1"
FT                   /db_xref="HOGENOM:HBG059032"
FT                   /db_xref="HOGENOM:HBG398646"
FT                   /db_xref="InterPro:IPR005556"
FT                   /db_xref="UniParc:UPI00003B6B39"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNQ3"
FT                   /transl_table=1
FT                   /translation="MKFLTTAATLTAASILGSTALAAAMPDLKDCTTTAQGNHQHKRAV
FT                   AVEYVYETVIVDDQGHTLNVPPVKNDAASPTQAPKQSTQTPAAAPSTSTLAPASSSSPS
FT                   PAKKADSTTSTLAPSSSSSPSPSPSSSSSSSSSSQQSKPSSSTSSSSSYSGGIYGDLAA
FT                   FSGPSEKFQDGVIPCSQFPAGQGVIPISWLGENGWSGVENSDTSTGGDCKEGSYCSYAC
FT                   QPGMSKTQWPSSQPADGRSIGGLLCKNGYLYRSNTNADYLCEWGVNSAEVESKLSQGVA
FT                   ICRTDYPGTENMVIPTFVQAGATLPLTVVNQDTYYQWQGMKTSAQYYVNNAGISVEDGC
FT                   VWGNAGSGLGNWAPLNFGAGYTNGITYLSLIPNPNNKAPLNYNVKIVAADDSSVVNGEC
FT                   SYENGVYSGGADGCTVAVRSGKAKFVLY"
FT   CDS_pept        976274..978052
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248839" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20196873"
FT                   /locus_tag="CAGL0J09944g"
FT                   /product="Similar to uniprot|P53943 Saccharomyces
FT                   cerevisiae YNL065w"
FT                   /function="transporter activity"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="membrane"
FT                   /protein_id="CAG61093.1"
FT                   /db_xref="GO:0005215"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG058554"
FT                   /db_xref="HOGENOM:HBG397984"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI00003B6B3A"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNQ2"
FT                   /transl_table=1
FT                   /translation="MVESGPHSINDDLSTNEYIEQPKFYHDDHASDSNSLSDIDDDNKK
FT                   HGGLYGTVSRTTTRELPEDLESEISSTHSQDAKEDLEIQHNAAPYSLLNYRDKWCMVAL
FT                   LTACGFWSSLGSPIYYPALKQLEKQFDIDENMVNITVVVYLLFQGLAPTCSGGLADKFG
FT                   RRPVLLIGMLIYVVASIGLACAPSYGVIVFLRCVQSIGISPSIAISSGVVGDFTVKSER
FT                   GTFVGATSGFVLLGQAFGSLIGAALAAAWDWRAIFWFLTIGCGASFAICFALLPETKRS
FT                   IVGNLSIRPKNPLNIAPVTLLPAARRKLKYDNPDYETLDKTKPVFDLTSAFKICALPEI
FT                   FLSLLPPGLAFAMWTLMLSAISSELSAAPYNYKLTIIGVCYLPAGIGGLIGSFATGKII
FT                   DFQYKKKLKVFEEKKAAGIIPEDEKFNIMGARLQSVLPQNFLCVVTYILFGWSCDKGWK
FT                   IPSILITSCVSSFCAMSTLSAMSTLLVDLYPGKSSTASSCFNFMRCSLSAILMGCFAKM
FT                   KHSLTVGGTFTLLAGLVFVGNFLMFIPMKHGMRWREEREQRAALKAKSMDQANENGYKL
FT                   FSKIKFSSPFKSEEKV"
FT   CDS_pept        complement(978692..979915)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000226718" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21045658"
FT                   /locus_tag="CAGL0J09966g"
FT                   /product="Similar to uniprot|P25491 Saccharomyces
FT                   cerevisiae YNL064c YDJ1"
FT                   /function="ATP binding"
FT                   /function="heat shock protein binding"
FT                   /function="unfolded protein binding"
FT                   /biological_process="protein folding"
FT                   /biological_process="response to heat"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAG61094.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="GO:0009408"
