(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_11

ID   CAGLA1_11; SV 2; linear; genomic DNA; GRV; FUN; 1302831 BP.
XX
AC   CR380957_GR;
XX
DT   19-SEP-2006 (Rel. 106, Created)
DT   15-FEB-2011 (Rel. 128, Last updated, Version 21)
XX
DE   Candida glabrata (strain ATCC 2001 / NRRL Y-65 / CBS 138 / IFO 0622)
DE   chromosome K, complete sequence.
XX
KW   complete genome; genome reviews.
XX
OS   Candida glabrata (strain ATCC 2001 / NRRL Y-65 / CBS 138 / IFO 0622)
OC   Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina; Saccharomycetes;
OC   Saccharomycetales; Saccharomycetaceae; Nakaseomyces; mitosporic
OC   Nakaseomyces.
XX
RN   [1]
RX   PUBMED; 15229592.
RA   Dujon B., Sherman D., Fischer G., Durrens P., Casaregola S., Lafontaine
RA   I., de Montigny J., Marck C., Neuveglise C., Talla E., Goffard N.,
RA   Frangeul L., Aigle M., Anthouard V., Babour A., Barbe V., Barnay S.,
RA   Blanchin S., Beckerich J.-M., Beyne E., Bleykasten C., Boisrame A., Boyer
RA   J., Cattolico L., Confanioleri F., de Daruvar A., Despons L., Fabre E.,
RA   Fairhead C., Ferry-Dumazet H., Groppi A., Hantraye F., Hennequin C.,
RA   Jauniaux N., Joyet P., Kachouri R., Kerrest A., Koszul R., Lemaire M.,
RA   Lesur I., Ma L., Muller H., Nicaud J.-M., Nikolski M., Oztas S., Ozier-
RA   Kalogeropoulos O., Pellenz S., Potier S., Richard G.-F., Straub M.-L.,
RA   Suleau A., Swennen D., Tekaia F., Wesolowski-Louvel M., Westhof E., Wirth
RA   B., Zeniou-Meyer M., Zivanovic Y., Bolotin-Fukuhara M., Thierry A.,
RA   Bouchier C., Caudron B., Scarpelli C., Gaillardin C., Weissenbach J.,
RA   Wincker P., Souciet J.-L.
RT   "Genome evolution in yeasts.";
RL   Nature 430:35-44(2004).
XX
CC   This Genome Reviews entry was created from entry CR380957.2 in the
CC   EMBL/Genbank/DDBJ databases on 15 February 2011.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1302831
FT                   /organism="Candida glabrata"
FT                   /strain="ATCC 2001 = NRRL Y-65 = CBS 138 = IFO 0622"
FT                   /mol_type="genomic DNA"
FT                   /chromosome="Chromosome K"
FT                   /db_xref="taxon:284593"
FT   CDS_pept        complement(3332..5830)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21045672"
FT                   /locus_tag="CAGL0K00110g"
FT                   /product="Similarities with uniprot|Q08294 Saccharomyces
FT                   cerevisiae YOL155c"
FT                   /protein_id="CAG61192.1"
FT                   /db_xref="HOGENOM:HBG123728"
FT                   /db_xref="InterPro:IPR021031"
FT                   /db_xref="UniParc:UPI00003B6B94"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNG1"
FT                   /transl_table=1
FT                   /translation="MRKLPLFMAWKFWLICLYIIKVASTQIVIKSNTIVGGNNPSGFQN
FT                   GYIVSGDAFLAFQDMNTVPMYQTVRIDKGGALYYINNDKQGFSILSDHNYNHPFVFLNE
FT                   GTVVVDDRRSISPGSWTIKDGSFTNNGNIMFTSSQGDIFSIGSNYITNTGFIFSKGTSF
FT                   EKPQRLQIGNGNIWINTGTVCMANTTYILENAIQGGGCISVGENSVFNIYSFDMQQQTV
FT                   YLSHPSSVLILNGGHEVPVYGLGNGNGILYPDAPIRDIYYDSSTGIMDVTAGTNGIYKF
FT                   TVYIGAGYNESNFEIVSSIKIHGISYDNYNFVRYRGPPPNLAPSVCQPCVEIPLYSFQV
FT                   PDPYTTTNELGFSETVSFYSTYNENDIPVIGNTTIYVPPAIYTLTKVNENTTETDIISR
FT                   VTGMGYNGLPFTYYTTITVGEMETGVVTKTITITENKSRSTKTTLMSRNYTFSFSNYSP
FT                   ISSSGTYSVSTVDNITTLTDTVANVSSSGPNSIVTATMTTYQNNHEFNNASVINVTNSS
FT                   NIMVPITSTFYSSVDSNLTTPITSLTRTSQSQIVSHITKLASSINETTIANTFPSPAAS
FT                   GTNYTTVVTNAEGSVQTDIVSHITTTDSDGKPTTIVSHITTTDSDGKPTTIVTTFPAPA
FT                   ASGADYTTVVTNADGSVETDIVSHITTKDSIGKPTTVVTTVPYTLCASNADYTTVVTKS
FT                   NVSVETEVVSHITTTAPCSDLESHVENQTTSPSMHTTSLVGSENGVSAKTVNDKPNPTI
FT                   FTEVAVSEGTTSNAGYVTDQGSSLEMFAPTGASAVESGNKVSQTQTASIFHGAGSTFKI
FT                   KFNTILLSTSLTILILLGMA"
FT   CDS_pept        14140..18411
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17442278"
FT                   /locus_tag="CAGL0K00170g"
FT                   /product="Similarity"
FT                   /protein_id="CAR58049.1"
FT                   /db_xref="InterPro:IPR018871"
FT                   /db_xref="UniParc:UPI00017BD8CA"
FT                   /db_xref="UniProtKB/TrEMBL:B4UN33"
FT                   /transl_table=1
FT                   /translation="MFNWIIVSYLLIVQWVHANDLGFSLFDKRALSSQNPFGYPIGCSP
FT                   QSTNVIPGLTMELYSYPIVSGTPPNCYDASYVDPEYPRTGYLKRKMIGKSTGVTGSLNY
FT                   KFSVEKACMVKYGNLPAGYNYNEPLTVSNFTMLLYGYFKPQTSGIHTFFVNADDLLYIN
FT                   FGAGNAFDCCKREDSKFKLGEYVAYDIWHVDSSKNKVSLNLEKDVYYPIRMFFNNIGKD
FT                   SSLDLSFSVNGAVEHITDFSGYLYSVPDQPDACPAPIGYDTTCKSIDSTTTYSTQFITT
FT                   KPEENVLPITSTIYYIATPCAKTPSPVPNCEGGFLDPLKNTCYYPKPEDPKPEDPKPED
FT                   PKPEDPKPEDPKPEDPKPEDPKPEDPKPEDPKPEDPKPEDPKPEDPKPEKPIDPKPEEP
FT                   SHNPSSVNPSSVNPSSKPVDPSPADPSHNPSSVNPSSVNPSSVNPSSVNPSSKPVDPSP
FT                   ADPSHNPSSVNPSSVNPSSVNPSSVNPSSKPVDPSPADPSHNPSSVNPSSVNPSSVNPS
FT                   SVNPSSVNPSSVNPSSKPVDPSPADPSHNPSSVNPSSVNPSSVNPSSVNPSSKPVDPSP
FT                   ADPSHNPSSVNPSSVNPSSVNPSSVNPSSVNPSSKPVDPSPADPSHNPSSVNPSSVNPS
FT                   SVNPSSVNPSSKPVDPSPADPSHNPSSVNPSSVNPSSVNPSSVNPSSKPVDPSPADPSH
FT                   NPSSVNPSSVNPSSVNPSSVNPSSVNPSSKPVDPSPADPSHNPSSVNPSSVNPSSVNPS
FT                   SVNPSSKPVDPSPADPSHNPSSVNPSSVNPSSVNPSPSIFSPSVSTKTVTLSNGSTTTV
FT                   TVTVTPPSPNGGSSNSNTDSFSLPPPYTTTVSKSTTTETDIVSFFPSTDSDGHTRTGTT
FT                   TITLTGSKPGNNGDSDSFSLPPPYTTTVSKSTTTETDIVSFFPSTDSDGHTRTGTTTIT
FT                   LTGSKPGNNGDSDSFSLPPPYTTTVSKSTTTETDIVSFFPSTDSDGHTRTGTTTITLTG
FT                   SKPGNNGDSDSFSLPPPYTTTVSKSTTTETDIVSFFPSTDSDGHTRTGTTTITLTGSKP
FT                   GNNGDSDSFSLPPPYTTTVSKSTTTETDIVSFFPSTDSDGHTRTGTTTITLTGSKPGNN
FT                   GNVGTSSVPPVGNIVITPSVSTRTVTFTNGIISTITTTIRPPSPNGGGSGNNGNPPSPN
FT                   GGGSGNNGNPPSPNGGGSGNNGNPPSPNGGGSGNNGNPPSPNGGGSGNNGNPPSPNGGG
FT                   SGNNGNPPSPNGGGSGNNGNPPSPNGGGSGNNGNPPSPNGGGSGNNGNPPSPNGGGSGN
FT                   NGNPPSPNGGGSGNNGNPPSPNGGGSGNNGNPPSPNGGGSGNNGNPPSPNGGGSGNNGN
FT                   PPSPNGGGSGNNGNTPSPNGGGSGNNGNTPSPNGANSPRLSTSVAVNQPTLSTFKGEGS
FT                   QAVKMMPTKLLLLVLIAPIFL"
FT   CDS_pept        complement(20762..24604)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000047200" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21045673"
FT                   /locus_tag="CAGL0K00231g"
FT                   /product="Similar to uniprot|P28273 Saccharomyces
FT                   cerevisiae YKL215c"
FT                   /function="hydrolase activity"
FT                   /protein_id="CAG61195.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG285674"
FT                   /db_xref="HOGENOM:HBG305043"
FT                   /db_xref="InterPro:IPR002821"
FT                   /db_xref="InterPro:IPR003692"
FT                   /db_xref="InterPro:IPR008040"
FT                   /db_xref="UniParc:UPI00003B6B95"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNG0"
FT                   /transl_table=1
FT                   /translation="MSGNIRIAIDSGGTFTDCIGSKGTQCLDDDVVIKLLSVDPNNYPD
FT                   APLEGIRRILEIFQKKEIPRGSQLDLSNVSSIRMGTTIATNSALERTGEKCALVVTKGF
FT                   KDVINIGDQTRPDIFDLNIRKPLPLYSMVVEIDERVTIEDFSEDPTNKVTEINNSDIVE
FT                   GRSGEAIRILKEPDPDHIKTVLNVIYGTGIRSIAVAFVHSYTYPKHEQIVYDIAKAVGF
FT                   SNITLSSDISPMIKYLPRTHSALADAYLTPVLHGYLNRIEDGLKNVSMHSLQFMQSDGG
FT                   LVQKSKFSGLRSILSGPAGGVVGYSRTCFDTANEIPLIGFDMGGTSTDVSRFGENRLEH
FT                   IFETTTAGIIIQTPQLDIHTVAAGGSSILRWENSLFKVGPQSASADPGPACYRKGGPLT
FT                   ITDANLVLGRLVPQYFPKIFGRSENEGLDIDKSYALFKELTKNINNDLGKALSLEEVAY
FT                   GFLKVANAAMVRPIRAITETKGYMVSRHRLVSFGGAGGQHAIDIAESLNIDTVLFHRYS
FT                   SILSAYGIYLADVIEESQTPCSISTKELSFCERIKSIFQKLVEKNVSSLNEQGFDQANI
FT                   VHEKYLNMRYEGTESCIMIYEQDNSLNFEKWFLEQHEKEFGFTFNNRKIVVDDVRVRSI
FT                   GKSNVRTDSSVDEQVKKYIKRQTDMIQPQPEFSQQCYLRNKWQQIPVFNIKSLKIGVQI
FT                   KGPAILADETQTNVILENWTASILKTHIIVNKQEQERKRFTEVSDEINPIMLSIFSHRF
FT                   MDIAEQMGSQLRKTSVSTNVKERLDYSCALFDPVGNLVANAPHVPVHLGSMSTCIAAQA
FT                   KIWKGRLKKGDVIITNHPNSGGTHLPDITIITPSFSVSGEIIFFVASRAHHSDIGGILP
FT                   GSIPPNSKHLYEEGVSIFSDLIVEQGEFMEDRIFRIFVKEPEKYPLCSGARKFSDNLSD
FT                   LKAQIAANVKGVQLIQRLIDDFTLTTILKYMKAIQDNARNTIKSMLKKLTIYFNRNVFE
FT                   GKDYMDDGSVIQLKVTLLCEENKYIFDFSGTSPQMYGNLNAPHSIANSAIIYCLRCLVG
FT                   EDIPLNQGCLDPLTVILPVGSLLNPGEGAAVVGGNVLTSQRICDVILKTFQICADSQGD
FT                   CNNLTFGRRSETDINGKQIPGYGYYETICGGAGAGPSSILKQGWNGADAVHTNMTNTRM
FT                   TDVEIFERRYPVLLHKFEIRQNSGGKGKYNGGNGVIRDILFRDEVEVSILSERRALPPN
FT                   GIYGGECGQRGYNLWIKKDGSEINIGGKNTIIAKKGDRIVIMTPGGGGVGYGECS"
FT   CDS_pept        complement(25117..25623)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000142334" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17442279"
FT                   /locus_tag="CAGL0K00253g"
FT                   /product="Similar to uniprot|P36036 Saccharomyces
FT                   cerevisiae YKL214c"
FT                   /function="nucleic acid binding"
FT                   /function="nucleotide binding"
FT                   /protein_id="CAG61196.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="HOGENOM:HBG059260"
FT                   /db_xref="HOGENOM:HBG202301"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniParc:UPI00003B6B96"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNF9"
FT                   /transl_table=1
FT                   /translation="MSQNTKHHRVTNYRRRDLRNTLESRLGLPVEKRRLVPQLFRLKIT
FT                   NIGLDVSDYTILDIIKEFGEPEYINFRDHKDSRSCISDFKDNEIATKLIEKYNNFEING
FT                   KSIQVTLLDQQKRKRDADQERRKLRHGPRGGYGSHYTKSQKPIEQRNKTVDELNAELDA
FT                   YMKES"
FT   CDS_pept        complement(26129..28276)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000174247" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17442280"
FT                   /locus_tag="CAGL0K00275g"
FT                   /product="Similar to uniprot|P36037 Saccharomyces
FT                   cerevisiae YKL213c DOA1"
FT                   /protein_id="CAG61197.1"
FT                   /db_xref="HOGENOM:HBG020328"
FT                   /db_xref="HOGENOM:HBG395734"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR013535"
FT                   /db_xref="InterPro:IPR015155"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="UniParc:UPI00003B6B97"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNF8"
FT                   /transl_table=1
FT                   /translation="MYQLSATLRGHSQDVKDITAVNDNKIASVSRDGSLRVWTRSSSGD
FT                   WEDVLVYQSDKFLNAVCYDKTSQTVYYGGQDTLINGSHIEDVIGSSADPMYTLVGHTGN
FT                   VCGLRFQNGLLLSSSWDKTAKIWDNNKLKYDLRNHEASVWDSTMVSDDIILTASADKSI
FT                   GVWMEGKLIKKLSNIHDDVIRHLEYISNDIFASCSNDGTIKLLNLEGEIKNVFEGHESF
FT                   VYCVKHMNNTLFSCGEDSTVRIWSINGSTKQVIRIPAVSVWNLDLLPNGDFVICCSDNT
FT                   IRIFTEDQSRVASKDQLDAFKEELEKSAINSETINFDESKLSPYEVLSKPGKKEGQLVV
FT                   VKSPEGVTEAHQFSCGQWIKIGDVVGSATSGSDQKKEYEGKMYDYVFDVDVKENEPPLK
FT                   LPVNITDNPYDIADKFIARYELPPEYRDQIVQFILTNTTGMKVGDTATSDNNRDNSFTS
FT                   SQTFAMFPVTKILSNKNFNADSIFNGIVKFNLKEQSFDDEDLGLIGSSLQSVDESWEAL
FT                   YGYANRILKSWENKIPAFDILRVIVDKLPDPNNINDYIDLGLSNKDIVISMLTVKILVN
FT                   IFSNKIWGPQLLSSPKVYENIFETIETIYDNATEKKTSNLAIAVSTLLFNFSTMVINDK
FT                   NGTEMLPVICDTINTKFGPLEEYQANEEASYRLLMAYGNMATIEPTLLQYAKSITWIRQ
FT                   MKHNFGHIDRFKVIFTDLKLH"
FT   CDS_pept        30321..32204
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000189112" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18502245"
FT                   /locus_tag="CAGL0K00297g"
FT                   /product="Strain CBS138 chromosome K complete sequence "
FT                   /protein_id="CAG61198.1"
FT                   /db_xref="HOGENOM:HBG181309"
FT                   /db_xref="HOGENOM:HBG315443"
FT                   /db_xref="InterPro:IPR002013"
FT                   /db_xref="UniParc:UPI00003B6B98"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNF7"
FT                   /transl_table=1
FT                   /translation="MSGPLLFARNADGLYFKPLKNEDSKRVIHLSAHDQLLTAVDGGEF
FT                   PVAAKSTIKVAALLGFIRLKLNKYAIIADTVEESGRLDGHIIYKVVQHSIVNAKRSSRI
FT                   DKDEAEYLKLLEMQLKNSTLYFSYTYDLTNSYQRNEHIKSPVGSPYWKTCDKRFFWNHY
FT                   ITEELRSLAQEDSNVEVFIQPIIYGYAKVLDTGLNGVPINVGLITRRSIYRAGTRYFRR
FT                   GIDENGNVGNFNETEQILQVRKTGGNPELFSFLQTRGSVPVYWAEINNMKYKPKLVLGD
FT                   NSTLESTKKHFDEQVSLYGDNYLVNLVNQKGHELPVKEAYETAVAGLNNPKIHYIYFDF
FT                   HHECRNMKWHRVKLLIDHLTEMGLSSKDYFHKIFTMDGLKTEKIVSEQHSTVRTNCMDC
FT                   LDRTNVVQSVLAHWILQNELETSGVVGEEQLWEQDKSLLSLFQNLWADNADAVSFSYSG
FT                   TGALKTDFTRTGKRTKAGAFNDFVNSASRYYQNNLTDGPRQDSYDLFLGGFKPFSTGVV
FT                   SPFTDRRPFIIQAVPMLLYAAITVLGATILFPKGSFTDSKNMMYFICAAVTTAACVQFL
FT                   IKNGMQYVNWPKLMDVGFLVAMQTHNKEQEFRGFKYKPDPRFKAPTTSKKD"
FT   CDS_pept        34290..37334
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000167329" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17442281"
FT                   /locus_tag="CAGL0K00319g"
FT                   /product="Similar to uniprot|P22515 Saccharomyces
FT                   cerevisiae YKL210w UBA1"
FT                   /function="ATP binding"
FT                   /function="small protein activating enzyme activity "
FT                   /biological_process="protein modification process "
FT                   /protein_id="CAG61199.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006464"
FT                   /db_xref="GO:0008641"
FT                   /db_xref="HOGENOM:HBG356508"
FT                   /db_xref="HOGENOM:HBG517821"
FT                   /db_xref="InterPro:IPR000011"
FT                   /db_xref="InterPro:IPR000127"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR009036"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR018074"
FT                   /db_xref="InterPro:IPR018075"
FT                   /db_xref="InterPro:IPR018965"
FT                   /db_xref="InterPro:IPR019572"
FT                   /db_xref="UniParc:UPI00003B6B99"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNF6"
FT                   /transl_table=1
FT                   /translation="MSKETGEIDESLYSRQLYVLGKEAMLKMQLSNVLIVGLRGLGVEI
FT                   AKNVALAGVKSLTLFDPEKAVLQDLSTQFFLSESDIGRRRDEVTRGKLAELNSYVPVKT
FT                   LESLNDDDLKQFQVVVATETVSLEDKIKMNNICHNSGVKFIATETRGLFGQAFVDLGDE
FT                   FSVIDQTGEEPRTGIVSDIEPDGTVTMLDDSRHGLEDGNYVKFSEVQGLEKLNDGTLYK
FT                   VEVLGPFAFRIGSVKDLGEYKKGGIFTEVKVPKTLSFKTLQESLSEPEYVFSDFAKFDR
FT                   VGQLHLGFQALHQFALKHQGELPRTLNDEDANEVLKLVTDLAAQNPNVLGSEDAEINEK
FT                   LIRELSYQARGDIPGVVAFFGGLVAQEVLKACSGKFTPLKQYMYFDSLESLPDPKQYPR
FT                   TAENTAPINTRYDNQIAVFGIDFQRKLANSKVFLVGSGAIGCEMLKNWALMGLGSGPDG
FT                   RIIVTDNDSIEKSNLNRQFLFRPKDVGHDKSDVAARAVSSMNPDLEGKITPMTDKVGPD
FT                   TENIFDDAFWEGLDFVTNALDNIDARTYVDRRCVFYRKPLLESGTLGTKGNTQVIIPRL
FT                   SESYSSSRDPPEKSIPLCTLRSFPNKIDHTIAWAKSLFQGYFADAAENVNLYLNQQDYV
FT                   QQLMKQSGDVKGTLESIAESLNNKPNNFDDCIAWARLEFEKKFNHDIKQLLYNFPADAK
FT                   TSTGEPFWSGSKRAPTPLVFDVNEPDHFHFIVGAANLRAFNYGIKGDDGEPDVNYYNSV
FT                   LTHVDVPEFSPNKNLQIQVNDEDPDPNAGSQNDNLDQLAASLPDPKTLNGFQLAPVEFE
FT                   KDDDTNHHIEFIAACSNCRALNYSIEVADRQKTKFIAGRIIPAIATTTGLVTGLVNLEL
FT                   YKVVDGKDDIEVYRNGFVNLALPFFGFSEPISSPKGKYNDKTYDKIWDRFDINGDIKLS
FT                   DLIDHFEKVEGLEITMLSYGVSLLYASFFPPKKLKERLNLPITELVKLVTKKDLSSHLK
FT                   TMILEICADDKEGEDVEVPYVTIHL"
FT   CDS_pept        complement(37531..37953)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19350086"
FT                   /locus_tag="CAGL0K00341g"
FT                   /product="Similarity"
FT                   /protein_id="CAG61200.1"
FT                   /db_xref="HOGENOM:HBG123877"
FT                   /db_xref="UniParc:UPI00003B6B9A"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNF5"
FT                   /transl_table=1
FT                   /translation="MFSSLLWIIVCNPLLHGGVVALTNGARTLTKEIQYIFWFSAVIQA
FT                   VCFPFMGRNIVTSCVRGSSEFWCNVDVFMFILALFVLTGSIYTAINKVGITNKMIRKKI
FT                   TEFRLKTMAGVSPVNQVIILITIIVALGLIPLISDM"
FT   CDS_pept        complement(38281..41964)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093959" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17442282"
FT                   /locus_tag="CAGL0K00363g"
FT                   /product="Similar to uniprot|P12866 Saccharomyces
FT                   cerevisiae YKL209c STE6"
FT                   /function="ATP binding"
FT                   /function="ATPase activity, coupled to transmembrane
FT                   movement of substances"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAG61201.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0042626"
FT                   /db_xref="HOGENOM:HBG059570"
FT                   /db_xref="HOGENOM:HBG396815"
FT                   /db_xref="InterPro:IPR001140"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017940"
FT                   /db_xref="UniParc:UPI00003B6B9B"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNF4"
FT                   /transl_table=1
FT                   /translation="MLSIFKRYHKGNIYMNIRFRKNIWLLILILVCTVINGLVPAISSI
FT                   LFGRIFHLLDDNSDKVDYNTKRKQLVIRTMSILILGMGNLPFNWLAIYGWMMLGERQSY
FT                   IIRKKLFHEYFNLPCSWFDKYRSDIMGEFTQLHRCIEEVRSSSAEASAIMSQSLVAVIA
FT                   LIGTAFYFSWSLTLIIFCSTPFIIICAVIFSKYIHKYTEKENTESECAAERLAWMLKNI
FT                   EFVRLHNGDDFEISMYTHYIAQANEYYIKASLFISANISILRLLSLLMFVQGFWFGSSM
FT                   IKQGKLNIDSVITSFHCCLMLGSIINSALGQAVVLQKGDVAMKRLLKMIDRTPRESLAF
FT                   IDAISGIDLLPIVFNNVSFCYPERKTDKVFDKMNFIIKPNKMTYVIGPSGSGKSTLFDL
FT                   ILLHYDNYHGSIMLGDLDIRSINRNIILENITLVSQTPTLFNDTIRNNILACSNWTNLP
FT                   SKLEMECICKFALLENLIAELPDGLDTRIGSGGIKLSGGQAQKVALARAFARNTSILLL
FT                   DEPLSAVDMRQRIVLMENIKRWRNGKTTVIITHDLEFIRNTDNILNISERKILSSALNT
FT                   EKTQEFKWDDHLTSESIYDNSATVSTDVSYLEEEAFQGEEYQYFAFSAGISEYDQKDLE
FT                   SNTKSVILIPFNEIIYKFIISSSKKHVLVIGLIAAIIAAICNPVFSYTFSYLMNGLLPT
FT                   SYNSPGSEYLLKFSLIVSLIALCDGVSTFIKLFFLGYSGEFWIFELRQETFIKIIKNPI
FT                   SWFSKSNNKAPILSTLLINDLRDLRNLVTEFLSVITTLILVTSIGLVWAIAIGWKLSLV
FT                   CIAIIPLVVVLTGLYGTILIKTENRYKTSVANLESIVYEAIIGMKTIQSLCLQQYITKK
FT                   FNCKIKLLEKNGTYRAVATGLGIALTNMLVLLFQSILFYYGFKLVLTGEYTHSKLFETI
FT                   ALLLFTIVTVASLVTQLPDITRGQRSISWIDQILKGDNQQTIEPPSNLSTTKGIWNPNQ
FT                   PVIEVSNLSFTYAQVHNKKTLTNINMQLYSNQIYGIVGKSGSGKSTLINLICGLYSLSE
FT                   GSINICSCDINKWSTKELHKTVALLQQNPVLQFDTIRNNLLYGLTETVGDEHLLNVLEY
FT                   VGLKSFIISLNNGLDSKLDDSLLSGGQSQRLCMAREMLRNPKVLILDECTSALDVTSAK
FT                   KINDIIGSRSLAPVTIIVSHQKETIKLCDKIFFLVDGTVAMMGTYEELMENNWEFRKLL
FT                   NL"
FT   CDS_pept        42643..43347
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18502246"
FT                   /locus_tag="CAGL0K00385g"
FT                   /product="Similar to uniprot|P36038 Saccharomyces
FT                   cerevisiae YKL208w CBT1"
FT                   /protein_id="CAG61202.1"
FT                   /db_xref="HOGENOM:HBG123733"
FT                   /db_xref="UniParc:UPI00003B6B9C"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNF3"