FT                   /db_xref="GO:0031072"
FT                   /db_xref="GO:0051082"
FT                   /db_xref="HOGENOM:HBG436112"
FT                   /db_xref="HOGENOM:HBG635315"
FT                   /db_xref="InterPro:IPR001305"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR003095"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR012724"
FT                   /db_xref="InterPro:IPR015609"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="UniParc:UPI00003B6B3B"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNQ1"
FT                   /transl_table=1
FT                   /translation="MVKDTKLYDTLGVSPGASDAEIKKAYRKSALKYHPDKNPSEEAAE
FT                   KFKEVSSAYEILSDSQKREVYDQFGEEGLSGNGGAGFPGGFGFGEDIFSQFFGGATGGR
FT                   PRGPQRGRDIKHEMAASLEELYKGRTAKLALNKQILCKSCEGRGGKEGAVKKCSSCNGQ
FT                   GIKFVTRQMGPMIQRFQTECDVCHGTGDIIDAKDRCKSCNGKKVDNERKILEVRIEPGM
FT                   KDGQKIVFKGEADQAPDVIPGDVVFVISEKPHKHFQRAGDDLIYEAEIDLLTALAGGQF
FT                   ALEHVSGDWLKVDIVPGEVIAPGARKIVEGKGMPIQKYGGYGNLLIKFNIKFPENHFTS
FT                   EENLKKLEEILPPRRQINIPAKAQVDDCVLSEFDPSKFGQSNGRSGANYDSDDEDAHGG
FT                   EGVQCASQ"
FT   CDS_pept        980400..981422
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248841" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18502234"
FT                   /locus_tag="CAGL0J09988g"
FT                   /product="Similar to uniprot|P53944 Saccharomyces
FT                   cerevisiae YNL063w"
FT                   /function="nucleic acid binding"
FT                   /function="protein methyltransferase activity"
FT                   /protein_id="CAG61095.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0008276"
FT                   /db_xref="HOGENOM:HBG397981"
FT                   /db_xref="HOGENOM:HBG434728"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004556"
FT                   /db_xref="UniParc:UPI00003B6B3C"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNQ0"
FT                   /transl_table=1
FT                   /translation="MRIRPCDMRAAWGRHRWLPLLLPQCRSVDQALVEFGWMQGLAPDN
FT                   IVQGNAVQGNAVQGNIVQGNAVPGNTAARRLLRGCAARFRGVPLQYVLGSQPFGAAELV
FT                   CRPGVLIPRWETEEWALKLARAIARYSSQQPLAQPLKLTLVDLCTGTGCVPIGIHDELA
FT                   RAPSLIKYTAVDVSPQAIDLCRLNVGRRAIEVKQVDVLRQDSPADIVGGLGPGRGLGLG
FT                   RGPAIDILLCNPPYIPRKAFTRTTARSVRLYEPRLALIADKEFYKNLVDVWSQHTNSFV
FT                   YEIGDSSQYEYVKQALDPSVWSVGLHIDSNGCPRAVYGYRNSIPSIAYIFEEFKQPRYV
FT                   "
FT   CDS_pept        complement(981617..983038)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000248840" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21045659"
FT                   /gene_name="TRM6"
FT                   /locus_tag="CAGL0J10010g"
FT                   /product="tRNA (adenine-N(1)-)-methyltransferase non-
FT                   catalytic subunit TRM6"
FT                   /function="translation initiation factor activity "
FT                   /biological_process="regulation of translational initiation"
FT                   /biological_process="tRNA processing"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG61096.1"
FT                   /db_xref="GO:0003743"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006446"
FT                   /db_xref="GO:0008033"
FT                   /db_xref="HOGENOM:HBG058555"
FT                   /db_xref="HOGENOM:HBG397982"
FT                   /db_xref="InterPro:IPR007316"
FT                   /db_xref="InterPro:IPR017423"
FT                   /db_xref="UniParc:UPI00003B6B3D"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FNP9"
FT                   /transl_table=1
FT                   /translation="MDPLKSIVQDQHVILTLPSGNSKIVELKPDSSVSLGKFGAFQVND
FT                   ILGWPLGTTFEIYYDNVEEIVENKKKKPKSNELNKVPVGKVRLYKEVATDDKAEEEVEE
FT                   MDSSAVIPVELQNVLSSATNQGLINIGNDVQKLTMHDVERFKQQSASANEIITKMIESH
FT                   GSFHQKTIYSQEKYLKRKKQKFAKFFTVDYLSSSMLLKFLVEKGDIQRVLDLSEESLGM
FT                   ILNLTNIRSDGTYLCMDETGGLIVYTMLERMFGGKEDLDAPGKIVVINENEHPNLDLLK
FT                   FSNYSEKFIEKHVVTLSILDYFRPPTMEEVEGRFTPLSKEEVNKLKSGKRSAYSRKLKW
FT                   YYTQLRVIEMATKQQYDGLVVASTLHLPSLVPRLAERVHGARPIVCFSQFKETLLELAH
FT                   TLYSDLRYLAPTILETRCRPYQTARGKLHPLMTMRGGGGYLLWCHRVIPAPEPEIEEPT
FT                   DVNADEQEEKKQKME"
FT   CDS_pept        983405..985264
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000224258" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17442231"
FT                   /locus_tag="CAGL0J10032g"
FT                   /product="Similar to uniprot|P40991 Saccharomyces
FT                   cerevisiae YNL061w NOP2"
FT                   /function="RNA binding"
FT                   /function="S-adenosylmethionine-dependent methyltransferase
FT                   activity"
FT                   /biological_process="rRNA processing"
FT                   /protein_id="CAG61097.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0006364"
FT                   /db_xref="GO:0008757"
FT                   /db_xref="HOGENOM:HBG460167"
FT                   /db_xref="HOGENOM:HBG726909"
FT                   /db_xref="InterPro:IPR001678"
FT                   /db_xref="InterPro:IPR011023"
FT                   /db_xref="InterPro:IPR018314"
FT                   /db_xref="UniParc:UPI00003B6B3E"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNP8"
FT                   /transl_table=1
FT                   /translation="MGKGRSKFKQAAPPSLDEFLAKKEKKQNKLNKKSKRTHEDKDDGK
FT                   KSKKQKKSKSKRAETEETEEEPADLPEVDYEELSKAKKSLFDDEEDAGADSNDEEELDD
FT                   DELKDEFDLEQEYDYDEDEEAEAKPMFSDDEEDEEELERLNANNMEFLSKRLDEEEAEE
FT                   AEEAELELTEAHKQNPRADVLPSKEEEELMAQNPPDLTSIRTRIIEIVKVLEDFKTLGA
FT                   EGRSRSEYTDRLLKDICEYFGYTPFLAEKLFNLFSPAEALEFFEANEIARPITIRTNTL
FT                   KTSRRDLAQALVNRGVNLQPIGSWTKVGLQIFDSQVPIGATPEYLAGNYILQAASSFLP
FT                   VVALDPQENERVLDMASAPGGKTTYISALMKNTGCVFANDANKKRTKSLIANIHRLGCT
FT                   NTIVCNYDAREFPKVIGGFDRVLLDAPCSGTGVIGKDQSVKVSRTEKDFIQIPHLQKQL
FT                   LLSAIDSVDANSKKGGVIVYSTCSVAVEEDEAVVDYALRKRPNVKLVDTGLQIGKEGFV
FT                   SFRGKKFHPSLKLTRRYYPHTYNVDGFFVAKFQKIGPSPHDDNQATAKEKEAAARLEAI
FT                   EEGIIKEDFAEFEDEEDKEYIEKSKSKLLKKRGVNPKAKLEKK"
FT   CDS_pept        complement(985402..987666)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000171615" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17442232"
FT                   /locus_tag="CAGL0J10054g"
FT                   /product="Strain CBS138 chromosome J complete sequence "