FT                   /transl_table=1
FT                   /translation="MRTSMILKRSHNLSRYVELPNYYTKFAHEQPAEIRSLGRELQPYA
FT                   RTLRYKELFESYDFFCVYKWESVQNKDTRFHIRNVWQSFHSDIPKGTNSLFVKERMSCP
FT                   SMDSLLGRKIYGDDTPMLRMSWHRTNEIDSIIKLLEKVYAKENVFHLHSVGISLPQHPI
FT                   ILKQLQPLLETTSQNFDYEKLMSIAKKHQNNQSKDKIKVETLLQGLAQRSIVTPLLLKD
FT                   GQWLVLMPKEKK"
FT   CDS_pept        43874..44683
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000158234" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18502247"
FT                   /locus_tag="CAGL0K00407g"
FT                   /product="Similar to uniprot|P36039 Saccharomyces
FT                   cerevisiae YKL207w"
FT                   /protein_id="CAG61203.1"
FT                   /db_xref="HOGENOM:HBG500347"
FT                   /db_xref="HOGENOM:HBG626693"
FT                   /db_xref="InterPro:IPR002809"
FT                   /db_xref="InterPro:IPR008568"
FT                   /db_xref="UniParc:UPI00003B6B9D"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNF2"
FT                   /transl_table=1
FT                   /translation="MWFDWVWTAVTISGSHVVDELTLDTRLKYWVLLPISVVMVLAGIL
FT                   RHYVMSLLNPSVKGTARVKLTENQYVLKAQVLLGNNSSLSDEAFEVRREYMAQLLSSGK
FT                   YIAQTNAKPGEVVNPFSDPNISDAMMNMAKGNMAQFIPQTVLMWWVNHFFAGFVLMKLP
FT                   FPLTIRFKEMLQSGVMTSDLDVRWVSSISWYFISVLGLNPVYNLILAEPEEDQLGMMQQ
FT                   QQPDQMMGGPGAPQPEAVMKGLANDLTIAQHESCFDNIESRILKMYS"
FT   CDS_pept        45259..46407
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000191633" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18502248"
FT                   /locus_tag="CAGL0K00429g"
FT                   /product="Similar to uniprot|P47122 Saccharomyces
FT                   cerevisiae YJR072c"
FT                   /function="nucleotide binding"
FT                   /protein_id="CAG61204.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="HOGENOM:HBG409872"
FT                   /db_xref="HOGENOM:HBG460599"
FT                   /db_xref="InterPro:IPR004130"
FT                   /db_xref="UniParc:UPI00003B6B9E"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNF1"
FT                   /transl_table=1
FT                   /translation="MALSTVICIGMAGSGKTTFMQRLNSHIRSKKEVPYVINLDPAVLR
FT                   VPYGANIDIRDSIKYKKVMENYQLGPNGAIVTSLNLFSTKIDQVIKLVEKKRDTHDFCI
FT                   IDTPGQIECFVWSASGSIITESFASTFPTVIAYIVDTPRNSSPTTFMSNMLYACSILYK
FT                   TKLPMIIVFNKTDVKKSDFAKEWMTDFEAFQQAVREDQDANGDFGMGSGYMSSLVNSMS
FT                   LMLEEFYSTLDVVGVSSFTGEGFDDFLDAVDKKVDEYEEFYKAERERILKQKEEEEKLR
FT                   KDKSLNGLMKDLGLNDKKDKEDDSADVISDLEEGENDGLVDRDEDEGVERQYTFAGDER
FT                   LTGEVNEDSTPALQKRYQEALEDVGKSVSSETAENIARYIRQ"
FT   CDS_pept        complement(46532..47338)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000066091" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17442283"
FT                   /locus_tag="CAGL0K00451g"
FT                   /product="Similar to uniprot|P36040 Saccharomyces
FT                   cerevisiae YKL206c"
FT                   /protein_id="CAG61205.1"
FT                   /db_xref="HOGENOM:HBG059569"
FT                   /db_xref="HOGENOM:HBG202343"
FT                   /db_xref="InterPro:IPR016562"
FT                   /db_xref="InterPro:IPR019151"
FT                   /db_xref="UniParc:UPI00003B6B9F"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNF0"
FT                   /transl_table=1
FT                   /translation="MTAKLIIPLIGTGNVPQLSIDLLLHSTNSFNYVKRIDSKFCYPFS
FT                   GPLDHAAGEDPKLYNGKTLFSSAIELFKQKDEQIYVIQQRTPIIPGYLNNFIVETLIPV
FT                   LHEYQITELIVLDSFGALDGVVESLNGSGSFFNVGTCNLSSVNDLIQQFDDHLNLRNNG
FT                   QVNRVKAFNFDDKGIQQDITTEQDIFKVVYHLTNTSNLQLNKIKYYSTFVHEGDNSEDA
FT                   YTFYNNLMLAQPEVFPRIDEFHPPVSWKGVYGFTPIRSAYDEGLYT"
FT   CDS_pept        48964..52155
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000111186" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21045674"
FT                   /gene_name="LOS1"
FT                   /locus_tag="CAGL0K00473g"
FT                   /product="Exportin-T"
FT                   /function="tRNA binding"
FT                   /biological_process="tRNA processing"
FT                   /biological_process="transport"
FT                   /cellular_component="cytoplasm"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG61206.1"
FT                   /db_xref="GO:0000049"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006810"
FT                   /db_xref="GO:0008033"
FT                   /db_xref="HOGENOM:HBG055977"
FT                   /db_xref="HOGENOM:HBG397794"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR013598"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI00003B6BA0"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FNE9"
FT                   /transl_table=1
FT                   /translation="MLARIREVVSIANGSTSSDPESKRQAIEYFEQLKNDVQSTEIFVS
FT                   LMTDEGSDDLMRFVALQVVCEQIGNGILSQAQLTFVRNAAIELLRSKVNVPNGNLKSTP
FT                   EYIRTKIAELVTRLFYVLYQDQWQSFFPDLTEILQIQSLLENPNENFSLIGIDYFCRIC
FT                   VFINSEIADQTFVRSKEIQQKNNDLKDQMRVQDVQRLVTIWINTLKSIAPNKQPDIAIM
FT                   IMACIGSYISWIDVTLIVVPEYVSLIINYLEFPETKISCAQCLCEIISKKMKPVDKLSL
FT                   LSLLDLTTKVASFDNSVDDVDISEQLARLASAVGTELTIILEQCNEANPPTEESQQLFS
FT                   AADQQILLQVIPLILKFMLHEYDSVTQQSFQFISQYLAVMKKMFAVGGKAGSVVAVNSK
FT                   RQSLDSAHEEFLVSLLQVCFKKMKIDESCTEESVDDIEVFCESIRSKLKVFQDTVAVIN
FT                   PQIFLTNISACIQNLINSADWRDIELVIYQLHNLSESIRNNLFGLPKNQIINSEPSMIM
FT                   NNFMRLLLDNSTVFQMDSSYVQISFFELIVRHYQFLSFSGTKDELSLLNIFCSPFGMFN
FT                   KREKTRLRTWYLFSRLLKTTKPKFPISVLNEIVGKIAPLLPIKVYSLNNDGVEEDSIFE
FT                   SQLYLFEGLGVLIGGNTDSNFEILNEILTPLFTDLEACISSSQEQPQVVLQCHHILLAI
FT                   GTLARAVHSGLVPENRVNNALVSKKLIHRSLIEKFMNIAEVVLVTFSYFSKHETIRDAS
FT                   RFTFSRLIPILSDDIVPFANKLILLYLESNLKMMEMSDFLSFLGQMIHMFHKEQSCFEL
FT                   FNNLLGPVISKVHVLMTQIEQERNGEENPEWNGTTLNKGHGSNGKNIIITDAFRDKMLL
FT                   KKAYMGFLQSFVTNNVTSLLLTTQGREVLPTILNDVLEYTPQEIQELSVMKLSLNVLVN
FT                   FVKFFGSGKCTDPEDMYAASIEKLDGLNEFFITKVIPLVFEIPFKPEYKFNVREGSCRV
FT                   IASDLSRLLLELYLQSGGGTSIDTNPCLKYLTEVYLPMVQFPPELIMDLVQNLITSNPK
FT                   SFEKYFVQLITNFTA"
FT   CDS_pept        53462..55564
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19350087"
FT                   /locus_tag="CAGL0K00495g"
FT                   /product="Strain CBS138 chromosome K complete sequence "
FT                   /protein_id="CAG61207.1"
FT                   /db_xref="HOGENOM:HBG123742"
FT                   /db_xref="UniParc:UPI00003B6BA1"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNE8"
FT                   /transl_table=1
FT                   /translation="MNFDDSGFFGQRTTGAEQADNQPSQPQSGAQNLSRFFGEFIRRTE
FT                   NNDETLPDSGNPLQERPQVNIDIGIPSNSGANTTMENASATISVSQLEQSLFSNRIQPG
FT                   MVQQQFPVNDHKEEHPVIFEALEMDITEFKPVNTSKEHVYSINELLELSKEIPKHTIES
FT                   ISSMLPKKKFWRLYQKHSEPRSGNNKTRGTDNSFDKKNAKGKGQKLSNTKKFGNKFGRN
FT                   DRSGYVEENDINTNNDDLIALEEEIGSAPNSMMDFEAWKAKMKEMERRKKGLGGSVDSI
FT                   NPTGGDIPSRSSSALNHNHISEAGTNSISEFLNISSSKIVSNPENELSLQGDDTEIQMN
FT                   NSPDVAVENEISTRESSTTDLTQIDENRKGGSSRFSSFFSTTSKSKTKDVGPIIESHPN
FT                   VTTADSSPVKQQGSSTGGSRLMSFFDNKEKNVSSNLQLNSSNSSPKLSMLSSKKEENAN
FT                   QGNMRMEPLNSSMHPHIDNHNITRQGQNMPPINRQDSDRQHTAPTQIMPGMVFPPNPQN
FT                   NSSFFQDLLSKGKTNDHIRSSMPPPGLMHPGSGNNSSNMGNQRMMPMGMPPPGYPMGMP
FT                   PPNMMPGPGMPGFPLNNRGQPLGQIPQSKPADSKDGNIDNLQRGNNVNMKGPQFMQNMP
FT                   PPPGFAPLPNIPMGFPSGQFPPGMGPPPMNQTNFGKNPMNVPASNPYAENQKSAMDNNN
FT                   QQAFKR"
FT   CDS_pept        complement(55747..63162)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000163215" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17442284"
FT                   /locus_tag="CAGL0K00517g"
FT                   /product="Strain CBS138 chromosome K complete sequence "
FT                   /function="ATP binding"
FT                   /function="kinase activity"
FT                   /function="phosphotransferase activity, alcohol group as
FT                   acceptor"
FT                   /protein_id="CAG61208.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0016301"
FT                   /db_xref="GO:0016773"
FT                   /db_xref="HOGENOM:HBG143897"
FT                   /db_xref="HOGENOM:HBG320181"
FT                   /db_xref="InterPro:IPR000403"
FT                   /db_xref="InterPro:IPR003151"
FT                   /db_xref="InterPro:IPR003152"
FT                   /db_xref="InterPro:IPR009076"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR014009"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR018936"
FT                   /db_xref="UniParc:UPI00003B6BA2"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNE7"
FT                   /transl_table=1
FT                   /translation="MQAILRKGADKRIKTGNKSNKLTVRKHRKSEEELSNVSAPGGDPT
FT                   DNSTARRAASSANGEENAKFIDLENGWDDSDISPSNLYDLFERLKSDDQMVRTNTAMEL
FT                   RTSIISIAREIPTDQFQRFINTLNNKIFELIHGSSSNEKMGGILAVDSLIDFYLEIGEL
FT                   SNQTTRLANYLRVLIPSNDIDVMRLATQTLGKLALPRGTVTSEFVDFEVKTCLEWLTAS
FT                   TDNPPLNFKQEYRRHAAILILYSLIENSPYLLFPYINPILDNIWGSLKDTKLIIRRDAA
FT                   ETMRKCMETLQSRDPQNAREWYQRSFSTATQGLNSNNIESIHATLLTFKELLNLKDSYI
FT                   KDKYSQIFQVVIKFRDHKNDIVRREVYAILPLLAMNDSDIFASKYLDPTMSFYLKVLKD
FT                   MDSSTANNADKEAIFISIGDLSENVRSKMHSYIHQLEINLREGLQTKYKIRKHYEKALF
FT                   YCIIKLTAALGPAIATNINKGFLDLILSCPLSSHLLEVMATIKKSIPALSTSIDKRLIE
FT                   IVHAYLSGERYNDGTNSQIMKTVSLPLARKWRDRDYCWKTGDQNSDNNDDFLLVQTLKM
FT                   VDIIDPKHLVSEHTKMSIIAYIEHTHETVRKLAALKSVELYKLTEANLPDDEHALDTSA
FT                   TVLGKLLVLAITDPNSNIRLSILQSFDYHFSSQLAQPDNLRLLFCSVNDEVYTIRLEAI
FT                   RVIGALTEFNPIYVVPEMQKIFLSFLTELKYSATNRKKENMLTLIHAVINSHPDTLVPF
FT                   IKDCLDSLIQRLEDNSSAVATIAMKTIGALAEAVGPDITNYVHQLMPIIISTLHNQLNS
FT                   IKRATAIKTLIQISSSTAYVIDPLIEYPELLGLLMNILKTESNMEIKRDIIQLIGTLGA
FT                   IDPYKYRAVETNSKGVQKIDTTQHSTAIDLLIKGMSPSNEEFYPSVVMHSLVKILNDNS
FT                   LSSYHTNTLQTIMRIFQDMGVQSIIFLKILVPAIKSVVKTCPPSHLEFYFQQLSVLVNT
FT                   VNHHIEPFTEDIFEIIADHFSITKLQVVIISLIESMSHLVKNNLKRFLPKTVNLFLNVL
FT                   ENDRSNQKMASVSIMKALIAFGKNLEDYSHLIIPTIVRICEYSQNHLRKISIVTFGKLA
FT                   KCINLTELSSMIINALVRVLTNGDKSLIKVTMNTLCLLLLQLGNDFVVYIPTIHSVLIK
FT                   NRIQHSIYDQLVNKLLNGEVLNTNILLDKDSEEKNKNINLQNNPRTEKFVVDQQILKSA
FT                   WDCSQQKSKEDWQEWFRRLSVHTIRESASPSLRACSNLVSVYNPLARDLFNVSFSSCWN
FT                   ELNIGSREHILNSLCSALSSPQNPTEIYLILINLIEFMEHDMNPLPIPATITGEYAQKC
FT                   NAFAKALHYKETEFIENEKPCIIESLIDINNQLHQPDASIGILKYAQQHYNLQLKETWY
FT                   EKLQRWDDALQAYTDREKNGEDTPEVLMGKMRSLYALGNWSEIADLANDKWNTVPLHIQ
FT                   EKLSPIAAGSSWALHNWDDIEKYCSILQDNSIDKEFFSTVMCLHHNNFEEAEQHADNVN
FT                   SLLVGEMSALINESYSRIYNSVAKCQTVAELKEIIKYKRLPRMSPKRKAMRETWNKRLL
FT                   GCQQNIDVWQVILKTRSLVVNPEDDEEIWIKFANLCRRNGRMNMTRDVLNSLLKFNEMS
FT                   ENPDILQASPEVVYSYLKYKWDTGEKNSALNQLAIFIGKVIRDLGLHPEHIISNKTFQS
FT                   KTNISPNERPKYQKLLATCFAKQGDWTIALDPNWSNTDPGSVLSSYLLATHFDPQWYKA
FT                   WHNWALANFEVISMMSSTNKDTNYQKSNAPITSFYQIRNNIFEKNGETPYYNQFPSRLI
FT                   NNHVVSAIKGFFHSIALSDSSLLQDALRLLTLWFTFGSTSETTQAMQEGFNMVKISTWL
FT                   EVLPQLISHIHQPNPLISRALLTLLSDLGKEHPQALVYPLTVAIKSESLSRQKAAISII
FT                   DNVRSHSPVLVDQAELLSRELIRVVALWNEMWYEGLEDASRHFFGENDNTKMLETLEPL
FT                   YELLNKGPETIREISFKYAFGKDLTYAYEWVKKYKETGEVSNLNQAWDIYYSIFKKINK
FT                   QLPQMETLELQHVSPKLLAAKNLELAMPGTYIPGTEIVTIESVNGTCEVISSKQRPRKI
FT                   ALKGSDGKEYLYVLKGHEDIRQDSLVMQLFGLVNTLLQNDIECFQRHLDIQQYAAIPLS
FT                   PKTGLLGWVTESDTIHVLIKDYRDAKKMPLNIEHLVMLQMAPDYDSLTLLQKVEVFKYV
FT                   LDNTQGFDLYNILWLKSKSSETWLERRTTYTRSLAVMSMTGYILGLGDRHPSNLMLNRN
FT                   TGKVVHIDFGDCFEAAILREKFPEKVPFRLTRMLIKAMEVSGVEGSFRITCENVMRVLR
FT                   DNKDSLMAILEAFAFDPLIRWGFDLPTEQIKKENDKHFKATESIYGIDEASSMSNITTT
FT                   SVKDKKREYINTRAVLVLKRISSKLTGNDIPKHEDLDVAEQVDHLIEQAKSVENLCQHY
FT                   IGWCPFW"
FT   CDS_pept        complement(64028..65398)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000173247" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21045675"
FT                   /locus_tag="CAGL0K00539g"
FT                   /product="Strain CBS138 chromosome K complete sequence "
FT                   /biological_process="intracellular protein transport "
FT                   /biological_process="vesicle-mediated transport "
FT                   /cellular_component="clathrin adaptor complex"
FT                   /protein_id="CAG61209.1"
FT                   /db_xref="GO:0006886"
FT                   /db_xref="GO:0016192"
FT                   /db_xref="GO:0030131"
FT                   /db_xref="HOGENOM:HBG058183"
FT                   /db_xref="HOGENOM:HBG525531"
FT                   /db_xref="InterPro:IPR001392"
FT                   /db_xref="InterPro:IPR008968"
FT                   /db_xref="InterPro:IPR011012"
FT                   /db_xref="InterPro:IPR018240"
FT                   /db_xref="InterPro:IPR022775"
FT                   /db_xref="UniParc:UPI00003B6BA3"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNE6"
FT                   /transl_table=1
FT                   /translation="MASAIYFCDNKGRPLLSRKYRDDIPFSAIDRFPILLSNFEEETNL
FT                   IPPCIEHNGIQFLFIQHNDLYLVAIATSISCNAALIFSFLHKVIEVLSEYLKAVEEESI
FT                   RDNFVIIYELLDEMMDYGIPQITEPKMLKQYITQKSFKLKKAAKKKRNAARPPTSLTNS
FT                   VSWRPEGIKHKKNEAFLDIIESINMLMTQKGQVLRSEIIGEVKVKSKLSGMPDLKLGIN
FT                   DKGLFSKYLEGDENGVPIAPDDSSVDESKPKKKRSNNMELEDLKFHQCVRLSKFENEKQ
FT                   ITFIPPDGDFELMSYRLSTAIKPLIWCDVNIKTHSKSRIEIFCRAKAQIKKKSTATNVE
FT                   ILIPVPEDADTPVFKYSHGSIKYVPEKNAILWKIRTFPGDKEYSMAAEMGLPSTNAGEE
FT                   SEKLKRPVQVKFQIPYFTTSGIQVRYLKIEEKNLQYKSYPWVRYITKSGDDYTIRLS"
FT   tRNA            complement(66068..66139)
FT                   /gene_name="tRNA-Asp (GTC)"
FT   CDS_pept        complement(67074..67970)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000160635" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19350088"
FT                   /locus_tag="CAGL0K00583g"
FT                   /product="Similar to uniprot|P25358 Saccharomyces
FT                   cerevisiae YCR034w V-SNARE bypass mutant "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAG61210.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG055438"
FT                   /db_xref="HOGENOM:HBG331215"
FT                   /db_xref="InterPro:IPR002076"
FT                   /db_xref="UniParc:UPI00003B6BA4"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNE5"
FT                   /transl_table=1
FT                   /translation="MLQDYTPTVDRPFFNIYLWSHFNDAASYLTNGRFVPDEFQFFPGG
FT                   PPLSKFSHVLVGIATYYLLVFGGRYMLRNTRPFKLNTLFQCHNLFLTSFSFLLLTLMVE
FT                   QLVPLLIRHGLYDTLCSKYAWTQPLMTLYYLNYLTKFVEFIDTLFLVVKHKNLTFLHTY
FT                   HHGATALLCYIQLVGHTTIAWVPITLNLGVHVVMYWYYFLAARGIRVWWKEWVTRFQII
FT                   QFILDVGFIYFAAYQKTAYRFYPSWPHCGDCVGTLTSNYSGCAIISSYLFLFIAFYIEV
FT                   YKRSGTKKPVTTNKKKN"
FT   CDS_pept        69112..70683
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000057140" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17442285"
FT                   /locus_tag="CAGL0K00605g"
FT                   /product="Strain CBS138 chromosome K complete sequence "
FT                   /function="ATP binding"
FT                   /function="nucleoside-triphosphatase activity"
FT                   /protein_id="CAG61211.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0017111"
FT                   /db_xref="HOGENOM:HBG059665"
FT                   /db_xref="HOGENOM:HBG202240"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR016314"
FT                   /db_xref="UniParc:UPI00003B6BA5"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNE4"
FT                   /transl_table=1
FT                   /translation="MSYQRALRPRNTPLPVTPTKDVPVNVVPLKRTKLVFETPIQTKRH
FT                   REAESLPSPAASPKKQCVGVSHGLLSLTARVKACLQRSASTQYDDVSGCLVSRRTQFDQ
FT                   VIQFLNSAISEGRSDSLYITGPPGTGKTAQLNSILKHRFTPVASPVSPLSDITNLHDFV
FT                   LPNGNVEKVAIISINCITVNDPSSIFNKIYLSFLNSDGGNRAVPQRYSVKTMLDLKNFM
FT                   TRYASEMTFIVILDEMDKLVHTNSASVNATKVIFELFLLAKLPEIKLLLIGIANSLDLK
FT                   DRFLSRLNLKQELLPETVVFQPYTADQMYEIINHRINSVLLATEESLFNPMAIRFAAKK
FT                   CSGNTGDLRKLLDILRNSVEVMELERITASRRCVTDENDRPLPAENKPMKVGLQHIAKV
FT                   FTQINNTQSTKSMITKLNMQQRIVLCTLIHRQKIDIFQGHCTIDDAYDYYLKLLRGSEN
FT                   FVALKRNEFLEICNALEMMGVATITTGRISGKRRGMVKLIKGTVDNNEFNQEMSKFDIL
FT                   KELLII"
FT   CDS_pept        71269..72501
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000159361" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18502249"
FT                   /locus_tag="CAGL0K00627g"
FT                   /product="Similar to uniprot|P39542 Saccharomyces
FT                   cerevisiae YJL193w"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAG61212.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG202245"
FT                   /db_xref="HOGENOM:HBG517207"
FT                   /db_xref="InterPro:IPR004853"
FT                   /db_xref="UniParc:UPI00003B6BA6"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNE3"
FT                   /transl_table=1
FT                   /translation="MLTKLPHSVQTNIHIITLCLCWYFISSLASQVTKQILTICPLPLF
FT                   LGEFQFLFTALLAAISCALAFNYRWIYDLFPEGTFPRYYVTIHEHENERDQERIYAITR
FT                   PSKHIITTVLPLSFFQFVGKYFGHTATALVPVSTVASVKTLSPVFIVIFQKMLKMPTVN
FT                   LNVRILTSLAALIFGVWLIVNEDNKQKLASKKKTQLIDTESGRSSNYGIVCAIISMFIF
FT                   VMQNIYGKKVFTYKRNHEKTMIPKKKSIYNLGDNPSELPIYSESKTLSPKTTKYDKLTL
FT                   MIYISLVGFSLSFFWFMTIEFSTVWRYLCGYTTQSDGQPLIISTIPWTLFLLNGVFHFM
FT                   QAMITFHLLGEVSTLTYSIANLMKRIAIISVSWLFAGIHVTLLQIVGLSLNAIGLFLYE
FT                   RYSSTQKHANK"
FT   CDS_pept        complement(72798..73532)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000057138" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19350339"
FT                   /gene_name="SOP4"
FT                   /locus_tag="CAGL0K00649g"
FT                   /product="Protein SOP4"
FT                   /biological_process="protein transport"
FT                   /cellular_component="endoplasmic reticulum membrane "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAG61213.1"
FT                   /db_xref="GO:0005789"
FT                   /db_xref="GO:0015031"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG059663"
FT                   /db_xref="HOGENOM:HBG202246"
FT                   /db_xref="UniParc:UPI00003B6BA7"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FNE2"
FT                   /transl_table=1
FT                   /translation="MWKSVIYLFVLLLGVIRAEDVKDLRNNEVSIKGRLELSEIDISAY
FT                   MIPRCSFRLYQIGNYSADKPFHQITRIKDKNGTFEFNHVPINHGVNESTYFVMTPSSRD
FT                   FNLLPQRVLVEVTNIFNETTGKVEQQLKAFRNYFGREYFPSKDIHFPDKLEEMDALPYI
FT                   SIKMSKMLPFRDYLQQRNVGLLQSGPLAGILNSKWKIAAVITLLALMTFPYLVEKLDPE
FT                   TARAMKEEARKKQREKYVVKEE"