FT                   /protein_id="CAG61098.1"
FT                   /db_xref="HOGENOM:HBG327501"
FT                   /db_xref="HOGENOM:HBG351854"
FT                   /db_xref="InterPro:IPR004000"
FT                   /db_xref="UniParc:UPI00003B6B3F"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNP7"
FT                   /transl_table=1
FT                   /translation="MSREVSRDASLTPLRVDIIEDPPLRNSYEHFIDSATYDPNIPIAI
FT                   DFGSYELRAGYTNISRPSHIFPNRFSKYRDRKTNKYLPCIGYDTWLDQTTRSQARSPFD
FT                   GPLVVNWDMVEDILQYTFHHLGVQPDNGVTNPIIINEKLACLQSQRSNWYQTLFESFGV
FT                   PKVSMAVEGMLAFYGHNGGSSTGIVIDCGYEDTNVIPIVEGQGMMLDAKRINWGGHSSI
FT                   DYLSNLLYLKYPYFPTKLSYLQYEKMYKDYCYVSQDYETDIEGYLTLGNLENKNVVVEA
FT                   PFVEVQAPQKSEEELRIQAEKRKESGKRLQEQARIKRKERLVQKREEYEYFSKVKEQLE
FT                   GEPKKKVLAVLQSAGFDDERDFKKYLYNVQRSIKKAEALELSEAVDEAEEEENMEGKFD
FT                   LVDIPDEQLNEEQKQEKKVQKLLKANYDARQKAKEEKERILKEVEEQKKKDEEWRSTDF
FT                   NGWLKDKRNRLHDLMQKRKEKLKLKEDMKDRKSQVAQNRMKNLANLAEDNARGTKRTRQ
FT                   QATIDNDPNDTFGANDEDWMVYNDITQNPEALDEAIEDEYKEIVDLEGILLEYDPNFTE
FT                   EDTLDAQYDWRNSVFHLFLRGPRPHDSENIHEQHQMHINVERIRVPEVMFQPILGGQDQ
FT                   AGITEICETIITKKFGSTPRNLSQQSLDMAKNVWLVGGNAQVPGLKSRVVKEFTEFLPS
FT                   DTKINVNISEAPTLDVWNGMYRLANTEEDYQRTIVTSEEYDECGVDYLKEHKLSNVPYF
FT                   E"
FT   CDS_pept        complement(988050..989186)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20196874"
FT                   /locus_tag="CAGL0J10076g"
FT                   /product="Similar to uniprot|P53947 Saccharomyces
FT                   cerevisiae YNL058c"
FT                   /protein_id="CAG61099.1"
FT                   /db_xref="HOGENOM:HBG123674"
FT                   /db_xref="UniParc:UPI00003B6B40"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNP6"
FT                   /transl_table=1
FT                   /translation="MLRRKRAFTDESLMLMERGLPRLVTTSTTPTPTTEPTTEPTTTKD
FT                   ETSQTSATDASTATTSTAATSTAATSSTSTDITATSLTITSSSLSTDVANIVPPSAENN
FT                   PYIFRTSALSGTVFIAVGSIAGAILMLIFLWWSITKYLNYKRTKKDYLESMATQYPYGS
FT                   RGGHAHHSSIFSTASSDVYSYGGDDEKLSLGHSRSQSVDKKTHEKVKKSKIGLFGGSTN
FT                   DIFKTPTRNDSWESLSDAITNYGDGSVHRFNPIQDDIQYNNRRSLFISPTVEVMNLPRQ
FT                   EVPDIFATPKKQQTSIYNDYDTPLIPDLSKPEDVALSPQRSHRKTPSNDKYHRRNRSSA
FT                   NLSPSRSPTRTPIRTRNMARDHRKTPSMYLEDLLDDNY"
FT   CDS_pept        989719..990279
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000188365" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18502235"
FT                   /locus_tag="CAGL0J10098g"
FT                   /product="Similar to uniprot|P53949 Saccharomyces
FT                   cerevisiae YNL056w"
FT                   /protein_id="CAG61100.1"
FT                   /db_xref="HOGENOM:HBG253090"
FT                   /db_xref="HOGENOM:HBG527347"
FT                   /db_xref="InterPro:IPR004861"
FT                   /db_xref="UniParc:UPI00003B6B41"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNP5"
FT                   /transl_table=1
FT                   /translation="MSGGRAKYIPPLNFAPIVSTDVSLYRSGYPMPLNYSFIRGQLHLK
FT                   TIIYVGDKSEPMPEYAEFLERERINYHHIHMDSCRDPDIDAQMDRVLQLVLRADNYPIL