FT   mat_peptide     complement(72801..73478)
FT                   /gene_name="SOP4"
FT                   /locus_tag="CAGL0K00649g"
FT                   /product="Protein SOP4"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FNE2 "
FT   sig_peptide     complement(73479..73532)
FT                   /gene_name="SOP4"
FT                   /locus_tag="CAGL0K00649g"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FNE2 "
FT   CDS_pept        join(74297..74306,74866..75272)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000111598" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20197141"
FT                   /locus_tag="CAGL0K00671g"
FT                   /product="Strain CBS138 chromosome K complete sequence "
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="CAG61214.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG119370"
FT                   /db_xref="HOGENOM:HBG385416"
FT                   /db_xref="InterPro:IPR001971"
FT                   /db_xref="InterPro:IPR018102"
FT                   /db_xref="UniParc:UPI00003B6BA8"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNE1"
FT                   /transl_table=1
FT                   /translation="MAKDLVQSRDASQVFGVARIYASFNDTFVHVTDLSGRETISRVTG
FT                   GMKVKADRDESSPYAAMLAAQDVAAKCLEVGITAVHVKIRATGGTRTKTPGPGGQAALR
FT                   ALARSGLRIGRIEDVTPVPSDSTRKKGGRRGRRL"
FT   CDS_pept        complement(75466..78096)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000057137" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17443376"
FT                   /locus_tag="CAGL0K00693g"
FT                   /product="Similar to uniprot|P32944 Saccharomyces
FT                   cerevisiae YJL187c"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="CAG61215.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG058963"
FT                   /db_xref="HOGENOM:HBG202261"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI00003B6BA9"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNE0"
FT                   /transl_table=1
FT                   /translation="MENSEFGKGLGIYYDFDQRSDGMVPDDPPQNNDDASSMDDEEMNS
FT                   YNSPNGSNRLKFYPYSNNSMTRSVATLNLSISNSHNQVEETLPSKNNRIRQGLDFGIPS
FT                   SNTRLQLPAITKTTVDYSKTENKNFNMETCLNDWSPFNYNGSSSSNSSKSELSPFVNNP
FT                   ETLKKWSWMPKQNKKHGKPLDKANIIITQTPRNTSKNHPDFEIAKPDPSAFETSGLKPK
FT                   SLLNTAQKLAVPNTPVKKSPFIDTGNTFSSASRVADSSILEFSTLNYRNSTTGHTSFLF
FT                   SPSLNKTPVHDKFYNSTGILDDSPLQLSKGQKSNNKDFKQNNVRPLHSESNTPDSTHKG
FT                   SYKKIKKSRDSVILKNIELSNSLLQFTNDLYDEEENRNNNKENHPTIFESEADDECVPP
FT                   AGKADDHRRDKNCGLSLHISSPKYNSQISTKSNVNHLITVESSYDVKSLLTPTRTKSIA
FT                   GAKMTDKLANPYLNEELSSFDGLSPLSSKKKIHNQENPDMHLSKKFEDISIIGQGPFST
FT                   VYYVVDPETNKKFAIKSMQINKKNPIKRILQEINLLTEFQSTNLDEEGKEYIIDYITSW
FT                   KYGDSYYIMTDFYENGSLDKFLQEQVVSKKTKLEDWRIWKIMVEICLGLRFIHDSCQVV
FT                   HLDLKPANIFITFEGNLKIGDFGMATHLPLTDKSFENEGDREYIAPEIITDSVYDFKAD
FT                   IFSLGLIMVEIAANVILPDNGNAWHKLRSGDLSDAGRLSSTDIHSESLFSSVTKVEKGN
FT                   SGLLDYNREVLSQIDSNAFEGNSNPVLDLPHSSTTKVSNKLNSNINAEKQHSRDSIPAW
FT                   VPKFLIDGESLDNIVKWMIEPNYKRRPSADEILHTEECLYVEMTRKAGAIVQEDDYGPR
FT                   PEFFQ"
FT   CDS_pept        80166..81185
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000179260" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17443377"
FT                   /locus_tag="CAGL0K00715g"
FT                   /product="Similar to uniprot|P53047 Saccharomyces
FT                   cerevisiae YGR213c RTA1"
FT                   /biological_process="response to stress"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAG61216.1"
FT                   /db_xref="GO:0006950"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG123771"
FT                   /db_xref="HOGENOM:HBG447992"
FT                   /db_xref="InterPro:IPR007568"
FT                   /db_xref="UniParc:UPI00003B6BAA"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FND9"
FT                   /transl_table=1
FT                   /translation="MSTNSTINLSDDFKFDFYKYTPNLGASIAFAVLFLIAAIIITGQL
FT                   WILTKSHRQFLTQWMNSPTYYANIRHYNTFKLFAAHIPLIVGCIIEVVGYIARSVSRHD
FT                   VYSLPPFAVQVVLLLVGPTLYAASIYMVFGRMAHLMFVENLMIMPARFNTVIFVLGDVA
FT                   SLLLQAAGGGMQASASTEKAGSNIVTVGLFIQIAFFGIFMINEFLFVIRVRALRNKNKI
FT                   ASKSNTWIYYNWILIVNSAMILVRSIVRTVEFIQGYDGYITSHEYFLYIFDATPMFLLP
FT                   LITIVFMMKYNIFEIQRESIQIQSELDKDYESEDNDSSLDIEADIEDGSENRMSKTEF"
FT   CDS_pept        complement(81263..82636)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000142333" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18502532"
FT                   /locus_tag="CAGL0K00737g"
FT                   /product="Similar to uniprot|P53304 Saccharomyces
FT                   cerevisiae YGR212w"
FT                   /function="alcohol O-acetyltransferase activity "
FT                   /biological_process="alcohol metabolic process "
FT                   /protein_id="CAG61217.1"
FT                   /db_xref="GO:0004026"
FT                   /db_xref="GO:0006066"
FT                   /db_xref="HOGENOM:HBG058521"
FT                   /db_xref="HOGENOM:HBG204426"
FT                   /db_xref="InterPro:IPR010828"
FT                   /db_xref="UniParc:UPI00003B6BAB"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FND8"
FT                   /transl_table=1
FT                   /translation="MVRHLGGIEQYFYQRSSLNLHSCFSVGVELNSLPNRSDFICALRR
FT                   VVNSHFQLYCNAYKSNNEVVVNPIGEPIKFDDVVDYMDWDTYGEEEINSVFRKYNFEYG
FT                   VDKPLWKVIVVPKANKMIFATDHLFFDGIATVLFWTELLKSLEELKQDNDLDVDEIIYR
FT                   PGGSTDSIDQCHPYEKLPIPFSWKVKRPIVKALFTIAPGAVVSQDASIIQFDEYKIPED
FT                   YLKKNSNDDGCYQIKNTNRQISLKMSSNKLKVIMKDCKQHHVSFTAYLTAVLYLALGKI
FT                   PKEKYSGSTIKYEVPMNTRNRISNSGEYSNSYGTFVAGGEFIETLDFERDEWELAQSIH
FT                   KKIVEKSTTGVMDAINEARLLELVDAKKFMKMKFETTTGPSSTFEVTNLGFQNFSQNEH
FT                   SKYTVTDAFFNEPQLFTNLITYSVISTPSGGLNCSMAYPEKLDSILCNSVAFLKNKFN"
FT   CDS_pept        complement(83056..84495)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000216492" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18502533"
FT                   /locus_tag="CAGL0K00759g"
FT                   /product="Similar to uniprot|P53303 Saccharomyces
FT                   cerevisiae YGR211w Zinc-finger protein "
FT                   /function="zinc ion binding"
FT                   /protein_id="CAG61218.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG046136"
FT                   /db_xref="HOGENOM:HBG716460"
FT                   /db_xref="InterPro:IPR004457"
FT                   /db_xref="UniParc:UPI00003B6BAC"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FND7"
FT                   /transl_table=1
FT                   /translation="MSEDKLFKPVGEAANEVQEENDNGVSLTGASDAMGHPVQEIESLC
FT                   MNCEKNGVTRLLLTSIPYFREVVLMSFECPHCGFKNSEIQPASQIQEKGSKYQLKVESK
FT                   EDFNRQVVKSETATCKFVELDVEIPAKRGQLTTVEGLLSEMIEDIEQDQEMRKSIDENL
FT                   YNQIAEFIKKVRSYINCEPGTLPLTFILDDPSGNSWIEYKPGEPQHKWSHVQYVRSDEQ
FT                   NVVVGILTEDQYEQRRRAKLEELSNKGRNPSESVKVGSANAEFLSDATDIENFNNEVQT
FT                   FRASCPSCTQECETHMKPVNIPHFKEVIIMSTTCEHCGYKSNEVKTGGSIPEKGRKITL
FT                   LCDDPADLSRDILKSETCSLHIPELHLDIQEGTLGGRFTTLEGLLKQVYEELESRVFTQ
FT                   TSDSMDEATKQRWVDFFAKLKEALDGKVHFTVIMEDPLAGSYIQNVYAPDPDPNMKIED
FT                   YERTQQQNEDLGLNDMKTDAN"
FT   CDS_pept        84829..86055
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000087627" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17443378"
FT                   /locus_tag="CAGL0K00781g"
FT                   /product="Similar to uniprot|P42942 Saccharomyces
FT                   cerevisiae YGR210c"
FT                   /function="GTP binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAG61219.1"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="HOGENOM:HBG489518"
FT                   /db_xref="HOGENOM:HBG586249"
FT                   /db_xref="InterPro:IPR002917"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR013646"
FT                   /db_xref="UniParc:UPI00003B6BAD"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FND6"
FT                   /transl_table=1
FT                   /translation="MPRDPLIGIVGKPSSGKSTTLNSLTDASAAVGSFPFTTIEPNKAT
FT                   GYLQVDCACSRFGKEELCKPNYGWCEKGKRHIPIMLLDVAGLVPGAHSGRGLGNKFLDD
FT                   LRHADALIHVVDVSGTTDAEGKNCRGYDPLNDIEWLQDEIRLWIENNLKKRWGSIVRRH
FT                   TATKSSVVDTLQAQFGGYGSLIPMVQRCLDRLEGLPPLEKWDDEWITKVVKSFMMEKFP
FT                   TVLALNKIDHPDADKNVSKIMLKYPETKAVLTSAITEVFLRKLKKQGFIQYDSGTEFVD
FT                   TCEDDPSLKPLDEKSLARIENIRDLVLYRFGSTGVVQVLQAATDVLDLIPVYTVKNMTT
FT                   FTGGNGTNVFRDCFLVKRGTPVGKVARYILGDVTVAAIETVGSVRVSEETPVLPGKNDI
FT                   LTFKIAPRS"
FT   CDS_pept        86725..87036
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000292977" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17443379"
FT                   /locus_tag="CAGL0K00803g"
FT                   /product="Strain CBS138 chromosome K complete sequence "
FT                   /function="electron carrier activity"
FT                   /function="protein disulfide oxidoreductase activity "
FT                   /biological_process="cell redox homeostasis"
FT                   /biological_process="glycerol ether metabolic process "
FT                   /protein_id="CAG61220.1"
FT                   /db_xref="GO:0006662"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0015035"
FT                   /db_xref="GO:0045454"
FT                   /db_xref="HOGENOM:HBG491141"
FT                   /db_xref="HOGENOM:HBG493509"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017936"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="UniParc:UPI00003B6BAE"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FND5"
FT                   /transl_table=1
FT                   /translation="MVKQITSVSEFDSAIAVDKLVVVDFFATWCGPCKMIAPMIEKFAA
FT                   EYSTADFYKLDVDELPEVAQKNEVSAMPTLVLFKNGKEVAKVVGANPAAIKQAIANNV"
FT   CDS_pept        complement(87331..88218)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000231114" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17443380"
FT                   /locus_tag="CAGL0K00825g"
FT                   /product="Similar to uniprot|P42941 Saccharomyces
FT                   cerevisiae YGR208w Phosphoserine phosphatase "
FT                   /function="phosphoserine phosphatase activity"
FT                   /biological_process="L-serine biosynthetic process "
FT                   /protein_id="CAG61221.1"
FT                   /db_xref="GO:0004647"
FT                   /db_xref="GO:0006564"
FT                   /db_xref="HOGENOM:HBG437117"
FT                   /db_xref="HOGENOM:HBG645339"
FT                   /db_xref="InterPro:IPR004469"
FT                   /db_xref="InterPro:IPR005834"
FT                   /db_xref="InterPro:IPR006383"
FT                   /db_xref="InterPro:IPR023190"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniParc:UPI00003B6BAF"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FND4"
FT                   /transl_table=1
FT                   /translation="MSFVVTVIAHGDALRSEKELVDRVVGALDAELIKTETLSKRAVDI
FT                   FVKAPGEVLQLKQKLDQLDVDGADLAVQVVDEQLQRRPLKLCVFDMDSTLIYQEVIELI
FT                   AAYAGVEPQVHEITERAMNNEIDFKQSLRERVRLLKGLKIDNLYEEIKQKLQITEGVPQ
FT                   LCSTLKQHGIKLAVLSGGFIQFASYIKDQLSLDYARANLLEMDDSGVLTGEVIGEIVDG
FT                   QCKAETIKQLCKDWSIDLENVCMIGDGGNDLPSMHVSGYGIAWNAKPTVQKQAPSKLNT
FT                   KSLADALYIFGIIE"
FT   CDS_pept        88542..89321
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000247877" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17443381"
FT                   /locus_tag="CAGL0K00847g"
FT                   /product="Strain CBS138 chromosome K complete sequence "
FT                   /function="electron carrier activity"
FT                   /protein_id="CAG61222.1"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="HOGENOM:HBG007870"
FT                   /db_xref="HOGENOM:HBG716515"
FT                   /db_xref="InterPro:IPR000049"
FT                   /db_xref="InterPro:IPR012255"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="UniParc:UPI00003B6BB0"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FND3"
FT                   /transl_table=1
FT                   /translation="MSKPLRILVPVKRVVDFQIKPRVNKTLTGIEKSGIKFSINPFDDI
FT                   AVEETVRIKEKHGDLVEHTQAVSIGPAKAQDILRNCLAKGIDNVSLIDCKDLELEPLAV
FT                   AKVLKNIVEKQNINLIIMGKQAIDDDFNHTGQMLAGLLNWPQATNAAKVDILADEGKVR
FT                   ITREIDGGEETLKASLPLIITTDLRLNTPRYVGLPNLMKAKKKPMEKLTLEKDFADIDT
FT                   KPRLEILSVNEPNAKEPGITVGSVDELVQKLKDSKVL"
FT   CDS_pept        complement(89436..89774)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000939" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20197142"
FT                   /locus_tag="CAGL0K00869g"
FT                   /product="Similar to uniprot|P42939 Saccharomyces
FT                   cerevisiae YGR206w"
FT                   /protein_id="CAG61223.1"
FT                   /db_xref="HOGENOM:HBG123795"
FT                   /db_xref="HOGENOM:HBG204425"
FT                   /db_xref="InterPro:IPR019014"
FT                   /db_xref="UniParc:UPI00003B6BB1"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FND2"
FT                   /transl_table=1
FT                   /translation="MSDNQLKNIDDILNNIPLRNKFGDNYPRERLSKVEVPLYKIENIA
FT                   DSKKMFEPWYKECDEIIAACEVHDQLGRNFEQWYNEKYISTKPPGMVQGNGEISVLSPS
FT                   KKHGEMLK"
FT   CDS_pept        complement(90112..91011)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000170906" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17443382"
FT                   /locus_tag="CAGL0K00891g"
FT                   /product="Similar to uniprot|P42938 Saccharomyces
FT                   cerevisiae YGR205w"
FT                   /protein_id="CAG61224.1"
FT                   /db_xref="HOGENOM:HBG058525"
FT                   /db_xref="HOGENOM:HBG559891"
FT                   /db_xref="UniParc:UPI00003B6BB2"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FND1"
FT                   /transl_table=1
FT                   /translation="MADKLNSLEHCMKFVDEYVPAWFETGKRDPLFIFISGPQGSGKSY
FT                   VGKRIYEHLKDYYKDQKSVAYASMDDFYLTHEAQQKLNKEYPNNKLLQGRGLPGTHDMA
FT                   LLYKCINAILQRHGNDNDSIDGDHLQDSSKLVLPKYDKSAFNGEGDRSTVTVSEKIPVD
FT                   IFILEGWFLGFEPILQNFESEETVKGDMVDVNSKLFIYSDLLWDNPEIKSLGIVFAADQ
FT                   LENVYDWRLQQEKELIAKTGNGMNDEELKKFVDRYMPCYDLYYNHLIHTESLGSVATLT
FT                   LGLDKERKVFSFKTRYIE"
FT   CDS_pept        complement(91347..94187)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000040280" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18502534"
FT                   /locus_tag="CAGL0K00913g"
FT                   /product="Strain CBS138 chromosome K complete sequence "
FT                   /function="ATP binding"
FT                   /function="formate-tetrahydrofolate ligase activity "
FT                   /function="methenyltetrahydrofolate cyclohydrolase activity"
FT                   /function="methylenetetrahydrofolate dehydrogenase (NADP+)
FT                   activity"
FT                   /biological_process="folic acid-containing compound
FT                   biosynthetic process"
FT                   /biological_process="one-carbon metabolic process "
FT                   /protein_id="CAG61225.1"
FT                   /db_xref="GO:0004329"
FT                   /db_xref="GO:0004477"
FT                   /db_xref="GO:0004488"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006730"
FT                   /db_xref="GO:0009396"
FT                   /db_xref="HOGENOM:HBG181856"
FT                   /db_xref="HOGENOM:HBG677721"
FT                   /db_xref="InterPro:IPR000559"
FT                   /db_xref="InterPro:IPR000672"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR020628"
FT                   /db_xref="InterPro:IPR020630"
FT                   /db_xref="InterPro:IPR020631"
FT                   /db_xref="InterPro:IPR020867"
FT                   /db_xref="UniParc:UPI00003B6BB3"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FND0"
FT                   /transl_table=1
FT                   /translation="MAELIDGKACAQGIRASIKEEIEAIKQQNPSFVPTLTIVQVGDRP
FT                   DSATYVRMKRKAAEEAGIRADFLHLAEDVSENELYEEVTKLNENPDIHGVIVQLPLPGH
FT                   INEDKITSAVVAEKDVDGFGPINIGELNKKNGKPFFLPCTPKGIIELLKQAGVQIAGSK
FT                   SVVIGRSDIVGSPVAELLKSLDSTVTITHSKTPDIPSYLNDADIVVVAIGKPEFVKGEW
FT                   FANNKKGAVVIDVGTNYVDDSTKKSGYRCCGDVEFKEACKYVRKITPVPGGVGPMTVAM
FT                   LMQNTLIAAKRQLETGGKLSEFEPLPLQLKRPVPSDFEISRAQKPKQITKVALEAGILP
FT                   SELEPYGSTKAKVSLNILDRLKDRENGKYILVTGITPTPLGEGKSTTTVGLTQALGAHL
FT                   NKTVFANVRQPSMGPTFGIKGGAAGGGYSQVIPMDEFNLHVTGDIHAISMANNLLAAAI
FT                   DTRMFHESTQKDGPLYKRLVPAKKGERKFTPTMLRRLKKLGIDKTNPDDLTDEEITRFA
FT                   RLDIDPETITWRRVVDCNDRFLRGITVGEAPTEKGFTRKTGFDISVASECMAILALCNS
FT                   LSDMRERLGKIVVAASKSGEPITCEDIGCAGAMTALLKDAVKPNIMQTLEGTPVFVHAG
FT                   PFANISIGANSVLADKIALKLAGVDPKLPEEKKKEQVGYVVTEAGFDFTMGGERFLNIK
FT                   CRSSGLVPDVVVIVATVRALKVHGGGPEVKAGAPLPSEYLNEDVELLRKGCANLAKHIE
FT                   NAKQYNLPVVVAINKMSSDTDKEHEVIREESLKAGAYDAIVSDHWAEGGAGAVDLAKGI
FT                   IKAADETDNSKFSFLYESQGKVEDKIQKIANAMYGAKDVEFLPEAQKKIDLYTKQGFGD
FT                   LPICIAKTQYSLSHDANLKGVPKDFTFPIRDIRASIGAGYLYALAAEIQTIPGLPTHCG
FT                   FMNIEVNEDGEIEGMF"
FT   CDS_pept        complement(94846..95286)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000162894" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17443383"
FT                   /locus_tag="CAGL0K00935g"
FT                   /product="Similar to uniprot|P42937 Saccharomyces
FT                   cerevisiae YGR203w"
FT                   /protein_id="CAG61226.1"
FT                   /db_xref="HOGENOM:HBG144738"
FT                   /db_xref="HOGENOM:HBG587364"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="UniParc:UPI00003B6BB4"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNC9"
FT                   /transl_table=1
FT                   /translation="MSRSIANIQYLEAKNLAHWMKSADAPLFQVIDVRGSDYVGGHIKG
FT                   CWNYPYRRLKVDDGYMEEMYKALNKKLEDTGSDRSLNAIFHCAQSQQRGPAAAMKLLRF
FT                   LPDDKLSNFKIWVLRGGFNHWQDQYGEDQELTEDYEPDIWSW"
FT   CDS_pept        95657..98038
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000200623" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19350340"
FT                   /locus_tag="CAGL0K00957g"
FT                   /product="Strain CBS138 chromosome K complete sequence "
FT                   /protein_id="CAG61227.1"
FT                   /db_xref="HOGENOM:HBG118786"
FT                   /db_xref="HOGENOM:HBG327889"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="UniParc:UPI00003B6BB5"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNC8"
FT                   /transl_table=1
FT                   /translation="MVTVNSEAIFIGANKQTQVCSYNKARNVLAFGAGKNIALWNPLDA
FT                   DCRGIYATLKGHEAEVTCVKFMPGTDILVSASEDHHVKLWKYKAPESEELECIQTITHY
FT                   SHTIVSIETLAGLIVIGSAGGLVSIWVPETEGSDTYIISHEYSLPRNVFPLCFSLSNVV
FT                   GNKYLLAIGGTTVKIFIYSFVLSEGKVIENFNLAAELEGHEDWVKSIQFRHQETPGDYL
FT                   LCSGSQDRYIRIWRIRTNDLIDDSEDDETKLTLLSSKQHKFHISEDLRIGINFEALIIG
FT                   HDDWVSSLQWHESKLQLLASTADTAVMIWEPDESSGVWVCSSRLGEMSSKGASTATGSS
FT                   GGFWSCLWFEENGADYILTNGKTGSWRIWEAKDEIMCEQRVGITGAVRPVTDVAWAPCG
FT                   KYLLSTSLDQTTRLFAPWIYNENNELRSRKTWHEFSRPQIHGYDMICVEPVNDERFISG
FT                   GDEKILRSFDLPKGVAHLLKKFVGLRFTNEEEERPEAASVPVLGLSNKAVEENESNDTD
FT                   DPDVRESNDNKNISYDLVTSANTPPMEETLQRHLLWPEVEKLYGHGYEITSVDVSPDQK
FT                   LVVSACRSNNAQHAVIRIFDLDTWLEVKPNLSFHSLTITRLRFSPDSKYLLSVCRDRKW
FT                   AVWERNFDDNTFTLKYTDEKPHSRIIWDGEWAPLEFGNVFLTTSRDRKVKVWSLETSES
FT                   NAFSMLHFIKLNSPITAISIYNKVINNKLIVAVGLETGEIFIYNYSKSDGFELISQFEQ
FT                   YITPSDRIERLRWSNWVDNDKLLLASASLDQSCRIYSILI"
FT   CDS_pept        complement(98135..100327)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000157526" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20197143"
FT                   /locus_tag="CAGL0K00979g"
FT                   /product="Strain CBS138 chromosome K complete sequence "
FT                   /function="mannosyltransferase activity"
FT                   /biological_process="protein O-linked glycosylation "
FT                   /cellular_component="membrane"
FT                   /protein_id="CAG61228.1"
FT                   /db_xref="GO:0000030"
FT                   /db_xref="GO:0006493"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG026546"
FT                   /db_xref="HOGENOM:HBG332413"
FT                   /db_xref="InterPro:IPR003342"
FT                   /db_xref="InterPro:IPR003608"
FT                   /db_xref="InterPro:IPR016093"
FT                   /db_xref="UniParc:UPI00003B6BB6"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNC7"
FT                   /transl_table=1
FT                   /translation="MVEDKLADEKTTETKENTPDQTKVVPRACNFAKYRDLIACLGFTV
FT                   LSFVLRFQGIDKNNSVVWDEAHFGKFGSYYIRHEFYHDVHPPLGKMLIALSEWLAGFDG
FT                   EFDFESGHQYPDGVNFKFMRQFNATFGALCTPVVFFTAKTMNLSWPIVYLVTLMVTLEH
FT                   SFIALSKFILLDSMLLFFTATTFACMVKLIQLRGCQLTRQWLWWLLLTGLSIGCVCSVK
FT                   WVGLFITLVVGLFTIIDLLEHYWNKKESRKIYYKHWILRIINLIIIPFLVYLFCFKIHF
FT                   LLLYKSGTGDASTNSLFQVNLEGTQIQNSPRTVMYGSEVTIRSHGLSPNLLHSHVQLYP
FT                   DGSRQRQVTGYGHSDGNNNWMIKFGRTTGRYLDEDNKRLNGELVPVRDGDTIRLFHVRM
FT                   GCNLHSHTISSHVSKGNYEVSGYGSEEVGDEKDDWIIEIMEQLDSANTNFGKEDNEVLH
FT                   PISTMFRLRHKDLGCYLASTGLSYPTWGFHQAEIVCKYSWGKRDKSTWWNVEDHWNDQL
FT                   VVDEEYVPPKSKFWTDFILINFAMASSNNALVPDEDKYDYLASKAWEWPILHKGLRLCG
FT                   WSSAGVRYYLLGSPFNTWLSSIALLVNILLGMVVAIKWRRQSIVINEESCWKLFTLLLF
FT                   PFLAWLANFMPYVMMGRVTYVHHYMPALYFAIIAFGSITEYLLADYCTVKAFLAFLSMV
FT                   GCTYIYWYFAPICQGLHGIGSHYFYLQWLPGWDIAV"
FT   CDS_pept        complement(100751..103117)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000155656" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21045931"
FT                   /gene_name="YPP1"
FT                   /locus_tag="CAGL0K01001g"
FT                   /product="Cargo-transport protein YPP1 "
FT                   /function="binding"
FT                   /biological_process="endocytosis"
FT                   /cellular_component="plasma membrane"
FT                   /protein_id="CAG61229.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0005886"
FT                   /db_xref="GO:0006897"
FT                   /db_xref="HOGENOM:HBG058529"
FT                   /db_xref="HOGENOM:HBG204422"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniParc:UPI00003B6BB7"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FNC6"
FT                   /transl_table=1
FT                   /translation="MFIRDAVLQALEARLLGASEFHSTCNALDRALVVQFRLQYHTGGD
FT                   SVITPATGKVLFGDIDKVEMLSRRFPLDKPLLDLINKILGNCAGIIHFSIGEFEDAKVR
FT                   LQQARDIKLDKTFDVYDMYLGLENLYYTACLRQDEQQISDCLYDHLFDTLSFVPSASEA
FT                   LTHQCLWKIAKRLKGHNNLANLIKIWPENNRALVFLISIIASDNGAYTEFSKDNDEMIL
FT                   KYGMNLVEKIKFPKASENNNYHLEQFMLFLQVYFKNIVPDQAASTEWYNFILKAMSKTF
FT                   QSINVAHTALFVMKKIGSDNEKGKINGTLLRKEALLNFVNFIRYSNKEFKLNKNYNDII
FT                   SLLVCYNFVINEFTKKDNIDNLFDYDKSLDELLSLLVFFYKEYNIPLSEKKQSLDILEN
FT                   PIRLAFPPHVANTLSRSWLTLYNYHSTSLSALLSFDLLAFLANCVPISRSMDEGLFIST
FT                   VFQYALTLAKQRDVETAIKVLEKLILERHPNCYKAWHLMALCHSTKENKETAYKIVCSV
FT                   LEAMNENMKDLTFEEKFQYIYMKITQLRLIQDMFGTDETLELIPELFELYNTLFLGGAN
FT                   QKKVTINGVYDLDMTLQDIWLYVCSLYMKTPSTDNLQEAETAMDEAMALEKDHWKGRYL
FT                   PLRAKLNILKQQNKQALLDIEKAIDLDNSNIDAILCFAELIFDVEKKSEEDLTDEYYKL
FT                   VPIEGIKECSKNQSENEDRLFFNATDRSAATARLKLLLDSAVAESIEGYYTPEVWWSLS
FT                   QIHEQFATKDYKLSLMKCIKFEELRPIAQFENCNY"
FT   CDS_pept        103486..104451
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000065989" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20197144"
FT                   /locus_tag="CAGL0K01023g"
FT                   /product="Similar to uniprot|P12686 Saccharomyces
FT                   cerevisiae YGR084c MRP13"
FT                   /protein_id="CAG61230.1"
FT                   /db_xref="HOGENOM:HBG123817"
FT                   /db_xref="HOGENOM:HBG204366"
FT                   /db_xref="UniParc:UPI00003B6BB8"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNC5"
FT                   /transl_table=1
FT                   /translation="MLKNCSRFYSAVAKSNKQLLDEFYQYHTTRMNLRPLIYRPKNATL
FT                   LRSMDLKDPETNKPIQPREPMKPLKKQVLNNYVQEIPQGSKELMDFLQKWFKVSNRKRE
FT                   LFAFLEGSHLQVMLAASLFRIGHYSHVLGLLHSYQSKVVGTGNTKAYDQDRFFNTVLMC
FT                   SLLRNDLKDLKDAEIGLKKLKVNWGKVTEKNDTLGLTQPLLEAYANQQGISKEDLVLKG
FT                   RETISNINLPSIGDESRFSRLVTFITENKYTYFLARTIQKFSESCPSEIETFINEYKNA
FT                   LTTLKKDDEYDWSVQNMTEVNKIPEETKQERETQEETQEQ"
FT   CDS_pept        104993..106897
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000176924" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19350341"
FT                   /locus_tag="CAGL0K01045g"
FT                   /product="Strain CBS138 chromosome K complete sequence "
FT                   /biological_process="cellular metabolic process "
FT                   /protein_id="CAG61231.1"
FT                   /db_xref="GO:0044237"
FT                   /db_xref="HOGENOM:HBG455568"
FT                   /db_xref="HOGENOM:HBG589457"
FT                   /db_xref="InterPro:IPR000649"
FT                   /db_xref="UniParc:UPI00003B6BB9"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNC4"
FT                   /transl_table=1
FT                   /translation="MSENSSADQVKPENVNASPKTAQGSDAGTAPAATAVGERQLSNKE
FT                   LKELKKKEKAAKRAAQKQANGISIEQQKQQAEAKKQKKQQQREKQQKEQQKKQKKSDPS
FT                   AKPKRSVKKTTLFGHLETTEERRATILAITSAISSPKASRITAAGLMVPAVASSLAIAN
FT                   EESAEGSAGSLSTVQQPQSAATTTTSGTSEQNAIDLAKSLANISLDYEKNSVVPGISSV
FT                   IPEAMEQTLEGPSILASVKELLLNKDMLHPAISLLTSNLASYKIVGSIPRCIAMLEAFQ
FT                   IVINDYETPEGTTLSRNLTSYLSHQIDILKKARPLSVTMGNAIRWLKQEISLIDPSTPD
FT                   QEAKKDLCEKIGQFAREKIELADQLIIDNASNHIENSTRIVTYGSSKVLTELLLHNAVT
FT                   LEKNIEVIVVDSRPLFEGRKMAKLLRSKGVNVRYCLITSLDTAFNMDVDYVFLGAHSIL
FT                   SNGFLYSRAGTAMIAMSAKRRNIPVLVCCESLKFSQRVQLDSVTYNELADPNDLVPIDY
FT                   DNPVERRSNQGTLLKQFVKERNAEKARLELEQKNKGAKQKQQSGGASKGQNSGKPEQLS
FT                   EQSSNDKDVLHNWQDLQSLNIVNILYDLTPPEYIKKVITEFGALPPSSVPVILREYKA"
FT   CDS_pept        complement(107542..108096)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000216577" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21045932"
FT                   /locus_tag="CAGL0K01067g"
FT                   /product="Strain CBS138 chromosome K complete sequence "
FT                   /biological_process="protein targeting"
FT                   /cellular_component="mitochondrial outer membrane
FT                   translocase complex"
FT                   /protein_id="CAG61232.1"
FT                   /db_xref="GO:0005742"
FT                   /db_xref="GO:0006605"
FT                   /db_xref="HOGENOM:HBG059002"
FT                   /db_xref="HOGENOM:HBG333608"
FT                   /db_xref="InterPro:IPR002056"
FT                   /db_xref="UniParc:UPI00003B6BBA"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNC3"
FT                   /transl_table=1
FT                   /translation="MAQSLGRTLAAATAVGAVALSAYALYFDHQRRSNPEFRKELKRRV
FT                   KKEAKAAQVAEEQAKRQKLEKVTQYLTQELAADPIPASATERETVFTKNVELGERLSMT
FT                   PGQELEAAAKFYKALTVYPNPADLLGIYQRSVPENIYEYIVLMIAIMPPANVSTFIRGA
FT                   AAGNDNAAAKEVEESVADVDE"
FT   CDS_pept        108352..108984
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000065990" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17443384"
FT                   /gene_name="SLX9"
FT                   /locus_tag="CAGL0K01089g"
FT                   /product="Ribosome biogenesis protein SLX9 "
FT                   /biological_process="rRNA processing"
FT                   /cellular_component="nucleolus"
FT                   /protein_id="CAG61233.1"
FT                   /db_xref="GO:0005730"
FT                   /db_xref="GO:0006364"
FT                   /db_xref="HOGENOM:HBG058995"
FT                   /db_xref="HOGENOM:HBG448444"
FT                   /db_xref="UniParc:UPI00003B6BBB"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FNC2"
FT                   /transl_table=1
FT                   /translation="MVAKKRTKLRDKVSRLNAKESAVEEEVPYTSVLGEDPKAFLHQSK
FT                   ETKKEKQSLKHSSFLDRLREKSSANDFSGISKSAARRRKRKLRDDLKPKMQDLLTSLEN
FT                   DVEVESESGEEEYHDTVEDNHDPEIMEDAIPQRKVTRLVSSKKLKKHEKPSGSIVIKKN
FT                   APNIRNQRGAKQLSKQESERFNKVLTNQTFQQNPFGSLRDIIKMQKY"
FT   tRNA            109314..109387
FT                   /gene_name="tRNA-Val (AAC)"
FT   CDS_pept        complement(109615..110598)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248425" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17443385"
FT                   /locus_tag="CAGL0K01133g"
FT                   /product="Strain CBS138 chromosome K complete sequence "
FT                   /function="actin binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAG61234.1"
FT                   /db_xref="GO:0003779"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="HOGENOM:HBG058218"
FT                   /db_xref="HOGENOM:HBG396537"
FT                   /db_xref="InterPro:IPR002108"
FT                   /db_xref="UniParc:UPI00003B6BBC"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNC1"
FT                   /transl_table=1
FT                   /translation="MSNQSGILANQALLDELNKDLANAGVVTARISSDSTAVELDRTYA
FT                   TVEDCVKALSDEPLYIFYHAPATAEYQFISYVPDTSAVRSKMLYASTKNTLVRQIGTNS
FT                   IGKQLLITEASELADFANNLANDNGTDNDALTESERSAREIDATQKREFYSTYNSISGR
FT                   QLVSQTGGGPNVLQFDVKMSDNVKQLLKETNVVAFKIDLSNEDISVLNKENISNPEDLK
FT                   LSSEHPTYTLYRNNELYYFIYSCPSGSKVKERMLYASNKSGFIKHLNEKEGIEFSNVIE
FT                   IGDADELELSLISSGTTQQLQSEASKSDSNSTRKFNRPRGPGGRKR"
FT   CDS_pept        complement(111197..111808)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17443386"
FT                   /locus_tag="CAGL0K01155g"
FT                   /product="Similarities with uniprot|P53249 Saccharomyces
FT                   cerevisiae YGR079w"
FT                   /protein_id="CAG61235.1"
FT                   /db_xref="HOGENOM:HBG123832"
FT                   /db_xref="UniParc:UPI00003B6BBD"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNC0"
FT                   /transl_table=1
FT                   /translation="MSKQFKLGVITAQDISPLCKNKLPHPTVMANESLVSQVDELPEEF
FT                   HLDYTPHHEYNEYVDLGDLPVDSSISDFWNEVKSTHAEAPVTSSVTSVADTDDELRQLS
FT                   QSLSEGHEHAHAHAHAHAGSDTSLEDFLNHEDLDNDIVTPTQEVKLLCLRDSKGKFTLK
FT                   TTERSKKNKVKKNKKNKVLRRKSGVCAMISTGIGINEFML"
FT   CDS_pept        112575..113147
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000184744" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17443387"
FT                   /locus_tag="CAGL0K01177g"
FT                   /product="Similar to uniprot|P48363 Saccharomyces
FT                   cerevisiae YGR078c tubulin folding "
FT                   /function="unfolded protein binding"
FT                   /biological_process="protein folding"
FT                   /cellular_component="prefoldin complex"
FT                   /protein_id="CAG61236.1"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="GO:0016272"
FT                   /db_xref="GO:0051082"
FT                   /db_xref="HOGENOM:HBG021776"
FT                   /db_xref="HOGENOM:HBG631514"
FT                   /db_xref="InterPro:IPR004127"
FT                   /db_xref="InterPro:IPR009053"
FT                   /db_xref="InterPro:IPR016655"
FT                   /db_xref="UniParc:UPI00003B6BBE"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNB9"
FT                   /transl_table=1
FT                   /translation="MDTLFNSTEKNPRGIPSAPFLEDIGAFMAKEKEFELVFSKFQERL
FT                   SKYKFMLESKQATVRQLHVRIPDIENTLQVCRQLKQSKEDGEESALKFNYKLNETLFTK
FT                   AQVDLTKDLNVGLWLGADVMLEYPIDEAIALLEKKLEDSQDSLRIAKEDVEFLRENITT
FT                   MEVNCARLYNWDVELRKATKATEKLAI"
FT   CDS_pept        complement(113285..114196)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248804" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17443388"
FT                   /locus_tag="CAGL0K01199g"
FT                   /product="Similar to uniprot|Q08232 Saccharomyces
FT                   cerevisiae YOL073c"
FT                   /protein_id="CAG61237.1"
FT                   /db_xref="HOGENOM:HBG059142"
FT                   /db_xref="HOGENOM:HBG202967"
FT                   /db_xref="UniParc:UPI00003B6BBF"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNB8"
FT                   /transl_table=1
FT                   /translation="MSLETPVGLRRFPVTKLCMVTGIVVPVVAALTETKYVFKATYDPF
FT                   IKEYGQYYRYLTYQLSSVNETDVALIVLLFYQYRQLERLFGNEKYLSMLAMLIFYQGLA
FT                   TVSVHLLFNNLVGPWLGTQWNELASGAFGVVIGLFHFYKQYTPIVYEFDIVLGAPLWSQ
FT                   LFHKGVIRRFDNENKSMKVRLNDQFMVNVLVIILICNQGAWGPLQALVAWLSGLFLDIG
FT                   ILPGLDKWRVPFAHYMLFGEVKRLEVGSTSANTSASLGGNSVTQLANNSASSQLEEDNE
FT                   NDEPNDEPARPLGVQFLDAFRR"
FT   CDS_pept        114592..116427
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000142332" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19350342"
FT                   /locus_tag="CAGL0K01221g"
FT                   /product="Similar to uniprot|P53248 Saccharomyces
FT                   cerevisiae YGR077c Peroxisomal protein PAS6 "
FT                   /protein_id="CAG61238.1"
FT                   /db_xref="HOGENOM:HBG123838"
FT                   /db_xref="UniParc:UPI00003B6BC0"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNB7"
FT                   /transl_table=1
FT                   /translation="MVQADERTEVRYLLNLLRSSGHRSNKALHMSLIGNLVYYVPRLKD
FT                   PKLLAQLANALFDSTLWFQEDVDPSRLLDMAQGMFYWKLEISEPTLPIEEFYSIWNNIF
FT                   CENQGWSVYKLAILSGACSTLDRYTQLQSQYYIVESPRWIDGLYQNWKYNIFLRSWSQF
FT                   LSKSSDDSKKDVPRIEVLCLLYCPISRHHDVSRCHAQNVHFPLSFVIIALINLAIVYAI
FT                   DHPPEDEFLSRNINQVARTLQILLPQCDNPKEISMVLDELCVACFNISYKESSSDMPNK
FT                   DYSGVKYYSNTLLTFTLTFKGILDTKMKKPKTIFYQILTCMYYLNFIALDFGTIGFESY
FT                   EYTHNASIAGITSSGDQLTVYSNLLSTFNNNIWHTLKYPNKINDAKLLFLLDFLKRSIE
FT                   ITSLDFGSRMSTSDFINNTILPLKMQYLNSQDETIRDSMHSVMLAVFLNNSSGYELMAW
FT                   QRKSFLNYLSTAVEQYVIHNMLKPEQIIHIYQSMAFRMTILDKIKLEDEECTLVRETLN
FT                   YTYLQVKNAKFKEQKITLLKCLIYMIPYINHAYILVWLNNIMQLFDQELGVTTPDDQQL
FT                   LYNTLWEVIPLVKSTDAALIWWYSTIVPRIRHSKL"
FT   CDS_pept        116832..117296
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000189737" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18502535"
FT                   /locus_tag="CAGL0K01243g"
FT                   /product="Similar to uniprot|P23369 Saccharomyces
FT                   cerevisiae YGR076c MRPL25"
FT                   /protein_id="CAG61239.1"
FT                   /db_xref="HOGENOM:HBG059140"
FT                   /db_xref="HOGENOM:HBG398305"
FT                   /db_xref="UniParc:UPI00003B6BC1"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNB6"
FT                   /transl_table=1
FT                   /translation="MSSKQYFEQLPKKLKDFFYKYPPSVKYAVKPTSTHAMDANPFLAN
FT                   KHPVTGKYHGAKYSARRMSDIYKLAYRYGVQDLLPQTNKQFFEEKYNNKKFMRGILTPK
FT                   GHKHELNMEERMKRKAEGIANAEKILAEVKGSKYKRRMEKVQEKKRVGWV"
FT   CDS_pept        117543..118283
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000955" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17443389"
FT                   /locus_tag="CAGL0K01265g"
FT                   /product="Similar to uniprot|Q00723 Saccharomyces
FT                   cerevisiae YGR075c Pre-mRNA splicing factor "
FT                   /protein_id="CAG61240.1"
FT                   /db_xref="HOGENOM:HBG059138"
FT                   /db_xref="HOGENOM:HBG204363"
FT                   /db_xref="InterPro:IPR005037"
FT                   /db_xref="UniParc:UPI00003B6BC2"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNB5"
FT                   /transl_table=1
FT                   /translation="MSAEFQYESFISEKQLNNQSVSLVIPRITRDKIHNNIYYRCNLHP
FT                   VSMRGDTMLNLAPIIIRDLGKLRNPYQKPLNATLLLGGSEFKCLLMKLIEIRPTWEQIM
FT                   TLINEEMVEESFENKYIVALVLVYGRIQYYFLTFSDDYYDDAIKWRRLFKKYLNDYRKL
FT                   KALDLNVDCWSTSQMQNVELIHLDEIVDWLATKDDIWGIPLGKCQWANVYNDDIEDSSS
FT                   DSSSSSSDSSSGSESDSDSGPESV"
FT   CDS_pept        complement(118361..118816)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000182713" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17443390"
FT                   /locus_tag="CAGL0K01287g"
FT                   /product="Similar to uniprot|Q02260 Saccharomyces
FT                   cerevisiae YGR074w snRNA-associated protein "
FT                   /protein_id="CAG61241.1"
FT                   /db_xref="HOGENOM:HBG353275"
FT                   /db_xref="HOGENOM:HBG749684"
FT                   /db_xref="InterPro:IPR001163"
FT                   /db_xref="InterPro:IPR006649"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="UniParc:UPI00003B6BC3"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNB4"
FT                   /transl_table=1
FT                   /translation="MTLLVNFLKKLKNEQVTLELKNGTTVWGTLQSVSSQMNVTVTDVV
FT                   LSLPKSQSGKVSGGPGALASVYLVNNAQPDKANNDDGSVSLQYMNIRGNTIRQIILPDS
FT                   LNLDSLLVDEAQVKRLKKASAKPSETNYRKRRNEFSGNTAKRIKRGV"
FT   CDS_pept        complement(119076..120332)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17443391"
FT                   /locus_tag="CAGL0K01309g"
FT                   /product="Similar to uniprot|P48412 Saccharomyces
FT                   cerevisiae YGR072w UPF3"
FT                   /function="nucleotide binding"
FT                   /protein_id="CAG61242.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="HOGENOM:HBG123854"
FT                   /db_xref="InterPro:IPR005120"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniParc:UPI00003B6BC4"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNB3"
FT                   /transl_table=1
FT                   /translation="MADGSDRRRRRRKGAGAAGAAGSAGTGGNSDAGKKDTSKEASKAG
FT                   SSANGNANGNDNGGSNASAKSNSKGNAKGASKGKGKDRRRNKGKEDKKDDKKGVSKVKR
FT                   SGRKNEPGPKNSKTTKKKEAQRVQSALEQDYKKLVVRLLPPMLTETQFWSTVGAPTLEN
FT                   KQQYFDAHGIVEHYFHQGDAYAKFATMNARKKSYSRMYLIFKDIDHAKKYVLAIKDLTF
FT                   TDDHDNSNNPTFKISQYVKLFASGSTKQKSGSALEGTIDDDKIFKNFLKSMKYVREHQF