FT                   IHSNKGKHRVGVVVGIIRKLLQGWSIAGIYQEYGLFSGGLKDEADLEYITMFETDILMD
FT                   PRTVPRFALRRHHPTVIQQETTP"
FT   CDS_pept        990695..993127
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093809" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17442233"
FT                   /locus_tag="CAGL0J10120g"
FT                   /product="Similar to uniprot|P41813 Saccharomyces
FT                   cerevisiae YNL068c FKH2"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="sequence-specific DNA binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG61101.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0043565"
FT                   /db_xref="HOGENOM:HBG059216"
FT                   /db_xref="HOGENOM:HBG396792"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR001766"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR018122"
FT                   /db_xref="UniParc:UPI00003B6B42"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNP4"
FT                   /transl_table=1
FT                   /translation="MEARSQHQQGLTNAVISALAVPEQSTTVSKQYSNERNVATEVQAY
FT                   AKISGRDWTYYVKNLEVSIGRNTDPSSKDGERDSGIDIDLGPAKVVSRRHATIKFNMEY
FT                   GGWELKILGRNGGKVNFHRVEAGANAPSIKLSSGTILDIGGTQMIFILPDQEPFIPQEC
FT                   LENLMPTLVSIYGVDGSNIANDNPLLREVIRESNYVKTHRELSRQPPGINQQVRTFKMY
FT                   GSGSSFHLGDSTPNFYGTAATPIPGMATSGIAANNKQPNSSYQNVNNAGPNGAGIGQNM
FT                   NTISDFPQSLDFASDLSRDENRNIKPPYSYATMITQAILSTGEGVISLADIYKYISSNY
FT                   SYYRYAKTGWQNSIRHNLSLNKAFEKVPRRPNEPGKGMKWRISKDYQEEFLQKWNSGNG
FT                   NKIRRGSSVSRQLQLHMSKFNRLPTQNDYSNDVASEDKKVTKKHSKKSSTSSGGTMSTV
FT                   NSGQNSLSSIESHPDVNFDKYGIMGSSRNSMQLLPPTLPEQPTNTMQPPIRETLEPITS
FT                   YSVARKNPTNNALVSFTNASSSYLKPTTSSNSAPSLPSISTKGIQNLPLPTTAGSASNL
FT                   LQQNPHLSPSYDSLLRSPTKSFHVTAMEAYTPERGSAQTNFSPSNSRGENNPTGVGLPS
FT                   VSLPNGHTFSDDMRKTELMPSIQDPNPGGLRSTNMSDRLTPANFGSAKSSQYRNSPGGW
FT                   NSLLFSSVNNTPKFSLDSDTKNGNQTPKDLNGSASVKSSISEGRPDVGNPSATTSNGND
FT                   LTVSVPDLDSKDINSSPLKRHLENRRDTEGNIPEDPSRKTDRNMLLDTDSAKITIVK"
FT   CDS_pept        join(994957..994990,995582..996150)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000225289" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17442234"
FT                   /locus_tag="CAGL0J10164g"
FT                   /product="Strain CBS138 chromosome J complete sequence "
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="large ribosomal subunit"
FT                   /protein_id="CAG61103.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="GO:0015934"
FT                   /db_xref="HOGENOM:HBG211133"
FT                   /db_xref="HOGENOM:HBG745735"
FT                   /db_xref="InterPro:IPR005755"
FT                   /db_xref="InterPro:IPR005822"
FT                   /db_xref="UniParc:UPI00003B6B44"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNP2"
FT                   /transl_table=1
FT                   /translation="MSTFEKVVVIDAKGHLVGRLASIVAKQLLNGQKIVVVRAEALNIS
FT                   GEFFRNKLKYHDFLRKATAFNKTRGPFHFRAPSRIFYKAVRGMISHKTARGKAALERLK
FT                   VFEGVPPPYDKKKRVVVPEALRVLRLKPGRKYTTLAKLSTSVGWKYEDVVAKLEEKRKV
FT                   RSAEYYAKKRAFNKKVTAATASAAETDAAKKLATLGY"