FT                   EEDVEGISMLRPIEKELALKRERKELAEKAAQHAIAKLTGVSESDKKKKKRKKKKKGAV
FT                   EETPKEKKKRKRNKKKKEKKKKASEGNEPKADSNNFVILEKAGKQVLKERLAKKGSMTA
FT                   LPALTPDKPKVPKILKRNI"
FT   CDS_pept        120540..121517
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000172696" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17443392"
FT                   /locus_tag="CAGL0K01331g"
FT                   /product="Strain CBS138 chromosome K complete sequence "
FT                   /function="hydrolase activity"
FT                   /protein_id="CAG61243.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG488218"
FT                   /db_xref="HOGENOM:HBG716770"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR006186"
FT                   /db_xref="UniParc:UPI00003B6BC5"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNB2"
FT                   /transl_table=1
FT                   /translation="MDTASNRRGPDEWLETVKKCQALTENEMKQLCEMVKELLMEESNI
FT                   QPVMTPVTVCGDIHGQFHDLLELFRTSGGFPDDDVNYIFLGDYVDRGYYSLETFTLLMC
FT                   LKVKYPAKITLVRGNHESRQITQVYGFYEECLNKYGSTTVWKYCCQVFDFLTLAAIIDG
FT                   KILCVHGGLSPEIRMLDQIRVLSRAQEVPHEGGFSDLLWSDPDNVEAWQVSPRGAGWLF
FT                   GSKVAREFNHVNGLNLIARAHQLVMEGFKYHFPEKDVVTVWSAPNYCYRCGNVASVMKV
FT                   DEDLEPTFKIFSAVPDDYINQDASSPTTNNGNSGSNSQRAGYFL"
FT   CDS_pept        121967..122524
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000163950" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18502536"
FT                   /gene_name="NPC2"
FT                   /locus_tag="CAGL0K01353g"
FT                   /product="Phosphatidylglycerol/phosphatidylinositol
FT                   transfer protein"
FT                   /biological_process="lipid transport"
FT                   /protein_id="CAG61244.1"
FT                   /db_xref="GO:0006869"
FT                   /db_xref="HOGENOM:HBG190307"
FT                   /db_xref="HOGENOM:HBG330747"
FT                   /db_xref="InterPro:IPR003172"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="UniParc:UPI00003B6BC6"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FNB1"
FT                   /transl_table=1
FT                   /translation="MQVKSLISSVALWGCAFTVANPIIGWGIGDVDKKAPMPPGFGETK
FT                   PIPGDSPLKMCDIAEGQLLEITKLDLVPNPPKRGSKLVIKASGEIFETIEEGAYVDVEV
FT                   RLGYIKLLTQTYDLCEILEDNDVDGLTCPIKKGKYDNLSKDVDIPQEVPPGKYLVTARA
FT                   YTNDDDLITCITGEVYFPPPGI"
FT   sig_peptide     121967..122026
FT                   /gene_name="NPC2"
FT                   /locus_tag="CAGL0K01353g"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FNB1 "
FT   pro_peptide     122027..122095
FT                   /gene_name="NPC2"
FT                   /locus_tag="CAGL0K01353g"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FNB1 "
FT   mat_peptide     122096..122521
FT                   /gene_name="NPC2"
FT                   /locus_tag="CAGL0K01353g"
FT                   /product="Phosphatidylglycerol/phosphatidylinositol
FT                   transfer protein"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FNB1 "
FT   CDS_pept        122991..123278
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000211589" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21045933"
FT                   /locus_tag="CAGL0K01375g"
FT                   /product="Similar to uniprot|O75012 Saccharomyces
FT                   cerevisiae YDL045wa MRP10"
FT                   /protein_id="CAG61245.1"
FT                   /db_xref="HOGENOM:HBG059133"
FT                   /db_xref="HOGENOM:HBG736580"
FT                   /db_xref="InterPro:IPR017264"
FT                   /db_xref="UniParc:UPI00003B6BC7"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNB0"
FT                   /transl_table=1
FT                   /translation="MSGKPPIHRLPPLPRLKVKKPIITQEANKCLVLMSNLLQCWSSNG
FT                   HMSTVCEGLAKELKLCTAERAMGKGTQTQKSNINYHAARLYPKINGNPHD"
FT   CDS_pept        complement(123633..124547)
FT                   /evidence="1: Evidence at protein level "
FT                   /gene_family="HOG000065966" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18502537"
FT                   /locus_tag="CAGL0K01397g"
FT                   /product="Similar to uniprot|P38913 Saccharomyces
FT                   cerevisiae YDL045c FAD synthetase "
FT                   /function="ATP binding"
FT                   /function="transferase activity"
FT                   /protein_id="CAG61246.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0016740"
FT                   /db_xref="HOGENOM:HBG059132"
FT                   /db_xref="HOGENOM:HBG203101"
FT                   /db_xref="InterPro:IPR002500"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="PDB:3FWK"
FT                   /db_xref="PDB:3G59"
FT                   /db_xref="PDB:3G5A"
FT                   /db_xref="PDB:3G6K"
FT                   /db_xref="UniParc:UPI00003B6BC8"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNA9"
FT                   /transl_table=1
FT                   /translation="MRLGDAAELCYNLTSSYLQIAAESDSIIAQTQRAINTTKSILINE
FT                   TFPKWSPLNGEISFSYNGGKDCQVLLLLYLSCLWEYYIVKLSQSQFDGKFHRFPLTKLP
FT                   TVFIDHDDTFKTLENFIEETSLRYSLSLYESDRDKCETMAEAFETFLQVFPETKAIVIG
FT                   IRHTDPFGEHLKPIQKTDANWPDFYRLQPLLHWNLANIWSFLLYSNEPICELYRYGFTS
FT                   LGNVEETLPNPHLRKDKNSTPLKLNFEWEIENRYKHNEVTKAEPIPIADEDLVKIENLH
FT                   EDYYPGWYLVDDKLERAGRIKKK"
FT   CDS_pept        complement(125052..126314)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18502538"
FT                   /locus_tag="CAGL0K01419g"
FT                   /product="Similar to uniprot|P10849 Saccharomyces
FT                   cerevisiae YDL044c"
FT                   /protein_id="CAG61247.1"
FT                   /db_xref="HOGENOM:HBG123868"
FT                   /db_xref="UniParc:UPI00003B6BC9"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNA8"
FT                   /transl_table=1
FT                   /translation="MLRRSSIVSVTRSGSRYFHSSIKLRKEEKSNISGNKEYEDQSTVD
FT                   AAATQIEQNLYNSVFERVKQKQNLRKKQASSSFILDHFFSGNEEKQNPHIIFGGESKAK
FT                   AKSDQNLVDYLTGRIDSESNLSSFKSTNLRKYPVSLTSTSLLDEDTASAQNVIKDLKDN
FT                   LKNVNTVSRLETPQNLKLVFNKKTLEEITIKEKFKGTLELLLKPYMDNLIEAINDDHDL
FT                   LVKAEQLLKLYENRDKKWDNRESGEVKVILDHLKTTCTDNPTELPQPYRVSLPYVIVKL
FT                   LERQTFEFSTDRLYRIITYIYNYCKSSPDITLYLNVCNVDFYNSLLSLSWESYSEIKQI
FT                   RHITSEMKINGIFGDISTIEKLNKIVGEAREFNDNIPTVDELGNIQKKYNSVSVVWDKD
FT                   SPNDLRMVEIYLRDLKERLTN"
FT   CDS_pept        complement(126584..127375)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000191688" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19350343"
FT                   /locus_tag="CAGL0K01441g"
FT                   /product="Similar to uniprot|Q07350 Saccharomyces
FT                   cerevisiae YDL043c Pre-mRNA splicing factor "
FT                   /function="nucleic acid binding"
FT                   /function="zinc ion binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAG61248.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG267939"
FT                   /db_xref="HOGENOM:HBG523795"
FT                   /db_xref="InterPro:IPR003604"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="UniParc:UPI00003B6BCA"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNA7"
FT                   /transl_table=1
FT                   /translation="MDFQNRAGSKKGGGGIASDSQINQQRRRQVEELLQQGENIKYTFQ
FT                   DKEGEKDDTDTKKVQSNPYIYKNHSGKLVCKLCNTMHMSWSSVERHLGGKKHGMNVIRR
FT                   GELDEIRHEKQQATKPVDTFEMKVEARRKTINTIEGLVPTCHSTEVIDEKGNKGIAVML
FT                   EFEESDKTADVLNADRPYARIVSGLELNTSAQKDKRFLVVAYEPYQNVAIEIPNDREIV
FT                   MNGYQPQSDEEIFVDTLNRQCTFWIENQRQFIVQIFFKETS"
FT   CDS_pept        complement(127773..129332)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000191845" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21045934"
FT                   /locus_tag="CAGL0K01463g"
FT                   /product="Strain CBS138 chromosome K complete sequence "
FT                   /function="NAD binding"
FT                   /function="NAD-dependent histone deacetylase activity "
FT                   /function="zinc ion binding"
FT                   /biological_process="chromatin silencing"
FT                   /biological_process="protein deacetylation"
FT                   /protein_id="CAG61249.1"
FT                   /db_xref="GO:0006342"
FT                   /db_xref="GO:0006476"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0017136"
FT                   /db_xref="GO:0070403"
FT                   /db_xref="HOGENOM:HBG191410"
FT                   /db_xref="HOGENOM:HBG203103"
FT                   /db_xref="InterPro:IPR003000"
FT                   /db_xref="InterPro:IPR007654"
FT                   /db_xref="UniParc:UPI00003B6BCB"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNA6"
FT                   /transl_table=1
FT                   /translation="MSDESSTRRSKRLKTGPSPTSSSASSTSVSPMGPFSSGRTLRSSR
FT                   LSPNRHSALGSPMMTAEEIAQQESLMPREPPSPILIGKNVKDGKFVVTAFTRKDTINAC
FT                   MYLKYYGLRKFWTAYFPPEINSLHLYYMIRLLGFQLKDREVLNHISKNVEEWKANKKYT
FT                   ISYADMNDPLDKKFTIRLLRNLYKAINKVLSTRLRLMNFFTIDHLVERLEKAKRIVVLT
FT                   GAGISTSLGIPDFRSSEGFYTKIKYLGLEDPQDVFNYEIFLRDPSVFYNIANMVLPPEN
FT                   IYSPLHSFIKLLQDKRKLLRNYSQNIDNLESYAGIEVSKLIQCHGSFATASCVTCKWSL
FT                   PGEKIFKNIRNFEIPLCPHCYKKRTKYLELYERELDGEEHIPEWFDQVDKDTIKSFGVI
FT                   KPDITFFGEPLPSRFHKTVKEDIFRCDLLLCIGTSLKVAPVSEIVNMLPAHVPQVLINR
FT                   DPVRHAEFDISLLGYCDDIATMIAQKCGWKIPHQKWDKELTNKKFEIKESAVSVYSVVS
FT                   AD"
FT   CDS_pept        complement(129822..131195)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000167783" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17443393"
FT                   /locus_tag="CAGL0K01485g"
FT                   /product="Strain CBS138 chromosome K complete sequence "
FT                   /function="RNA binding"
FT                   /function="pseudouridine synthase activity"
FT                   /biological_process="pseudouridine synthesis"
FT                   /protein_id="CAG61250.1"
FT                   /db_xref="GO:0001522"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0009982"
FT                   /db_xref="HOGENOM:HBG348956"
FT                   /db_xref="HOGENOM:HBG395845"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006224"
FT                   /db_xref="InterPro:IPR006225"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniParc:UPI00003B6BCC"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNA5"
FT                   /transl_table=1
FT                   /translation="MIRAVLNFFRAGKPKLDGVTASTATKRSFTEIQDKDKSTFDAQLE
FT                   QEIKRAKRVQEEKIKRRERNKKSNAKSEIIRDGAGFKLRASSTNKKTKNRQSDPPYTIE
FT                   VDGPLRKIVPYYFTYNTYCKLRWRDRNLLDVFTNEFRDRPAEYYKKTIERGAVLLNDKP
FT                   ATLESIIKNGDLITHKVHRHEPPVTSRPIEIVFEDNDILVINKPSGIPVHPTGRYRFNT
FT                   ITKALEKERGYVVHPCNRLDRMTSGLMFLAKTSKGADKIGDQLKAREVEKEYLAKVVGE
FT                   FPEGTTVVDKPLKLLEPRLTLNVVCEETDPDAKHARTIFERVSVSKDKQTSIVKCKPLT
FT                   GRSHQIRVHLQHLGHPIANDPIYSSPEVWGDGKDYDEVIKRLDNVGKSYPAGTWQLPSS
FT                   RSNGTMLTGELCPECETELYSDPGPNDIELYLHAFRYSTKEDTEQQWSYETKLPHWAN"
FT   CDS_pept        complement(131704..134490)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000141709" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17443394"
FT                   /locus_tag="CAGL0K01507g"
FT                   /product="Strain CBS138 chromosome K complete sequence "
FT                   /protein_id="CAG61251.1"
FT                   /db_xref="HOGENOM:HBG058990"
FT                   /db_xref="HOGENOM:HBG104286"
FT                   /db_xref="InterPro:IPR022596"
FT                   /db_xref="InterPro:IPR023041"
FT                   /db_xref="UniParc:UPI00003B6BCD"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNA4"
FT                   /transl_table=1
FT                   /translation="MLDALANFNVTEVPSLKTSVREAMSTLNTTTVNLALGLPGMFSTF
FT                   NAGQLYRIRVVAITASALSIFGGVVGIYCMLNIDKRRKVFRHDLILFLIICDFIKALIL
FT                   MIYPAIILNNNYVYATPAFFNTLGWLTAYATEGADIAIMVFAIHFALLIFKPNWKWRNA
FT                   KTGNMEGGLYKVRGYIWPMTALIPSVLASLAFINYNKLHKWTQAERDAVVLDNNNYDFP
FT                   FKPRIGGYKPWSAWCYLPPRPLWYKIVLSWGPRYFLVITIIAIYISIYLYVSSKIRKIK
FT                   NQLKDFKHEQEEARHEEDRILRSSKFGTIKWLMKRYISPLFMGIIKSFKNFFTLSMEDI
FT                   SDDSELSTRSYSIYSSGSSYAYGANKADNEDYDKYHQGLQILKYKNSKNAQERNAVREQ
FT                   IQNQNQDQVENKAEDKDIEMADLETPKETFNNPLSKLSSLRKHMSIHSTDRRSGHSRRF
FT                   SDASDESNIDSLLENGLTEIFSTPIPDGEDSETQNPVAYQMEDLSKGISPMDNSVVPPL
FT                   GDERRIVGANEIDDVKKNFQREMYQNMKKRRSQIQKNVRSIFIYPCSYLALWVFPIIAD
FT                   CLQYNYEEKHGPVMWVTYLDTFTRPLACIVNSMVFFYREKPWRHTWERVEKKVLLDKFI
FT                   LKGEMSEQDMLFYRKTKLGRRGWYYRGKWLKRQCWSHQKEWWKRCLWYVYRTFIGAFKL
FT                   DFDYEDNCWDNEFWDQYYSGKPLPEFRSHQNAKEGKMRSTETENVLTSDSSLSPSREDA
FT                   FYDAQDKLKISAFWMLVHLFPMLNGVDLDEINRVLRMKYKEDDFVIPGLTYALTQRNAQ
FT                   VPTPQVAAGKHSRNPSTIRNTNTKLPTFDLRTQQIPSSDEHHYMRETPKIDEHLFSNRN
FT                   SQVSFARLDTDRPTSTVSESTSKQTTPPASTSVSQPSNHDDDDEHIDILAFLNEPLK"
FT   CDS_pept        complement(134906..136126)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000218046" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21045935"
FT                   /locus_tag="CAGL0K01529g"
FT                   /product="Similar to uniprot|Q12093 Saccharomyces
FT                   cerevisiae YDL033c"
FT                   /function="transferase activity"
FT                   /biological_process="tRNA processing"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAG61252.1"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0008033"
FT                   /db_xref="GO:0016740"
FT                   /db_xref="HOGENOM:HBG001358"
FT                   /db_xref="HOGENOM:HBG288422"
FT                   /db_xref="InterPro:IPR004506"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniParc:UPI00003B6BCE"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNA3"
FT                   /transl_table=1
FT                   /translation="MLEKFLRLARGRVVPGYSPQHVPAKFDNVVIAMSGGVDSSVAAAL
FT                   FAHYPKATGVYMQNWSESQALESIAEEPCYEKDWKDVAKLGDFLGVPVEKVNFESDYWI
FT                   DVFEPMLQEYDQGRTPNPDIGCNKFVKFGKLKSYLDQKYGHDNYHLVTGHYSRVLQHLE
FT                   SKEYHLLRGYYPQKDQSYYLSQINGGILPRLVLPMGHLTKPEVRDMARELQLPTANKRD
FT                   SQGICFVNNSQHKKFNKFLEHYLTNKPGNVITVEPTGEKTVWGTHKGLWSYTLGQKIGD
FT                   GISLPQADPRYTGAWYVSEKIPATNEIVIVRGRENPQLYRDKLRIQDFEYLGEPQTIRK
FT                   AITEALQRGELRARYRSLMEPEPLISINTDADEFHLQFQRPQRAMAPGQFCCLLSQNRI
FT                   LGSGPIM"
FT   CDS_pept        136421..139330
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000246455" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17443395"
FT                   /gene_name="DBP10"
FT                   /locus_tag="CAGL0K01551g"
FT                   /product="ATP-dependent RNA helicase DBP10 "
FT                   /EC_number="3.6.4.13"
FT                   /function="ATP binding"
FT                   /function="ATP-dependent helicase activity"
FT                   /function="RNA binding"
FT                   /biological_process="rRNA processing"
FT                   /cellular_component="nucleolus"
FT                   /protein_id="CAG61253.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005730"
FT                   /db_xref="GO:0006364"
FT                   /db_xref="GO:0008026"
FT                   /db_xref="HOGENOM:HBG517301"
FT                   /db_xref="HOGENOM:HBG737336"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR012541"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="UniParc:UPI00003B6BCF"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FNA2"
FT                   /transl_table=1
FT                   /translation="MVKNLKRKERDEHESDSDEEIDIAGNLVADGSDSESDDSSDGSDE
FT                   EVQDVIEYSSDEEEPAKPAKAVKKKVEDKSFPSLELSDDEDEKKKVDNDDDDVNAYFSV
FT                   NTDAKSKHKKGSFASFGLSKLILVNISKRGFRQPTPIQRKTIPLILQNRDIVGMARTGS
FT                   GKTAAFVLPMIEKLKTHSSKIGARAIILSPSRELAMQTHSVFKEFSRGTHLRSVLLTGG
FT                   DSLEDQFGMMMTNPDVIIATPGRFLHLKVEMNLDLKSVEYAVFDEADRLFEMGFQEQLN
FT                   ELLAALPSSRQTLLFSATLPTSLVDFAKAGLVNPVLVRLDAESKISDNLEMLFLSTKND
FT                   EREANLLYILQEVIKLPLATPEQIKQLNDNKADDSDESAEEDEDKKRRKRKSFNRKAMP
FT                   KANELPSEKATVVFVPTRHHVEYLSNLLKDCGYLVSYIYGALDQHARKSQLYNFRIGLT
FT                   SILVVTDVAARGVDIPMLANVVNYSLPASSKIFIHRVGRTARAGNRGWAYSIVSENELP
FT                   YLLDLELFLGRKILLTPMYEALERLSKEKWVAEGNDETLFQSPKISYTSRMVLGSCPRL
FT                   DIEALSELYNNLMKSNFDLDMAKKTALKAEKLYFRTRTSASPESLKRSKEIISSGWDEQ
FT                   NVLFGKNLEKEKNAFLEKLQNRRNKETVFEFTRNPEDEMANLMHRRRRAIAPIQRKAKE
FT                   RKELLEKERMAGLTHALEDEILKGDDAEVGYTVTEDTLKAFEDADTILAEQENASKKKK
FT                   KTFRDPNFFLSHYAPANEIQDKQLELSGGFINEAAQSAYDLNSDDKVQVHKQTATVKWD
FT                   KKRKKYVNMNGIDNKKYIIGESGQKIAASFRSGKFDEWSKARKLAPLKTGANESSIPSN
FT                   LLVDPTRGPGKSGSKLPNGKFKHKLEKAPRLPDKKRDDYHKQKKKVESALERGIAVKGY
FT                   NNAPAFKSELKSVAQIRKDRKTKENRHAKNARPSKKRKF"
FT   CDS_pept        139809..141359
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000160935" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17443396"
FT                   /locus_tag="CAGL0K01573g"
FT                   /product="Strain CBS138 chromosome K complete sequence "
FT                   /function="zinc ion binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAG61254.1"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG058991"
FT                   /db_xref="HOGENOM:HBG203107"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="InterPro:IPR022755"
FT                   /db_xref="UniParc:UPI00003B6BD0"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNA1"
FT                   /transl_table=1
FT                   /translation="MELDTVRSLLEDIEVIEDAISSRFQRNPELYYDYRIHLEGIRDDI
FT                   PKLGLDDDRMVNKIYKARKHKRTLKQKRTQQYEINTFLDDIFKKNKYILKVRNQLKSDG
FT                   LKYKDSECKFELLKKLLGDEPTEDEDEDDSISKSNSSRLLDIDETINRYNMNLGNGKLV
FT                   SERCSLLDINTIFQKDEQDGFIIDFEPLYRRWLNIVKDGTLTYPKFISNLEKFIDDKKY
FT                   LLDPVMDRKTKGYCEFVVEACDFVETQYFKRNILLNEEQIKGKLHRDFENHVTKAIITE
FT                   SGIYYCLYCDKMFNSAHIYDSHRTGKAHSKSVSNYHDSFRAEFKLHVYVSCMREEFENT
FT                   KEYVDRKMAFTNKERLEEMEKLTQEYHRPVYDPTEKEGDVEEDNSKSKTKDELKEMLGL
FT                   GEDMPLGPDGLPIPYWLYKLQGLDVGQECEICGNQVYKGHKNFDKHFSGPTHTYHLKCL
FT                   GIEPSSAFQGITKIKEAQALWKQMQRNTTQELAEEVEDKEGNVMSKDIYEELKKQGLV"
FT   CDS_pept        join(141618..141639,141971..143124)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000233340" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17443397"
FT                   /locus_tag="CAGL0K01595g"
FT                   /product="Similar to uniprot|P32381 Saccharomyces
FT                   cerevisiae YDL029w ACT2"
FT                   /protein_id="CAG61255.1"
FT                   /db_xref="HOGENOM:HBG345785"
FT                   /db_xref="HOGENOM:HBG559892"
FT                   /db_xref="InterPro:IPR004000"
FT                   /db_xref="InterPro:IPR020902"
FT                   /db_xref="UniParc:UPI00003B6BD1"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FNA0"
FT                   /transl_table=1
FT                   /translation="MDPHNPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERA
FT                   TINKPLKDIMIGDEASDVRSYLQISYPMENGIIKNWTDMELLWDYAFFNQMQLPTTSGG
FT                   KILLTEPPMNPVKNREQMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSGVVVDSGDGVT
FT                   HIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLCYV
FT                   SYDLDLDTKLARETTTLVENYELPDGRIIKVGQERFEAPECLFQPNLVDVEQAGIGELL
FT                   FNTIQSADVDVRSSLYKAIVLSGGSSMYPGLPSRLEKELKQLWFTRVLNNDPTRLDKFK
FT                   VRIEDPPRRRHMVFIGGAVLASIMADKDHMWLTKQEWRESGAAAMSKFGPR"
FT   CDS_pept        complement(143308..145632)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248654" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21045936"
FT                   /locus_tag="CAGL0K01617g"
FT                   /product="Strain CBS138 chromosome K complete sequence "
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="CAG61256.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG058850"
FT                   /db_xref="HOGENOM:HBG203108"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR016242"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI00003B6BD2"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FN99"
FT                   /transl_table=1
FT                   /translation="MGNPYHSESDQIWRISSQDSDDGEIGNPPKLSNFGSELISDAIEN
FT                   INPNRSDKKLISEETRIHESHSQQLNTDINQSTRVTHSASSPLYFEDTSPSTMFVQSQA
FT                   SAQPSATTYDISSQDYSDSSKSFIKLKSKQDTLKQELTTRYSERRTRRFLHATNRTTKL
FT                   GPALRNLTSPALAINDNNSIDNKMNETSKVNSSFDTNNAYVDFHQTKQDIYTSGEEHNN
FT                   TKDNGKIGATQQNDYSDINIHECNPIQYMKMHNLPTSELSKISKAYFEKQKEENRKKAL
FT                   KNVNMKQSLNYDLKHYSNSFPSIESGKENNLIHNTEIEDFNGRGHSTNNHSSSYLSNSH
FT                   SHPVSTQFVESANIELEKPTLKKSLSNADSYRHTQREALQNIDVNSNVRDGAIDYKRQK
FT                   IALKDSEFDGILDKKKYRGIKRVEIVEPPTSTRPPSRKNVVSVNGTEYERVELLGRGGS
FT                   SNVYKVRGLKNRVYALKKVSFDEFDESSVEGFKGEISLLKQLQNQNRVVQLYDFEMGSG
FT                   VLYLLMECGDYDLSQVLHQRANQPFDMEFIRYHAREMVTCVKVVHDAGIVHSDLKPANF
FT                   VFVKGILKIIDFGIANAVPDHTVNIYRDMQIGTPNYMAPEALVANNYTADNDGKYDQKT
FT                   NKWKIGKPADIWSCGCIIYQMIYGKPPYAKYQGQERLLSIMDPNVKIEYKEVLPDKTVI
FT                   PSLALELMQYCLMRNPEERWSALQILDSPFLNPLMVSQDFIKNLITTAVSYGAREGDVS
FT                   PSRLEALTDSVLARLADFRMH"
FT   CDS_pept        complement(146143..147354)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18502539"
FT                   /locus_tag="CAGL0K01639g"
FT                   /product="Similar to uniprot|Q07349 Saccharomyces
FT                   cerevisiae YDL027c"
FT                   /protein_id="CAG61257.1"
FT                   /db_xref="HOGENOM:HBG123869"
FT                   /db_xref="UniParc:UPI00003B6BD3"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FN98"
FT                   /transl_table=1
FT                   /translation="MLINTVSVIAQRNNTSATSKFHIAYKNMLSRFSGIATRNPLRASS
FT                   LILKGLPNRNAKIVQLLSLTSVTRSTQSLPALRSSNQLLTIPPCQPRTLNKVLKRGFYT
FT                   TSKKSIKFIFSKGDKDNHNKMKYYSIPTPVVILSTIGGFVLLFTILPFLFTFGFPFLIG
FT                   MIVFFQFRRWKTHQLYKKMAEVLQDSQINMKNNQLMSLKYRLIEQGLPMLTNFSNKTTK
FT                   QLSSRGETLINQLQQRIKESFANNDNNIANVFVPQGHKLSEYELLLPHHTFKSYTKKLP
FT                   HDQDIGLLSLSLYMRRRQHRNIKVAMPIPVELNLGNKVANVYFVYKGDTARGLLNTQIL
FT                   LEAAKAGVDLQEIKSSTQFLISIVPLDSWLPTQYIIADAGSLGSFNEDPSSSSREFVIN
FT                   NKSK"
FT   CDS_pept        complement(147781..149229)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000113214" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18502540"
FT                   /locus_tag="CAGL0K01661g"
FT                   /product="Similarities with uniprot|Q12100 Saccharomyces
FT                   cerevisiae YDL025c"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="CAG61258.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG123870"
FT                   /db_xref="HOGENOM:HBG447834"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="InterPro:IPR020636"
FT                   /db_xref="UniParc:UPI00003B6BD4"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FN97"
FT                   /transl_table=1
FT                   /translation="MVSFINGTDRLPGSSSSSSLSGRKSSLRKLFFRSSDEIPSIAPKS
FT                   SSIHLNPTTSTPVSSEHRPFPHNLHSPLNYTTRQLSQRHTSSASQLEMLHPVEALMHRK
FT                   LPETWPDIPTVHEPQEKKKQPPLKRFLKKFNSSSNSSSTDDSYNASSSMVTPVTYKQTV
FT                   LTDYVDTPMELIHKYGIPGKKIGEGASGSVSIVKKSNGQQYAVKMFRTSPNSTQEQIEK
FT                   YCKKITAEFCMGSTLHHANVIETFDIIREGNSLLMVMEYAPYDFFDLVMTNTMSPDEIS
FT                   CYFKQLCHGVNYLHAMGIAHRDLKLDNCVVTNDGILKLIDFGSAVIFQYPYERNIVKAT
FT                   GIVGSDPYLSPELLEMNHYDPRLADVWSLAIIYYCMTLKRFPWKAPRKQFNSFRLFCED
FT                   PDDENDFSKGPMKVLRQLPSYSRDLIGKMLELEVKDRYYLEQVMKHEWFQSIEVCIADS
FT                   KGELLYKPKTHIHHLETELKVSNT"
FT   CDS_pept        150099..151301
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000246855" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21045937"
FT                   /gene_name="GPD1"
FT                   /locus_tag="CAGL0K01683g"
FT                   /product="Glycerol-3-phosphate dehydrogenase [NAD+] 1 "
FT                   /EC_number="1.1.1.8"
FT                   /function="NAD or NADH binding"
FT                   /function="glycerol-3-phosphate dehydrogenase [NAD+]
FT                   activity"
FT                   /function="protein homodimerization activity"
FT                   /biological_process="glycerol-3-phosphate catabolic process"
FT                   /biological_process="oxidation-reduction process "
FT                   /cellular_component="glycerol-3-phosphate dehydrogenase
FT                   complex"
FT                   /protein_id="CAG61259.1"
FT                   /db_xref="GO:0004367"
FT                   /db_xref="GO:0009331"
FT                   /db_xref="GO:0042803"
FT                   /db_xref="GO:0046168"
FT                   /db_xref="GO:0051287"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG289569"
FT                   /db_xref="HOGENOM:HBG586392"
FT                   /db_xref="InterPro:IPR006109"
FT                   /db_xref="InterPro:IPR006168"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR011128"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR017751"
FT                   /db_xref="UniParc:UPI00003B6BD5"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FN96"
FT                   /transl_table=1
FT                   /translation="MSNSAAGRLNQTSHILNESIKNDDISLRRSQPSTTSLQALEHPFK
FT                   VTVIGSGNWGTTIAKVVAENTALNPHLFVSRVDMWVFEEKIDGKNLTEIINEQHENVKY
FT                   LPDIKLPENLVANPNLIDSVKGADILIFNIPHQFLPRIVSNLKNHVGPHVRAISCLKGF
FT                   EVGKKGVQLLSSYVTDELGIQCGALSGANLAPEVAKEHWSETTVAYHIPKDFRGEGKDV
FT                   DHKLLKALFHRPYFHVNVIEDVAGISIAGALKNVVALGCGFVEGLGWGNNAAAAIQRVG
FT                   LGEIIKFGQMFFPESRVQTYYQESAGVADLITTCSGGRNVRVAKHMAKTGKSALDAEKE
FT                   LLNGQSAQGIITCKEVHEWLETCEMTHEFPLFEAVYQIVYNNVPMKNLPDMIEELECIA
FT                   D"
FT   CDS_pept        151967..152926
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000221682" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20197145"
FT                   /locus_tag="CAGL0K01705g"
FT                   /product="Strain CBS138 chromosome K complete sequence "
FT                   /function="intramolecular transferase activity,
FT                   phosphotransferases"
FT                   /biological_process="glycolysis"
FT                   /protein_id="CAG61260.1"
FT                   /db_xref="GO:0006096"
FT                   /db_xref="GO:0016868"
FT                   /db_xref="HOGENOM:HBG469482"
FT                   /db_xref="HOGENOM:HBG658938"
FT                   /db_xref="InterPro:IPR001345"
FT                   /db_xref="InterPro:IPR005952"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="UniParc:UPI00003B6BD6"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FN95"
FT                   /transl_table=1
FT                   /translation="MSTLKLFILRHGQSDLNHENIFCGWIDAKLTDKGRSQAKNAGQLI
FT                   AQHCKSNGITLPQIGFTSRLLRTEQTMDVILNELQLGKKDEVSGQFNNPVFVVFDYIYT
FT                   LAEIRSYLLSEKEENPISNEIPVLRTWRLNERHYGAWQGQRKPKVLKEYGEEQYMYIRR
FT                   DYNGRPPEVDLEKEMIQKHDLGAATGYEFKEPNRSLKYELEELNQNIKLPYSESLSDVV
FT                   ARLEPFLDEIILKVAKEFDLDSCLIVGHGSSVRSLLKILEGVSDEDIKGVDIPNGIPLV
FT                   IELDKTNNFKFLRKYYLDPELAKINAEKVRKEGFEENP"
FT   CDS_pept        complement(153398..154897)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17443398"
FT                   /locus_tag="CAGL0K01727g"
FT                   /product="Similar to uniprot|Q03465 Saccharomyces
FT                   cerevisiae YDL020c"
FT                   /function="zinc ion binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAG61261.1"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG123871"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="UniParc:UPI00003B6BD7"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FN94"
FT                   /transl_table=1
FT                   /translation="MTSIDLGLKRTLTDVLEDELYNMRLREQETAQEQLDLREAGKVRQ
FT                   VQLQQQQMFSQYADPSVTMMSGDVACEGVLSTAPANLLANPDIRQAPAPQAQAQMLQVN
FT                   PEVLISYANKNSAHMNVSAVDDKLNRGLVDENSYYDDVDYSSMNAKMADWQLDDNVAML
FT                   DNNDARLIFDNEFADDDDLSDDENLFDEGLENYHNELVSSNSPIESLDVAEHKESVDDR
FT                   LRKYHLDNIQNILSKTSTNDKDILQIKLPSDFTTTNLHSTNPSGLIEDPSQLVLGSSKK
FT                   ITEDTHVEEESKNLPDLTELTSATEIEDILLAVDSDDDDLYTKPIAKQTTKKDNSKPVE
FT                   KTVVEKTSSVTKAGSNHSRSTLARPTAHARKLSSSRKQAPKVYNPKTTTKSTHTHSKNN
FT                   ATHEAFVCELVNSVTNEVCGAQFSRTYDLTRHQNTIHAKKRSIFRCSECIRALGDEGFQ
FT                   KTFSRLDALTRHIKAKHENLSLEERQQVTKYAKSNIGFVTA"
FT   CDS_pept        complement(155385..159134)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000186039" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20197146"
FT                   /locus_tag="CAGL0K01749g"
FT                   /product="Similar to uniprot|Q12451 Saccharomyces
FT                   cerevisiae YDL019c"
FT                   /biological_process="steroid metabolic process "
FT                   /protein_id="CAG61262.1"
FT                   /db_xref="GO:0008202"
FT                   /db_xref="HOGENOM:HBG059149"
FT                   /db_xref="HOGENOM:HBG325159"
FT                   /db_xref="InterPro:IPR000648"
FT                   /db_xref="InterPro:IPR001849"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="InterPro:IPR018494"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniParc:UPI00003B6BD8"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FN93"
FT                   /transl_table=1
FT                   /translation="MATHDVGVTLRKSRVSKPMLKLKLLQAMTGGSFKELHDMLQKEFV
FT                   PYDDPSVMEVSTLLLHYAVQVAPIALIKEIVRDYVVRDPFHLGLHKTPEGDITVNLNIN
FT                   YRDYNGNTPLHLAASQSRVDVVNFLMELPDINDTIVNNAGQEPIDMCKTLDIVAAMQNK
FT                   RDEYVSQVAQDLRDAFDRRDFDKLEQIWKIQRNEELLDINGLDPTSGDTVLHEFVKKKD
FT                   VQMCKWLVDHGADPLRRNAKALLPIDLLGPTSPSKHQGSSSELRNYIETVTRDRNVVNV
FT                   SETDHQTHAPTYKGQLKKWTNIAKGFQTRWFVLSEDGYLRYYKNRPKEGSSPRDKVHLS
FT                   KCRLFSNSHEKVKFELLIGDQGRWRLKGTNPAEAKKWIAAIQAGISYANAKHSQKQPSN
FT                   RSVISGSANEGQSRSAPSLQPAKPNRSRANSSTSQRISQVQKGLKPPVLGISTDHSNYG
FT                   SNASDAESVVGSLNINTNRLRRDMSPLTPMSNSLNSPILKDESFNSPTLESLLGKDKLN
FT                   AIDPYAKDSDEDIDEILVKPIDPDEEYLKTQYGPFIENLNVYKKTISMQLASVLEVLDT
FT                   ADISSSDLSTLRGTIQNTVDTFNNLAKLGAERDRKLVQIITKHRDVNNVWIDSVKELEL
FT                   ELNKKEDLLEALTKERRHLRKELNQELQETADQDNKMIKRASTVISRFLNVTKSVVEDG
FT                   NGDEFYDAEELIDEIGSIPDTTPGEMSEAKEMREQIKTMVPEQPAESKVEHEETSEKKE
FT                   VEQAETKPALEQKAISKEQEKMEAIKEQTSKPTDEESTLRETATSTASVKGESNEIELQ
FT                   RKLFASSKMKSQTESQKAKEKLLLEEGSFFGYDEGVRKRLKLDEDDRPKISLWGVLKSM
FT                   VGKDMTKMTLPVAFNEPTSLLQRVAEDLEYSELLDKAVQFEDSTLRLLYVSIFTASAYA
FT                   STTKRVAKPFNPLLGETFEYARPDKQYRFFAEQVSHHPPISATYTESPRWDFWGESYVD
FT                   THFNGRQFNVKHLGLWYINLLPNSTDRKELYTFKKPNNNVIGILVGNPQVDNYGEVVIT
FT                   NHTTGDYCKLYFKARGWRSSSAYEVKGEVFDKDNKKHWVLGGHWHDSIYAKHVNGKDKD
FT                   EIALDHKKTHTATEPTRDGSKFLVWKVNPRPDAPFHLTPFAITLNAPQKHLIPWLAPTD
FT                   TRLRPDQRAMEDGQYDLAAEEKHRVEEKQRAARRTREEQNIQYKPLWFTKETHPVTKKP
FT                   YWKFHGDYWQQRKNHQLKGKADIF"
FT   CDS_pept        complement(159387..161375)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000206461" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17443399"
FT                   /locus_tag="CAGL0K01771g"
FT                   /product="Similar to uniprot|P80235 Saccharomyces
FT                   cerevisiae YAR035w"
FT                   /function="acyltransferase activity"
FT                   /protein_id="CAG61263.1"
FT                   /db_xref="GO:0008415"
FT                   /db_xref="HOGENOM:HBG266464"
FT                   /db_xref="HOGENOM:HBG333439"
FT                   /db_xref="InterPro:IPR000542"
FT                   /db_xref="UniParc:UPI00003B6BD9"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FN92"
FT                   /transl_table=1
FT                   /translation="MTVGTEEEYKNFQTLERLPIPPLEATLKRYIDRTEPLLGSEEAQK
FT                   TKKVVYSESNLEVLSYLQDKLLEYENWLATFEPQSSYIEQFWYNAYLMYDSPVVLNVNP
FT                   FFELEDDPTLDYSMRTGVFQEYTLQIKRASRVVTSALRFASQIRNNTLKPDILRNDVPL
FT                   SMDQYQKLFGSSRIPPKPKQQSCHLQTDSTSHHIVIMYKGSFYWFDVLDCQNELIFQSA
FT                   EEIEWNLYSIIMDRERLNKENHKGFLEMGILTTESRRTWANIREHIHKQDSRQNWQNLK
FT                   IIDSALFVLCLDDYESHLDDPNSLLKLFLTGTSEIDFNSPFEIDEYVHAPKNLQRGTCI
FT                   NRWFDKLQIIVTKCGKAGVNFEHTGVDGHTVLRLANEIYTDAITSFAQTVTSRTPRTLP
FT                   QADSNLITVPRKLEWLKDEYLCRAVHFAEVKCTDLISQYEIESLEFGGYGSARIKSVFK
FT                   CSPDAFVQQMFQVAFYALYGTFETIYEPAMTKTFLNGRTEAIRPVTHDSIKFVKSVFNH
FT                   RSTDTERIDLLHRACQEHTRITRECSMGMGQDRHLYALQCIWQKLQAETPDDPITHSTP
FT                   PIFEDNAWHKINKNILSTSNCGSPALKWFGFGPVDKDGFGIGYIIKDSKISVTVSSRHR
FT                   QTARFITMLDRALNELDTIFNRAPKTI"
FT   CDS_pept        complement(162060..162722)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000160229" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18502541"
FT                   /locus_tag="CAGL0K01793g"
FT                   /product="Similar to uniprot|Q12403 Saccharomyces
FT                   cerevisiae YDL018c"
FT                   /biological_process="transport"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAG61264.1"
FT                   /db_xref="GO:0006810"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG334070"
FT                   /db_xref="HOGENOM:HBG372468"
FT                   /db_xref="InterPro:IPR009038"
FT                   /db_xref="UniParc:UPI00003B6BDA"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FN91"
FT                   /transl_table=1
FT                   /translation="MLAIAVLFLSLVGASPLTFELLKGERQCFHTLTTRTDCSISYYYE
FT                   VLSGTGNDLNVQYEIFEPGNLHEPIVNRNNEHKGHWSFPAKHRGEYTFCFYGGKAHDKI
FT                   VELEITSECGNVASDVRSQRRNFRKNQRGIEDKGESKQLKTKLEDSIDKIERQLYSLEN
FT                   SLGYYKTRNDRNHATVRSTEKRITAFSFYGILLIIGMSLGQIAVLQWVFKESRKQKV"
FT   CDS_pept        162973..164487
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000193450" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21045938"
FT                   /locus_tag="CAGL0K01815g"
FT                   /product="Strain CBS138 chromosome K complete sequence "
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="CAG61265.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG154249"
FT                   /db_xref="HOGENOM:HBG755340"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI00003B6BDB"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FN90"
FT                   /transl_table=1
FT                   /translation="MVGKYEIPEEIKQEIEQVYEEVPPLRDQYRLIDKIGEGTFSSVYK
FT                   AEDLQGKVTRKYGSHFWYKDSKYVALKKIYVTSSPQRIYNELNLLYILTGCVRVAPLCD
FT                   AMRVRDQVMAVLPYYPHEEFRNCYRDLPIKGIKMYMWELLQALSFVHSKGIIHRDVKPT
FT                   NFLYNPEIGRGVLVDFGLAEMQSDIITHGAEMAFPTAKDDDAAFAMKDYRNQELFCPCI
FT                   MRESKDTTIPSATHPLITIQNGKVVQLGNANGVDLTKGYPKNETRRVKRANRAGTRGFR
FT                   APEVLMKCGAQTTKIDIWSVGVILLSLLSRRFPLFQSLDDTDSLLELCNLFGWKAMKKC
FT                   AAIHGLGFEVAGVQNLREEPFQHGLKQFVYELLDKECEAGTFPEYSIAFETHSYLKYEI
FT                   EEGHSIEPHLPSQIEEDNDNEKMMQLKQYQKEIWSDHFWCFQVLEQCFKLDPSKRSSAD
FT                   ELLRSAFFNELNVGAGESTEGELTDEDVSDTASEAASSDEEVMLIA"
FT   CDS_pept        complement(164774..165706)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000190918" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17443400"
FT                   /locus_tag="CAGL0K01837g"
FT                   /product="Strain CBS138 chromosome K complete sequence "
FT                   /function="oxidoreductase activity, acting on the CH-CH
FT                   group of donors"
FT                   /biological_process="lipid metabolic process"
FT                   /cellular_component="cytoplasm"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAG61266.1"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006629"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0016627"
FT                   /db_xref="HOGENOM:HBG059145"
FT                   /db_xref="HOGENOM:HBG324731"
FT                   /db_xref="InterPro:IPR001104"
FT                   /db_xref="UniParc:UPI00003B6BDC"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FN89"
FT                   /transl_table=1
FT                   /translation="MLVTIKPRSKVLKETKVNLSESSTLEQVLIEVSRNNRNISKNRLR
FT                   LTYAKENKQLPILDDSYFKGLDSATTELYVKDLGPQISWRLVFVCEYIGPIIIHTLLYR
FT                   LSQNQSVISKFHNSSVHRDPFLYSLIYWLNTIHYTKRVLESLFLHKFSQATMPLFNLFK
FT                   NSSHYWILNGSITASYFGYGFLIGNDTLRPVYEFLHLEKVNTLVTLFLISEAWNFYIHL
FT                   KLRLWGDLQKKQGNTTKRVPLNEGIFNVLVAPNYSFEVWSWIWFAFIARLNIFALIFLA
FT                   VSATQMYLWAQKKNKKYNTRRAFLIPFIF"
FT   CDS_pept        166115..167086
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000106741" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17443401"
FT                   /gene_name="NOP1"
FT                   /locus_tag="CAGL0K01859g"
FT                   /product="rRNA 2'-O-methyltransferase fibrillarin "
FT                   /EC_number="2.1.1.-"
FT                   /function="RNA binding"
FT                   /function="methyltransferase activity"
FT                   /biological_process="rRNA processing"
FT                   /biological_process="tRNA processing"
FT                   /cellular_component="nucleolus"
FT                   /cellular_component="ribonucleoprotein complex "
FT                   /protein_id="CAG61267.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0005730"
FT                   /db_xref="GO:0006364"
FT                   /db_xref="GO:0008033"
FT                   /db_xref="GO:0008168"
FT                   /db_xref="GO:0030529"
FT                   /db_xref="HOGENOM:HBG297404"
FT                   /db_xref="HOGENOM:HBG370475"
FT                   /db_xref="InterPro:IPR000692"
FT                   /db_xref="InterPro:IPR020813"
FT                   /db_xref="UniParc:UPI00003B6BDD"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FN88"
FT                   /transl_table=1
FT                   /translation="MSFRPGSRGGARGGRGGSRGGFGGRGGSRGGFGGRGGSRGGSRGG
FT                   FGGRGGSRGGPRGGSRGGPRGGARGGARGGAKGGAKVVIEPHKHDGVYIARGKEDLLVT
FT                   KNMAPGESVYGEKRVSVEEPSKEDGVPPTKVEYRVWNPFRSKLAAGIMGGLDELFIAPG
FT                   KKVLYLGAASGTSVSHVSDVVGPEGVVYAVEFSHRPGRELISMAKKRPNVIPIIEDARH