FT   CDS_pept        complement(996792..996974)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000200536" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20196875"
FT                   /locus_tag="CAGL0J10179g"
FT                   /product="Similar to uniprot|P53507 Saccharomyces
FT                   cerevisiae YNL070w TOM7"
FT                   /function="P-P-bond-hydrolysis-driven protein transmembrane
FT                   transporter activity"
FT                   /biological_process="intracellular protein transport "
FT                   /cellular_component="mitochondrial outer membrane "
FT                   /protein_id="CAG61104.1"
FT                   /db_xref="GO:0005741"
FT                   /db_xref="GO:0006886"
FT                   /db_xref="GO:0015450"
FT                   /db_xref="HOGENOM:HBG059214"
FT                   /db_xref="HOGENOM:HBG325118"
FT                   /db_xref="InterPro:IPR012621"
FT                   /db_xref="UniParc:UPI00003B6B45"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNP1"
FT                   /transl_table=1
FT                   /translation="MNFLPSFILSDESKERFNKILDLTQRVAHYGWIPFVLYLGWAQTA
FT                   NKPNLFNLLSPLPSV"
FT   CDS_pept        complement(997347..998756)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000281566" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20196876"
FT                   /locus_tag="CAGL0J10186g"
FT                   /product="Strain CBS138 chromosome J complete sequence "
FT                   /function="dihydrolipoyllysine-residue acetyltransferase
FT                   activity"
FT                   /biological_process="pyruvate metabolic process "
FT                   /cellular_component="pyruvate dehydrogenase complex "
FT                   /protein_id="CAG61105.1"
FT                   /db_xref="GO:0004742"
FT                   /db_xref="GO:0006090"
FT                   /db_xref="GO:0045254"
FT                   /db_xref="HOGENOM:HBG395225"
FT                   /db_xref="HOGENOM:HBG630916"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001078"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR004167"
FT                   /db_xref="InterPro:IPR006257"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="UniParc:UPI00003B6B46"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNP0"
FT                   /transl_table=1
FT                   /translation="MSALLRALPQVSRTALRGRLVTPMTLRLYASFPPHTVIGMPALSP
FT                   TMSQGNLAVWSKKEGDSLAPGDVLAEIETDKAQMDFEFQDEGYLAKILVPAGTKDVAVS
FT                   RPIAVYVEDEADVAAFKDFTVEDAGGSQSSSAPAAEEQKEEPKKEEVKEEKSEKKAAKS
FT                   NSTPSSVASGDRIIASPLAKTIALEKGIALKSVKGTGPRGRITKADVEKYLESAPKSTS
FT                   TAAPSATPSTTGGASYEDLEITNMRQIIGDRLLQSRQSIPSYIVSSDISVSKLLKLRKS
FT                   LNATAKDQYKLSINDILIKAVTVAARRVPDANSYWLQNEGIIRQFKNVDVSVAVATPTG
FT                   LLTPIVKNAESKGLIEISKEVKELASRAKINKLVPEEFQGGTICISNLGMNPAVSMFTS
FT                   IINPPQSTILAIGTVKRVAVEDAGAENGIAFDDQVTITGTFDHRTIDGAKGADFMRELK
FT                   TVIENPLQLLL"
FT   CDS_pept        complement(999365..1000288)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000100290" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17442235"
FT                   /locus_tag="CAGL0J10208g"
FT                   /product="Similar to uniprot|P53942 Saccharomyces