FT                   PQKYRMLVGMVDAVFADVAQPDQARIIALNSHMFLKDQGGVVISIKANCIDSTVDAETV
FT                   FAREVQKLREEKIKPLEQLTLEPYERDHCIVIGRYMRSGLKK"
FT   CDS_pept        167939..169459
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17443402"
FT                   /locus_tag="CAGL0K01881g"
FT                   /product="Strain CBS138 chromosome K complete sequence "
FT                   /protein_id="CAG61268.1"
FT                   /db_xref="HOGENOM:HBG123872"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="UniParc:UPI00003B6BDE"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FN87"
FT                   /transl_table=1
FT                   /translation="MKRDGEEDPVIVLDSDNEEPANSEHEGVRPLPAIVVDEEDNSGAP
FT                   VEVTSVNADEGGDDDELTLLRQSNIRVPRRQISTPVAYINLDDEAAHHDASDDIEFLGG
FT                   NLVPNAGDNDEDAVTLLEERLADGLVPLNLPGGRRIIVNAANGEAPVRSSFERLMRNNQ
FT                   LRYLRTVPAERQNQRVQRNYRPVRNDGMFVPESDDSQDDEWETPDLSSGYQSSASNYPS
FT                   RPSSALINDWAIARARNAARRRTRAMTESRISAALGQLAGLSGSDLVNGYINFPVLPQS
FT                   MASYMHNHVYGTPITGSEDDEEAQTQSIIDIIQQREESERDKRVKEYTRKSESQKKKFY
FT                   EEAKQLPPGYSASFATPEVIRENDDEDNSNNDDDEDMIVCNLCGVELGIGIPEEFTGIS
FT                   KEDFALSFAELMDKYGSRCPYQSLGKPSELDRDLSKRTYVSNCGHLFCGRCWRRYLNAR
FT                   SLMKTKAGKSLNVKLGASHPDNFAPKVCPADNCKYQIRSKGKMREVYF"
FT   CDS_pept        complement(169669..169974)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20197147"
FT                   /locus_tag="CAGL0K01903g"
FT                   /product="Similarity"
FT                   /protein_id="CAG61269.1"
FT                   /db_xref="HOGENOM:HBG123873"
FT                   /db_xref="UniParc:UPI00003B6BDF"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FN86"
FT                   /transl_table=1
FT                   /translation="MSAEQYYGNQYAQNQYVHTRDQYYSAPQYQQPQYYQPPPQGYAPQ
FT                   GQYYQAQPPPYYQPPPQVRQQQPIYVQQAPPQNGNEDCLMACLAAMCICLTLDLLI"
FT   CDS_pept        170897..172243
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000163825" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17443403"
FT                   /locus_tag="CAGL0K01925g"
FT                   /product="Strain CBS138 chromosome K complete sequence "
FT                   /function="Rab GDP-dissociation inhibitor activity "
FT                   /biological_process="protein transport"
FT                   /biological_process="regulation of GTPase activity "
FT                   /protein_id="CAG61270.1"
FT                   /db_xref="GO:0005093"
FT                   /db_xref="GO:0015031"
FT                   /db_xref="GO:0043087"
FT                   /db_xref="HOGENOM:HBG018239"
FT                   /db_xref="HOGENOM:HBG330736"
FT                   /db_xref="InterPro:IPR000806"
FT                   /db_xref="InterPro:IPR002005"
FT                   /db_xref="InterPro:IPR018203"
FT                   /db_xref="UniParc:UPI00003B6BE0"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FN85"
FT                   /transl_table=1
FT                   /translation="MDQETIDRDYDVIVLGTGITECILSGLLSVEGKKVLHIDKQDHYG
FT                   GEAASITLSQLYSKFKQNPLSKEDREAKFGKDRDWNVDLIPKFLMANGELTNILVHTDV
FT                   TRYVDFKQVSGSYVFKQGKIYKVPANEVEAISSPLMGIFEKRRMKKFLEWISSYKEDDN
FT                   STHQGLDLDKNTMDEVYYKFGLGNSTKEFIGHAMALWTNDDYLQQPARPSYERILLYCQ
FT                   SVARYGKSPYLYPMYGLGELPQGFARLSAIYGGTYMLDTPIEEVLYSDTDKKFAGVKTK
FT                   LGEFKAPLVIADPTYFPDRCKSTGQRVIRAICILNHPVPGTGNADSLQIIVPQSQVGRK
FT                   NDIYIAVVSDAHQVCSKGHYLAIISTIIETDKPHIELEPAFKLLGPIEEKFMGIAELFE
FT                   PKDDGSKDNIFLSRSYDASSHFESMTDDVKDIYLRVTGHPLVLKKRAEE"
FT   CDS_pept        complement(172341..172658)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17443404"
FT                   /locus_tag="CAGL0K01947g"
FT                   /product="Similarities with uniprot|P40083 Saccharomyces
FT                   cerevisiae YER137c"
FT                   /function="nucleic acid binding"
FT                   /function="zinc ion binding"
FT                   /protein_id="CAG61271.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG123874"
FT                   /db_xref="InterPro:IPR001878"
FT                   /db_xref="InterPro:IPR013084"
FT                   /db_xref="UniParc:UPI00003B6BE1"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FN84"
FT                   /transl_table=1
FT                   /translation="MHCIKKRDAQPNRHCYANDMGKNELEEDVRKLSEAMDQIAKLVIA
FT                   TGVVKKPQDGSQEPQGPQVQPQMQTPKKKKKKKNKIHCSYCNEVGHTRARCPKKLGLID
FT                   I"
FT   ncRNA           <173107..>173155
FT                   /ncRNA_class="SRP_RNA"
FT                   /gene_name="SCR1"
FT                   /locus_tag="CAGL0K01961r"
FT   CDS_pept        173321..173713
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000141763" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17443405"
FT                   /locus_tag="CAGL0K01969g"
FT                   /product="Strain CBS138 chromosome K complete sequence "
FT                   /protein_id="CAG61272.1"
FT                   /db_xref="HOGENOM:HBG059427"
FT                   /db_xref="HOGENOM:HBG204261"
FT                   /db_xref="InterPro:IPR007898"
FT                   /db_xref="InterPro:IPR022793"
FT                   /db_xref="UniParc:UPI00003B6BE2"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FN83"
FT                   /transl_table=1
FT                   /translation="MDHTVYDACSDLILEHGKAVSADEVLADRIGNCVPIPLKTRQELE
FT                   LLSRGDRAAGVFSGDVVPRIDLRVVHYYATQLILAKYPQLMNRFDETSMITLGLLIEQW
FT                   VEEYLSGDSADAVAKHIDYRLNPTDI"
FT   CDS_pept        173969..175987
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000205147" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20197148"
FT                   /locus_tag="CAGL0K01991g"
FT                   /product="Similar to uniprot|P38205 Saccharomyces
FT                   cerevisiae YBL024w NCL1 tRNA"
FT                   /function="RNA binding"
FT                   /function="methyltransferase activity"
FT                   /protein_id="CAG61273.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0008168"
FT                   /db_xref="HOGENOM:HBG315458"
FT                   /db_xref="HOGENOM:HBG385837"
FT                   /db_xref="InterPro:IPR001678"
FT                   /db_xref="InterPro:IPR018314"
FT                   /db_xref="UniParc:UPI00003B6BE3"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FN82"
FT                   /transl_table=1
FT                   /translation="MARRRNYNKKKTFGARDDTNARKGWNELVRENAKWESYYKLLQLF
FT                   PAEQWDEFKTTCQSPLPLTFRVTGSRKHADEVLSLFKTRHLPNLTDVEFEGNKIQAPKS
FT                   LPWYPNEYAWQLDVPKTVIRKNEQFAKTQRFLVVENAVGNISRQEAVSMIPPIVLEVEP
FT                   HHTVLDMCAAPGSKTTQMIEALHKDTDEPTGFVVANDADSRRSHMLVHQLKRLNSANLM
FT                   VVNHDAQFFPRIILSDEPSKKKAQLKFDRILCDVPCSGDGTMRKNVNVWKDWNTQGALG
FT                   LHTVQLNILDRGLHLLQNNGRLVYSTCSMNPIENEAVVAEALRRWGDKVRLVDCSEKLP
FT                   GLIRSQGITQWPVIDRNMEERKKEDEGMINSWFPPSEEEVSKFHLERCMRVYPHQQNTG
FT                   GFFITVFEKVVEEEEEVEEPQQKKVKLDTQAPVKKEKLPRDANEEPFVFIDPNHAALQT
FT                   CWKFYGIDDKFDKTACLVRNATGEPTRVVYTVCSALKNIIQRNEDRLKIIYSGVKLFVS
FT                   QRSDIECSWRIQSESLPIVKHHMQSDRIVKVKPELLKLLLVDSFPSFEMIQNEHIDDDF
FT                   VEKMKEISSGCAFIEVIRDDENKENLFLPLWKGNRNVNLMVCKEDTHELLYRVFGIETT
FT                   AKDNPKAQAQKNAAEKKSEQDSEKESEKESTEPAVEA"
FT   CDS_pept        176257..177375
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000199266" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19350344"
FT                   /locus_tag="CAGL0K02013g"
FT                   /product="Strain CBS138 chromosome K complete sequence "
FT                   /function="ubiquitin-protein ligase activity"
FT                   /function="zinc ion binding"
FT                   /protein_id="CAG61274.1"
FT                   /db_xref="GO:0004842"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG059426"
FT                   /db_xref="HOGENOM:HBG397992"
FT                   /db_xref="InterPro:IPR003126"
FT                   /db_xref="UniParc:UPI00003B6BE4"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FN81"
FT                   /transl_table=1
FT                   /translation="MSSEGQGQTEEISASDFVNQQKQLEDEARELMPWEPKQCTYELGS
FT                   IRQPVFACRSHNQIGICYSCSILCHTSCDIVELFTKRHFTCDCGTERDTKPADEDGIHC
FT                   QLRKNRSKDISSDSNEYRQNFKGLFCGCSTEYDPENPAVMLQCVLGTECGEDWFHDYCI
FT                   LGKTKEEADELRARKQPDAENDDELEDPLAGMPDLETFDAFVCWKCTSKYEQYFKRLLS
FT                   HPLSETVIAKQLYRQCSEVKETDDGKRKHDEGSEDYSLFLKKDHESAFKKILKSSEADS
FT                   KIRIFLTDLAPHLIKDEPVYEPPEEKEETLSIEALTRQIIQNAMDRHTAVEGLTAFHSL
FT                   KDKLNSFLAPFAEAGQTVKEEDIVTFFSKSKH"
FT   CDS_pept        177716..178252
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000216653" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17443406"
FT                   /locus_tag="CAGL0K02035g"
FT                   /product="Similar to uniprot|P40081 Saccharomyces
FT                   cerevisiae YER134c"
FT                   /protein_id="CAG61275.1"
FT                   /db_xref="HOGENOM:HBG058687"
FT                   /db_xref="HOGENOM:HBG595032"
FT                   /db_xref="InterPro:IPR010033"
FT                   /db_xref="InterPro:IPR010036"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniParc:UPI00003B6BE5"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FN80"
FT                   /transl_table=1
FT                   /translation="MSYPEVAVFDLDYTVWPCYCDSHVFSPFKPVVNDNGEVHTLVDRH
FT                   GFEVTFFPDIPRIFTDLKDHGVKLISASRTWAPEVAQELLKGFKIRYHGKLVTLHEMFD
FT                   SLKWGERSKVGHIQDGMKEIYGSTELKKYRICLFDDESRNRDVERHGVKFIYIRNPEKG
FT                   PTWSLYQKYLNGELD"
FT   tRNA            178449..178521
FT                   /gene_name="tRNA-Lys (CTT)"
FT   CDS_pept        179166..180104
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000172697" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17443407"
FT                   /locus_tag="CAGL0K02079g"
FT                   /product="Strain CBS138 chromosome K complete sequence "
FT                   /function="hydrolase activity"
FT                   /protein_id="CAG61276.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG488218"
FT                   /db_xref="HOGENOM:HBG716770"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR006186"
FT                   /db_xref="UniParc:UPI00003B6BE6"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FN79"
FT                   /transl_table=1
FT                   /translation="MESQQVDVDSIIDRLLEVRGSKPGQQVDLEEHEIRHLCSKARSIF
FT                   IKQPILLELEAPIKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETIC
FT                   LLLAYKIKYPENFFILRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAI
FT                   IDEKIFCMHGGLSPDLNSMEQIRRVMRPTDIPDVGLLCDLLWSDPDKDIVGWSENDRGV
FT                   SFTFGPDVVNRFLQKQDMELICRAHQVVEDGYEFFSKRQLVTLFSAPNYCGEFDNAGAM
FT                   MSVDESLLCSFQILKPAQKSLPRQQAGRKKK"
FT   CDS_pept        182946..187847
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000113513" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19350345"
FT                   /locus_tag="CAGL0K02101g"
FT                   /product="Strain CBS138 chromosome K complete sequence "
FT                   /protein_id="CAG61277.1"
FT                   /db_xref="HOGENOM:HBG123875"
FT                   /db_xref="HOGENOM:HBG204455"
FT                   /db_xref="InterPro:IPR015915"
FT                   /db_xref="UniParc:UPI00003B6BE7"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FN78"
FT                   /transl_table=1
FT                   /translation="MSLLLPSACACYPLHLPSPYSHPRSNSSSSLNSADVRSPTKVSKK
FT                   DKEDDVYLDEALRKRLTLDVRTGSTTLLTRSNIYVNGGLTIPLNLTEVNSTQLQKELML
FT                   YFAKEKNKSISFKNLNEWISSETFFLDLISRSWRRLETTIDESSTTDDTNIKTNGRLFH
FT                   AMCFNEGFLYIFGGLMISPHNEYEFVATNDLWQLDLRGNKWSLLSKDPGVGRRYNHEMH
FT                   VLNSEDPTKDTKLVIVGGIDNMDEPVAKIDIFNLTTLQWESNAVEKTTRKNSGDMTALN
FT                   TNIDGLKTHINMDNNFSVMLDNSGKDSNAIPTLGFYLPIHKRSSKSYGKPTTKKSDSKK
FT                   SSKTHASENSSNKDNGLTVDTSDPKDDDLSPVAMLPLLPNTKGTRLTSRKLLKLEDFPK
FT                   KSTDDRSVPYNLMGPSGDSVSYSIIASGFHNNFSAANFHCYFYNVCSDTWTKLCTNCQD
FT                   SSIHRHRFWKTLVWKSHHQAILLGTANDDGQLPSVQKFDYLLSISLPMLNGFNRILHEI
FT                   TPDTNIHKKVSLKTPITPLTTVDKITQSQPIIPISSPHNTSIPDPLDPRRNLSLISNPT
FT                   SQFENYIRYITDPLEMESTSSVFPPYAMVLGKDTLEVFGKTLADFEFITNDGESIGVPM
FT                   FLLRKRWGRYFDRLLAQGYSKVCEDYRSNGVESTLIKYGSENNPILSASKTLPNKYPSN
FT                   HPKIVQEKHKIKIEKRSFKKEKDNEKITSSSNGMVFRVPFKGCDEDNCETNNGNHLIAG
FT                   TLSPSSEEKNKIMIKQKSTRTSSLVVPPPLQHRRNSVEERTQLRRLSHPAKLPNGEIID
FT                   EYHFSSKHNLNTRKHHHGRYIMSNSSSRKASIVSQNSLLSFVSSSSDRRTRGNSRKSSV
FT                   ANMSGASSPKLMPLQVNLPPQPRQPSESVPLPPLPTNLSLTQALSNIPHHRRNSHNYDY
FT                   IYGDRSSASASGRSSIVQTHRYSISSDPKFSMSEKSYSGSDDGNATQRHSTDKERQNDH
FT                   NQEYFKRAYSWSSDAGSERSNSDASNKDDPHAINSVEIEPLLIPRSLYMPWPAVSVKAF
FT                   TEFFFTGQINGKWPLSPVTLDLWMMSKVYEIRLLYDLITEALYSIIGKKEGSILVNCNS
FT                   LIDLFISKVNACYEDNEKCKIVLENNEAFRKLVDLRNAVKDIESGFLDTTLMEKSTRID
FT                   SISTGGSYFTEGPDGMTNRKLSLSSNNLNKHFRALHNNSQQSFGSRSHWKNSIDVRSIS
FT                   LAIPEDNGERQGNKSGRPHSKSLENLNEIDSSSEANSNPNVDAKQTDKNSSVELEEQIE
FT                   QVRLQTLSDIALGSGTTSPLTDNAGISNSMLPNDALAMDTESLLSTISDSDEYDMLHDE
FT                   MPLNMMTEKVREEKEEFEGSIDPLYKLPSTKAGSTVDTGTRSSENKNSAGENEIPPFST
FT                   LENMMSPNALPPVDHVLKSICRTAVLVNDGGIMLRASECIEFSKKLKKLKTIITNDLMT
FT                   LENNTMAAPIPMGRGALEDIIFGSFQKFDSEPNIQRATAVRPPLGPKTTSHNVEVLRKP
FT                   SNANSIYTTQSTISPRTSAVHSDIFIPTTGSMYNSNSANTPSSILTNSASKSNTNQRRN
FT                   RQNSRFNSQASGSMAVLMNPAVMPPPPPSSPSAAKSKKEGPPSTGPLSFLGIKK"
FT   CDS_pept        complement(188731..189090)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000108824" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17443408"
FT                   /locus_tag="CAGL0K02123g"
FT                   /product="Similar to uniprot|P39938 Saccharomyces
FT                   cerevisiae YGL189c RPS26A"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="CAG61278.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG410512"
FT                   /db_xref="HOGENOM:HBG744826"
FT                   /db_xref="InterPro:IPR000892"
FT                   /db_xref="UniParc:UPI00003B6BE8"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FN77"
FT                   /transl_table=1
FT                   /translation="MPKKRASNGRNKKGRGHVKPVRCVNCSKSVPKDKAIKRMAIRNIV
FT                   EAAAVRDLSEASVYSEYVLPKTYNKLHYCVSCAIHARIVRVRSREARRIRTPPQRPRFN
FT                   RENKVSPADAAKKAL"
FT   CDS_pept        190884..191837
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17443409"
FT                   /locus_tag="CAGL0K02145g"
FT                   /product="Similarities with uniprot|P39959 Saccharomyces
FT                   cerevisiae YER130c"
FT                   /function="nucleic acid binding"
FT                   /function="zinc ion binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAG61279.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG123876"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="UniParc:UPI00003B6BE9"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FN76"
FT                   /transl_table=1
FT                   /translation="MTDTFQLVHSDLTGNTLINNDAEQSVVIDDYEYEMLKRPSISDYM
FT                   LDRSRYYEYEKFDDISTAVLPEDKFIEPSQQIKKTTKVRNYFNNIFSNNIWSNYKRNKS
FT                   NSSALSGQDAYDVMTLNDEKMDDGDDIMDLDDDHNDLDMEPQVLNVNPRKVFSSIDNEA
FT                   LTQNQVFNFHSIINEVDDQFYIHNNPYQTYERRSNSIRQNESIDEDWNDQEDNTESQYS
FT                   EKTAYDSSTTNSPEGKKIRINGLPPRTRGRKPSLVPDLSKQFGCEFCDRRFKRQEHLKR
FT                   HIRSLHMGEKPYECHICNKKFSRSDNLNQHIKTHSH"
FT   CDS_pept        complement(192297..195785)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000115426" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17443410"
FT                   /locus_tag="CAGL0K02167g"
FT                   /product="Strain CBS138 chromosome K complete sequence "
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="CAG61280.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG058344"
FT                   /db_xref="HOGENOM:HBG203692"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="InterPro:IPR020636"
FT                   /db_xref="InterPro:IPR020657"
FT                   /db_xref="UniParc:UPI00003B6BEA"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FN75"
FT                   /transl_table=1
FT                   /translation="MVITTDSKYIEEVDIPENLQLEIDLSDPLLKGNSNSNTNVCTQST
FT                   LNTTTSTVSPVRKRFESLPEGLSASSSSLDSLNLLLEKQMTKQLNHPQHQEHLGSGKYS
FT                   PLGGNGGKLGRRTKVKETNRISLTYDPVSKRKVLNTYEIIKELGHGQHGKVKLGRDLVT
FT                   KRLVAIKIVDRHEKKERKFFSFKKPGKTENDKIKREIAIMKKCHHKHVVKLIEVLDDLK
FT                   SRKIYLVLEYCSRGEVKWCPPDCLETEAKGPSPLSFQFTREILRGVVLGLEYLHYQGII
FT                   HRDIKPANLLLSETGIVKISDFGVSLAASSSNVDGSDETIDELELAKTAGTPAFFAPEI
FT                   CLGEDAFEKYQLDREELFKGSCISFKIDIWALGVTLYCLVFGMLPFVSSFELELFEKIV
FT                   NDPVKFPKYSDMLKNNQVLQMTEEAEYEAAKDLLTRLLEKNPIKRINIEEIKRHPFVCW
FT                   DFDHLDGESEQELSLKLEEKMNFQCAQRDYLTQISVTMHELNNAVCGVGKEIKESDLQS
FT                   ITYRENASSDNSINLEKFNLIRDRDNSLIVSEGSILKNMKDLRRLSSKKSGADESLKKE
FT                   TNLEQSQLLLQNLKLVSSEDCEYDQDADFEESHGTSYSDNDESASETLSQKEQFEKEME
FT                   EFEKRQQNNNVVNLPINSSFASLDSFYIDNFAMTKMGMDNEVTNPEQRNSSASTFTKWN
FT                   TGSTHSVSPISHNSAHFTNNGNPSGNTTNISRNPSSHMLPYSLGMSSTRNDRIPRNHSI
FT                   SPHYSSNSSRKSRLQLSEAFPAKLKMTSKSKSQTNYHEGYENTEVDREKAGKRASSHPR
FT                   TQSRMQRANSTTKNSNHAIAAKNEAANRSTDSNRSDSPLISLQDMVKASGSNQDTYNVK
FT                   KGNFFDNFNGDDDSSSRSSVSSESSESYSDVPISEDSYSSASVSRRNTDTESLPYEFGI
FT                   DSGRASTVSLRDVPQNLGNVRPFLDLHPLTNSSSKGSQQRRDSMNSSGSDSDSDGPGSV
FT                   LVLRAGNKGHMRRQNSYQNDRPFNDSASTITPGATSPKRFYAKGSTLQPTNDRAKGYCK
FT                   SNLNPGVMAANAGTLVMSDSRAKPVIGTSDVFGTISNSTLTDVARHPLSRDLLKDALSS
FT                   GENSGRRGSIPLGILGIGSNSSPMNATVGGTLNKRASWSKDRTSLSDDELHSKNH"
FT   CDS_pept        complement(196915..197532)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000843" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20197149"
FT                   /locus_tag="CAGL0K02189g"
FT                   /product="Similar to uniprot|P40080 Saccharomyces
FT                   cerevisiae YER128w"
FT                   /protein_id="CAG61281.1"
FT                   /db_xref="HOGENOM:HBG058345"
FT                   /db_xref="HOGENOM:HBG203691"
FT                   /db_xref="InterPro:IPR013640"
FT                   /db_xref="UniParc:UPI00003B6BEB"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FN74"
FT                   /transl_table=1
FT                   /translation="MINDYTRRKVAVQDTQACYLCHKPTNVVLYNQSGPDWFYTCELHL
FT                   QNNPQFAVPVYGAEYESILKKMKETKELLNKQVTSKGGVGNWDGWVNKLISSRKSKDDD
FT                   KEADKKDDQKDDTQDAERQEPDLQKQYDMLLDKLTEIKSKNKKYKLSDMMFQNRVDLKE
FT                   RERLRRIRIQKEQEQYSNTDPVELETKFQFPSIPQTTPNKKV"
FT   CDS_pept        complement(197792..198847)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000074517" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21045939"
FT                   /locus_tag="CAGL0K02211g"
FT                   /product="Similar to uniprot|P40079 Saccharomyces
FT                   cerevisiae YER127w"