FT                   cerevisiae YNL072w RNH35"
FT                   /function="RNA binding"
FT                   /function="ribonuclease H activity"
FT                   /biological_process="RNA metabolic process"
FT                   /protein_id="CAG61106.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0004523"
FT                   /db_xref="GO:0016070"
FT                   /db_xref="HOGENOM:HBG303373"
FT                   /db_xref="HOGENOM:HBG584843"
FT                   /db_xref="InterPro:IPR001352"
FT                   /db_xref="InterPro:IPR004649"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR023160"
FT                   /db_xref="UniParc:UPI00003B6B47"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNN9"
FT                   /transl_table=1
FT                   /translation="MTVTEEKNVLPPTVQVSLNSLKTKTYYSEIPKSVIANESPVILGV
FT                   DEAGRGPVMGPMVYGISYCTKEYQDKVLIPKYTFDDSKKLTDPVRRMLFSKMYAGEIDQ
FT                   VGYATTAITPYDISTGMSRYPPSRNYNLNEQAHDVTMALIQGVIDRGVSIDHVYVDTVG
FT                   PPASYQRKLEDRFPSIKFTVAKKADSLYCVVSVASVVAKVTRDLLIESLRRTPDEIMGS
FT                   GYPSDPKTVAWLKGNQKPLLGWPIEIVRFSWQTCQTLLKDKSTGSVSIKWDEDYTNTKR
FT                   KLVPIPVPETNFYEKPPTLDNWFMRS"
FT   CDS_pept        complement(1000573..1002204)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000236577" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17442236"
FT                   /locus_tag="CAGL0J10230g"
FT                   /product="Similar to uniprot|P32048 Saccharomyces
FT                   cerevisiae YNL073w MSK1"
FT                   /function="ATP binding"
FT                   /function="lysine-tRNA ligase activity"
FT                   /function="nucleic acid binding"
FT                   /biological_process="lysyl-tRNA aminoacylation "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAG61107.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0004824"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006430"
FT                   /db_xref="HOGENOM:HBG370907"
FT                   /db_xref="HOGENOM:HBG631383"
FT                   /db_xref="InterPro:IPR002313"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR016027"
FT                   /db_xref="InterPro:IPR018149"
FT                   /db_xref="InterPro:IPR018150"
FT                   /db_xref="UniParc:UPI00003B6B48"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNN8"
FT                   /transl_table=1
FT                   /translation="MLRIVGARLLYASSRIRIGRGLASKVAIDSSNLEFTKRNELVLSS
FT                   LDRYYPSMSSIERGNLVSIDIFLKKYGSTSEDQLNKINQKISLCGRIKSIRFSGKKMAF
FT                   IDLVDGIHGIQLILNCREIGNSATFESELSFLRKGDYVMTTGLPRLSKSRMKNISLRCT
FT                   DLPKILSVAQMPLPPKLIDTVKSNSNKVVDYQINGFQNIRIRSSILKSIRNFLEERDFI
FT                   EVETPILSSKSNGAVAKPFMSSSKDFDKLMLRVAPELWLKRLIISGCNKVFEIGKSFRN
FT                   EGIDGSHNPEFTTLEFYQSYLTMEDLIKLNEDLFKKIITDLTNNLTIKQYLPESLLELE
FT                   DILKSNNWKFKRVEFLPTLSKELGVDLSQVKIEDSKQLLEVIPQKYKGQFFGKSSSYSS
FT                   SQILNRLCSELIEEKYCNSSHPTIIYHHPAVISPLAKSNPDDSRTTKRFELFIKGREYS
FT                   NAYEEENCPQVQLEKFEQQARMKEDYGDNDTLSSIDQEYINAMKWGMPPIGGFGLGIDR
FT                   LCMLITGCQRIEQVLPFGTLDDVNRQ"
FT   CDS_pept        complement(1002530..1003396)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000172063" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17442237"
FT                   /gene_name="IMP4"
FT                   /locus_tag="CAGL0J10252g"
FT                   /product="U3 small nucleolar ribonucleoprotein protein IMP4"
FT                   /function="ATP binding"
FT                   /function="aminoacyl-tRNA ligase activity"
FT                   /biological_process="rRNA processing"
FT                   /biological_process="translation"
FT                   /cellular_component="nucleolus"
FT                   /cellular_component="ribonucleoprotein complex "
FT                   /protein_id="CAG61108.1"
FT                   /db_xref="GO:0004812"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005730"
FT                   /db_xref="GO:0006364"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="GO:0030529"
FT                   /db_xref="HOGENOM:HBG055396"
FT                   /db_xref="HOGENOM:HBG601536"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR007109"
FT                   /db_xref="UniParc:UPI00003B6B49"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FNN7"
FT                   /transl_table=1
FT                   /translation="MLRRQARERREYLYRKAQELQETQLQQKRQIIKQALAQGKPLPKE
FT                   LAEDEQLQKDFRYDQSMADNEDEAGVDDEYSASSGIVEARVIVTTSRDPSSRLAQFAKE
FT                   IKLLFPNAVRLNRGNYVMADLVSACKKSGTTDLIVLHEHRGVPTSLTVSHFPYGPTAFF
FT                   SLHNVVLRHDILNRGNQSEVNPHLIFDNFTTPLGNRVVTILKNLFPPGPKKDSSRVITF
FT                   ANRGDFISVRQHVYVRTKDGVEMAEVGPRFEMRLFELRLGTLENKDADVEWQLRRFVRT
FT                   ANRKDYL"
FT   CDS_pept        complement(1003911..1005890)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000113596" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20196877"
FT                   /locus_tag="CAGL0J10274g"
FT                   /product="Strain CBS138 chromosome J complete sequence "
FT                   /protein_id="CAG61109.1"
FT                   /db_xref="HOGENOM:HBG123676"
FT                   /db_xref="HOGENOM:HBG202691"
FT                   /db_xref="InterPro:IPR013860"
FT                   /db_xref="UniParc:UPI00003B6B4A"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNN6"
FT                   /transl_table=1
FT                   /translation="MPSKLGLPRGPDNIPPLELSPGTDSKIPTGNAIKQTITQQHSEQQ
FT                   QKQRQQQHSQNNPNNKQNSGLSKQAISSEFLKVSPNLFTPERLHLFDTVELYTTLIKTS
FT                   KTIQQGERLGNLSWRILNKALLRNNDINISKKRDGVKNIYSVLNPMNNNGNNKSAATTF
FT                   GTTTNITSKKPQTSFTQILPKNENTDKRSKITAIRPMEALNGATEPRRNRSNDSFQKND
FT                   QHADIRGILSKERQHKSTTALFQKNHNRSENAGNQNDSDFNKSNHLLYKQFNQIKQKKK
FT                   KEDPQMVITGFDTNMVIIKKKHSSDSPNDKRNKSRSRSPEVLNIGKSNHKRSNSGTSQV
FT                   SDNNSKSIFKHESLFGKPNRRGSESKHNNNKTRKDNKIFFSSEDEDESDWDSVSDSSEF
FT                   YTDEIDEEDEDEQYYNKQWDKLVLAKQASNDKKLSAHGSELQDGAHHLEKIQSNNLSQP
FT                   IRRSLLSGLFHNGSSTYSTKDSGEDSGRSSLFNSQNSTPTSISGQNYKVSSAHKPTIET
FT                   TNVTAVGSVTPPHDSFMQPSQYIRETLTRSTSNMRSTSRRGSSSSIVSEATGARYLYES
FT                   NAPPTAHTLLPTALSTHMFVPNNIQQQRMAVKADVNQREGRRLTRRESMDIPIKNVKNS
FT                   VLKTRMEISEEERYQRSQMQRRHK"
FT   CDS_pept        complement(1006624..1008063)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000226718" [ FAMILY /