FT                   /protein_id="CAG61282.1"
FT                   /db_xref="HOGENOM:HBG058346"
FT                   /db_xref="HOGENOM:HBG396810"
FT                   /db_xref="InterPro:IPR007146"
FT                   /db_xref="UniParc:UPI00003B6BEC"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FN73"
FT                   /transl_table=1
FT                   /translation="MSLKSTLREINESLKATSESLDKLQDQYESGLPIEGGLKKYLGKD
FT                   GSGNEQVSLLTLKNDSMLAYLNSLLHILHDKMDRTGERVTADGHRERTIEHRVVLERGV
FT                   KPLEKKISYQLDKLTRAYTRMEKEYTDAEKRAAEKSAHREAEDSDSADDSSDEELSYRP
FT                   NASALVASKDKTSRDRKNKGDEGEGDESGEDEEKSGVYRPPKINAVLPPQQHHFEDRFV
FT                   ARDHKNKSNRSRMQAMEDYIKENSEQPDWESSIGANIVNHGRGGVKSLRDTEKERQVTT
FT                   YEEENFTRLNVGSSSAEKRKQKQRERNAKVNIIGGEDFSIFNSKRKLEDSTSRRGNKKS
FT                   RNAWDRAKRRL"
FT   CDS_pept        199177..199962
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000234606" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17443411"
FT                   /gene_name="NSA2"
FT                   /locus_tag="CAGL0K02233g"
FT                   /product="Ribosome biogenesis protein NSA2 "
FT                   /biological_process="rRNA processing"
FT                   /cellular_component="nucleolus"
FT                   /cellular_component="ribonucleoprotein complex "
FT                   /protein_id="CAG61283.1"
FT                   /db_xref="GO:0005730"
FT                   /db_xref="GO:0006364"
FT                   /db_xref="GO:0030529"
FT                   /db_xref="HOGENOM:HBG011932"
FT                   /db_xref="HOGENOM:HBG396800"
FT                   /db_xref="InterPro:IPR022309"
FT                   /db_xref="UniParc:UPI00003B6BED"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FN72"
FT                   /transl_table=1
FT                   /translation="MPQNDYIERHIKQHGRRLDYEERKRKREAREVHKVAEKAQKLTGW
FT                   KGKQFAKKRYAEKVAMRKKIKAHEQSKAKGSSKPLADNGEALPTYLLDREQTNTAKAIS
FT                   SSIKQKRLEKADKFSVPLPKVRGISEEEMFKVVKTGKSKSKSWKRMITKHTFVGEGFTR
FT                   RPVKMERIIRPSALRQKKANVTHPELGVTVFLPILGVKKNPQSPMYTQLGVLTKGTIIE
FT                   VNVSELGMVTSGGKVVWGKYAQITNEPDRDGCVNAILLV"
FT   CDS_pept        complement(200548..203016)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000208451" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19350346"
FT                   /locus_tag="CAGL0K02255g"
FT                   /product="Similar to uniprot|P39940 Saccharomyces
FT                   cerevisiae YER125w Ubiquitin--protein ligase "
FT                   /function="acid-amino acid ligase activity"
FT                   /biological_process="protein modification process "
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAG61284.1"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0006464"
FT                   /db_xref="GO:0016881"
FT                   /db_xref="HOGENOM:HBG067128"
FT                   /db_xref="HOGENOM:HBG607874"
FT                   /db_xref="InterPro:IPR000008"
FT                   /db_xref="InterPro:IPR000569"
FT                   /db_xref="InterPro:IPR001202"
FT                   /db_xref="InterPro:IPR008973"
FT                   /db_xref="InterPro:IPR018029"
FT                   /db_xref="UniParc:UPI00003B6BEE"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FN71"
FT                   /transl_table=1
FT                   /translation="MPAISVKLVAAESLYRRDVFRSPDPFAVLTIDGYQTKSTAAAKKT
FT                   LNPYWNETFRFDDINENSILTIQVFDQKKFKKKDQGFLGVVNIRVGDVLGHLDEDTATQ
FT                   TRAKEETITRDLKRSNDGMAVSGRLIIVLSKVAGSGSGSATASANGSSTAAETTASAMG
FT                   NLSLDNSTNVNSSPIANHNSSTMSSSASGTRTVQAASLTPRPTAQAVETTLQSGNQSNP
FT                   AATAAAANVANRQYSSFEDQYGRLPPGWERRTDNFGRTYYVDHNTRTTTWKRPTLEQSE
FT                   QERGSQLTANTELERRQHRGRTLPGNVTDGVTVQVGGTSTTPAINGAAAAAFAATGATT
FT                   SGLGELPSGWEQRFTPEGRAYFVDHNTRTTTWVDPRRQQYIRTYGPTNTTIQQQPVSQL
FT                   GPLPSGWEMRLTNTARVYFVDHNTKTTTWDDPRLPSSLDQNVPQYKRDFRRKVIYFRSQ
FT                   PALRILPGQCHIKVRRNNIFEDAYQEIMRQTPEDLKKRLMIKFDGEEGLDYGGVSREFF
FT                   FLLSHEMFNPFYCLFEYSAHDNYTIQINSNSGINPEHLNYFKFIGRVVGLGVFHRRFLD
FT                   AFFVGALYKMMLRKKVALQDMEGVDADVYNSLKWMLENSIDGVLDLTFSADDERFGEVV
FT                   TVDLKPDGRNIEVTDEVKKEYVELYSQWRIVDRVSEQFKAFMDGFNELIPEDLVTVFDE
FT                   RELELLIGGIAEIDIEDWKKHTDYRGYQESDEVIQWFWKCVSEWDNEQRARLLQFTTGT
FT                   SRIPVNGFKDLQGSDGPRRFTIEKAGEVEQLPKSHTCFNRVDLPPYADYDSMAKKLTLA
FT                   VEETIGFGQE"
FT   CDS_pept        203760..205463
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17443412"
FT                   /gene_name="DSE1"
FT                   /locus_tag="CAGL0K02277g"
FT                   /product="Protein DSE1"
FT                   /biological_process="cell cycle"
FT                   /biological_process="cell division"
FT                   /biological_process="cellular cell wall organization "
FT                   /protein_id="CAG61285.1"
FT                   /db_xref="GO:0007047"
FT                   /db_xref="GO:0007049"
FT                   /db_xref="GO:0051301"
FT                   /db_xref="HOGENOM:HBG123878"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniParc:UPI00003B6BEF"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FN70"
FT                   /transl_table=1
FT                   /translation="MTDYYEPINIFRQCAISVKKRGQEHGLDVATRRVASWQRSAKLNS
FT                   PTLRKVSDDYFLTKKVKSDYWQVSDMDLSATAFSSVGNLVMVTSNKDQDNVKLYTYAED
FT                   PNSMRQLQTITVPGAPITTATLLPAAEFNPTAYVPDHEQLLLTGHRDGIVNLISTSFTK
FT                   GESRIVKRYNHRKHLVSMANEVMNIDTKHKDEIEQLLANHKQKSNSARAMPVRSIKPWN
FT                   GMGFVSLINDSLFVFTLNNTKTPQYLNSFPGIQSFAIQTHSNPYLLGLTGTHFGANNIA
FT                   LLDLKKTLYIPDPVIDKEYRKSSSRSVSSDCTWISSCYLAQALGKEVNIWDVRRTDGKP
FT                   KAKILPNKGVIEHLSYHYETDTLFSSDDQGNIIAWDLTNLDRLEYCGLVHGLDAVKYNM
FT                   NLPINDSNYSQCGNVVVNGNNNSACTYRKLARKIEVNQRAGTLFSYCDHELGLHRLFSA
FT                   PVEISLQLSDTETINYESEEEEVMVHVDKLHDNSHENSSILHSDSTTLHSRDFDSYSDN
FT                   ESANTTDNDNELAYMDTFKRPVPAFLDEKVAAYNNPVLSSSSSTLAYGYF"
FT   CDS_pept        complement(206161..207777)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000182055" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17443413"
FT                   /locus_tag="CAGL0K02299g"
FT                   /product="Similar to uniprot|P39962 Saccharomyces
FT                   cerevisiae YER123w Casein kinase I "
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="CAG61286.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG537393"
FT                   /db_xref="HOGENOM:HBG755340"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI00003B6BF0"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FN69"
FT                   /transl_table=1
FT                   /translation="MSGQRTGSNPRSGYQHVVGMHYAVGPKIGEGSFGVIFEGQNILNS
FT                   SDGRQGHGSGSGSAHGSGNGNGNSLAGFPVAIKFEPRHSDAPQLRDEFRAYRILNGSKG
FT                   IPHAYYFGQEGMHNVLIIDLLGPSLEDLFEWCGRKFSIKTTCMLAKQMIERVRIIHDHD
FT                   LIYRDIKPDNFLISEFQKASNNNGECVKYCAQSAGGDPNLIYMVDFGMAKQYRDPRTKQ
FT                   HIPYRERKSLSGTARYMSINTHFGREQSRRDDLESLGHVFFYFLRGSLPWQGLKAPNNK
FT                   LKYEKIGLTKQKLNPDELLLSNQIPSQFATYLKYTRSLKFDEDPDYDYLISLMDGVLLS
FT                   KGYKDDGHYDWMDLNNGAGWDIRVNKRANLHGYGNAQPRNNNNNNNGAKNNGNTGRQRN
FT                   DSKRTSQQQQVQLAQTAMHSAKNKLATPSKQKEAMSTDKKHLSNLSEHSSDVIYHTLTQ
FT                   PNMNQGYDSMGTQDRRKSQSQHKLQTKRKNSRAHMQYQKGSNNAKDNFFNDQQQRYDSA
FT                   VERYSIKSEKGLCARICCCFF"
FT   CDS_pept        208082..209149
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000190863" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21045940"
FT                   /gene_name="EAF3"
FT                   /locus_tag="CAGL0K02321g"
FT                   /product="Chromatin modification-related protein EAF3 "
FT                   /function="chromatin binding"
FT                   /biological_process="DNA repair"
FT                   /biological_process="chromatin assembly or disassembly "
FT                   /biological_process="chromatin modification"
FT                   /biological_process="regulation of transcription "
FT                   /biological_process="transcription"
FT                   /cellular_component="chromatin"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG61287.1"
FT                   /db_xref="GO:0000785"
FT                   /db_xref="GO:0003682"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006281"
FT                   /db_xref="GO:0006333"
FT                   /db_xref="GO:0006350"
FT                   /db_xref="GO:0016568"
FT                   /db_xref="GO:0045449"
FT                   /db_xref="HOGENOM:HBG396389"
FT                   /db_xref="HOGENOM:HBG525584"
FT                   /db_xref="InterPro:IPR000953"
FT                   /db_xref="InterPro:IPR008676"
FT                   /db_xref="InterPro:IPR016197"
FT                   /db_xref="InterPro:IPR017398"
FT                   /db_xref="UniParc:UPI00003B6BF1"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FN68"
FT                   /transl_table=1
FT                   /translation="MFEVGGKCLAYHGPLLYEAKILRRWNPKLEKVEYSVPLKSGEEDG
FT                   LPESMNREEFYYYIHYQGWKSSWDEWVSVDRIMELTEANIELKKQLVMEAKKASLAQQQ
FT                   KTKNGGSAKRGGGGAHSESNHGGRRSGSGDRRDSNAEERGIVPSEGPFRTSSVMSYNFS
FT                   RNKLRIHIPMILESMLVDDWEIVTKEKKISNLPNPFPVETILDRFYKDVATRTTSPVEL
FT                   SLVEEYVYGLKQYFNEAIGNLLLYKLERLQYEQVFYPTPEQQQAMTPVERSLSGRRPGQ
FT                   LYGVLHLLRLISILPEMLSNCVGMDTQAINVILRHTEKLLLWLVDRIEDLLPHKVHKSY
FT                   YTNTSSQYEGVALGL"
FT   CDS_pept        209474..212962
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000141841" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17443414"
FT                   /locus_tag="CAGL0K02343g"
FT                   /product="Similar to uniprot|Q12139 Saccharomyces
FT                   cerevisiae YPR022c"
FT                   /function="DNA binding"
FT                   /function="zinc ion binding"
FT                   /biological_process="transcription"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG61288.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006350"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG190195"
FT                   /db_xref="HOGENOM:HBG203954"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="UniParc:UPI00003B6BF2"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FN67"
FT                   /transl_table=1
FT                   /translation="MVENHSYNVTPESVSLPSSGGEVHVVRKRSKTVSMVVGEDGQYRY
FT                   KCPHPTCDKSFSRQEHLSRHKLNHWPKEIFKCHYVSPLSGQPCGKTFVRRDLLNRHEKR
FT                   HENKSYTGRKSRSISREITPGITSPVAESPSNPSFQHSETSAYATSSRSNSNSSFTVGK
FT                   FSVTPQEESGNKRKRQRTKSSQKLNETTDSIGPIDPKLLDPSEADRSIYTTPAEKEEDK
FT                   PKTIPVYNNDVLINANNNIEDPNDDTIMTFISKKNARKQQKLVKIAPKPHNSRARPANT
FT                   VIDPAIHQFSYPERKSVDHKFNNESIPAPYNAELLNYGNTIVQEKSQKKRSQSGPDGSN
FT                   VSRDVFDWNSVMADRDDAHQSISNSNSSTNLNKVYDLFSIDFLSDDPLQNFMQELSVGH
FT                   KQGGSMTSAQASTQSTNPVNSPTQDSNCSSNGLRKSEDIHLQAMPKFDDSQKSHIKDNL
FT                   STQKININNFIKKDKEQRILERDSDSKRLHHKKRKNMKLSMRQIPSFFFTDQATKFDIS
FT                   KDKCLELFNLVPELRYIPAIELKKSLKSFWYNFHPQYGLLHKPSFNVNDAPAILILSMI
FT                   MTGASFLGSNAREMVSDPICGPLRWIIFSHPDFQPPSQTYIIQSLLLLEGYEKASTNRY
FT                   LHERSFLHHGTTIQLLRRTPSLGGHPSIVKREGNTTAAKILDDEQGQRDALEEIYRQWI
FT                   DFEMLKRIAFYAFYMDTTHAVVFGYWNLFIHCNQIQLNLPCSDEIWESYDLSYETLLNN
FT                   GFGGEARVENYQFLPTLKSLMNEVTETLRIQKLKAPTSSTPEAVKAAIDSVDKVSGRKW
FT                   NIRSIFGKKLLLAGIISIMFQCQEAVLPTTFRVGDGTDQVFSWTEIVSFAANYWLIKVQ
FT                   GDCTAAKSCMVSCGNDSDILTNSDVTVDEDVIKLDLLGEEADTICKIPVYHVIQIVLRI
FT                   FHNDYYIYAGAPWRMNVRLDKDEYSVVSNRVRKFASDPYNGGVAIVHGFQFLFQMFLKV
FT                   DSSENDGKERTITFKDYDINSDYIITRPNTVALISVLIWCYNNVLFGPESQIWDNSKEE
FT                   DVEASEENTRKNNEAKELYTPKESFEQYLIRMYHSLYIDTNTDVITYQNEIWAKATILG
FT                   TIPNTNNMCGMMLYMRDTYRRSFWDLGREFGNLFDNCLERSMGKSSPTCFNMYDV"
FT   CDS_pept        213531..216290
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000180633" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17443415"
FT                   /locus_tag="CAGL0K02365g"
FT                   /product="Similar to uniprot|Q12482 Saccharomyces
FT                   cerevisiae YPR021c"
FT                   /function="binding"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="mitochondrial inner membrane "
FT                   /protein_id="CAG61289.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0005743"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG058666"
FT                   /db_xref="HOGENOM:HBG203953"
FT                   /db_xref="InterPro:IPR001993"
FT                   /db_xref="InterPro:IPR002067"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="UniParc:UPI00003B6BF3"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FN66"
FT                   /transl_table=1
FT                   /translation="MEQLNSNGRKKLEQVAIFKRFASTIDDTQDDKTASILSFLKSSHG
FT                   DNGIGARTTVERTGHKSTGEMVLMYDDFVRLISNSQQFYSKFSGHTFNLNQVPANTFGC
FT                   IFFAMDENNKGYLTISDWFQLNNILEHENYHLIILYEFFRKFDVEKTNAQLRKSVFGGS
FT                   KYRKQNTLHHSPDSGYGERLPFNTKSINYANKFLSFDELLLNLDQFKETISLLQNCIKN
FT                   DDFVQKNDLILHWDKFDFLKLYQCFHYGKPYLTLNSLVTILQNDLKYEKMITGFRHLAQ
FT                   FDASRHRLSLNKNQLVYLLKLFYSHKVSADIFESLNLSNTKLIKSDNNSIAFNVYRDIF
FT                   YLFQNFDLLNQVFLKYAEDNNMSDRDIREQVITKKNLMDFLNKQYNKVTNISEFSPSQI
FT                   NLLFSIVANSKEYNRHRTRLIQNSQELNHEDSEINHFIHNEFMHGGRNKKEELETFNDN
FT                   YKDIANGFAQDSNIKSISKTSTGWFERVFGGRSDIATMRSDLTVQDFLKILNPNYLNDV
FT                   VHRLELRHIEEESLYTNYYFYPIFDSLYNFSLGSVAGCIGATIVYPIDFVKTRMQAQRS
FT                   LSQYKNSIDCFLKILSREGIRGVYSGLGPQLIGVAPEKAIKLTVNDYMRNKLKDKNGKL
FT                   GLLSEIISGASAGACQVIFTNPLEIVKIRLQVKGEYVAENAENAKLTALQIIKRLGLPG
FT                   LYKGAAACLLRDVPFSAIYFPTYAHLKRDLFNFDPNDKNKRSRLNTWELLSAGALAGMP
FT                   AAYLTTPFDVIKTRLQIDPKKGETIYKGIIHAARTILREESFKSFFKGGAARVLRSSPQ
FT                   FGFTLAAYELFHNIFPLPNDKDKFVISEDDRRAKILNNNARGPNIDKRELTRIVENPYS
FT                   DSYLNYYYKSCQVAKTFIELDNNFAKFDYGTYLKFHEHLRAISRGEDP"
FT   CDS_pept        216795..218492
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000242486" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20197150"
FT                   /gene_name="ROK1"
FT                   /locus_tag="CAGL0K02387g"
FT                   /product="ATP-dependent RNA helicase ROK1 "
FT                   /EC_number="3.6.4.13"
FT                   /function="ATP binding"
FT                   /function="ATP-dependent helicase activity"
FT                   /function="RNA binding"
FT                   /biological_process="rRNA processing"
FT                   /cellular_component="nucleolus"
FT                   /protein_id="CAG61290.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005730"
FT                   /db_xref="GO:0006364"
FT                   /db_xref="GO:0008026"
FT                   /db_xref="HOGENOM:HBG517301"
FT                   /db_xref="HOGENOM:HBG737336"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="UniParc:UPI00003B6BF4"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FN65"
FT                   /transl_table=1
FT                   /translation="MDIFRVLTRGASINKKANQKGKTVDYSTADTDNDKVDNKQVEKQL
FT                   NRELDFFRNKKIVSKVETAKAKLEDSVEDSHQQDNNDDVTEVAYDVKITTKEQASALRK
FT                   SYKGNITGEDIPLPIGSFEDLISRFSLDKRLLNNLIENHFTEPTPIQCEAIPLCLNGRD
FT                   LLACAPTGSGKTLAFLIPLLQQIIEEKNFSGVKGLIISPTKELATQIFNECVKLSKRIY
FT                   LDKKRPLQVAILSKSLGAKLRNKVISDKKYDLIISTPLRLIDVVKNEALDLSNVKHLIF
FT                   DEADKLFDKTFIEQTDDILNSCTDPSMRKSMFSATIPSSVEETANSIMNDPVRVIIGHK
FT                   EAANTNIEQKLIFCGNEEGKLIAIRQLVQQGEFKPPIIIFLESIARAKALYHELMYDRI
FT                   NVDVIHAERTAIQREKIIERFKTGELWCLICTDVLARGIDFKGVNLVINYDVPTTAQAY
FT                   VHRIGRTGRGGRSGKAVTLYTKLDSVAIKPIINVMKQSGCEVEGWMNNISKITKREKEA
FT                   IKKGKSHKERDQISTVPKVERLKRKKKQDMIRASKRRQLESNAIESAD"
FT   CDS_pept        complement(218954..219325)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000246804" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21045941"
FT                   /locus_tag="CAGL0K02409g"
FT                   /product="Strain CBS138 chromosome K complete sequence "
FT                   /function="hydrogen ion transmembrane transporter activity "
FT                   /biological_process="ATP synthesis coupled proton transport"
FT                   /cellular_component="mitochondrial proton-transporting ATP
FT                   synthase complex, coupling factor F(o)"
FT                   /protein_id="CAG61291.1"
FT                   /db_xref="GO:0000276"
FT                   /db_xref="GO:0015078"
FT                   /db_xref="GO:0015986"
FT                   /db_xref="HOGENOM:HBG191494"
FT                   /db_xref="HOGENOM:HBG395565"
FT                   /db_xref="InterPro:IPR006808"
FT                   /db_xref="UniParc:UPI00003B6BF5"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FN64"
FT                   /transl_table=1
FT                   /translation="MIERLQSLANRLVVRGNQLATKSIYYGKVTAEVSKQIYAKEGLKP
FT                   PTVNEFKSTYCKLYKQGLQYFNKPSEIINCAKNIKKPDALKYGSYLVQFLGFYSVGEII
FT                   GRRKFIGYKNYEHNAKAAH"
FT   CDS_pept        complement(219856..222630)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000224127" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18502542"
FT                   /locus_tag="CAGL0K02431g"
FT                   /product="Strain CBS138 chromosome K complete sequence "
FT                   /function="ATP binding"
FT                   /function="DNA binding"
FT                   /biological_process="DNA-dependent DNA replication
FT                   initiation"
FT                   /protein_id="CAG61292.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006270"
FT                   /db_xref="HOGENOM:HBG409874"
FT                   /db_xref="HOGENOM:HBG546212"
FT                   /db_xref="InterPro:IPR001208"
FT                   /db_xref="InterPro:IPR008047"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR016027"
FT                   /db_xref="InterPro:IPR018525"
FT                   /db_xref="UniParc:UPI00003B6BF6"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FN63"
FT                   /transl_table=1
FT                   /translation="MSNNPSSPVMGPIDEGSSSPGRNQPSSMGPNGDPSSPALFFNSSS
FT                   SQPQGDSQPVAPSSPIHFPSSSNRPMSSDVHSQGRRSNRNHLAANRSSALGRFSDYGSD
FT                   RQVLHSSSSNMGGYPSQRTNLRRNDIHASDLSSPRRIVDFDSRSGIQQPSSSSSSMPSE
FT                   ATEPLRIIWGTNVSIQECANSFRNFLMSFKYKYRRVLDGKTDITDDEAEEELYYVKQLN
FT                   EMRELGTSNLNLDARNLLAFKQTEELYYQLLNYPQEVISIMDQTIKDCMVSLVVDNQLE
FT                   HELDEIESKFYKVRPYNVETQKGMRELNPNDIDKLISLKGLVLRATPVIPDMKVAFFKC
FT                   NICDHTMAVEIDRGVIQEPARCERVDCNEANSMTLIHNRCSFADKQVIKLQETPDLVPD
FT                   GQTPHSVSLCVYDELVDSCRAGDRIEVTGTFRSIPIKANSRQRVLKSLYKTYIDVVHVK
FT                   KVSNTRIGVDVSTIEQELLQNKLDNNDVEEVRQISDAEIEKIKQVAQRPDLYDLLARSI
FT                   APSIYELDDVKKGILLQLFGGTNKTFKKGGRYRGDINILLCGDPSTSKSQILQYVHKIA
FT                   PRGVYTSGKGSSAVGLTAYVTRDVDSKQLVLESGALVLSDGGICCIDEFDKMSESTRSV
FT                   LHEVMEQQTISVAKAGIITTLNARSSILASANPIGSRYNPNLPVTENIDLPPPLLSRFD
FT                   LVYIILDKVDESTDRDLAKHLTSLYLEDKPAHVTTDDVLPIDFLTQYINYVKQNVHPLV
FT                   TEQAKNELVKAYVGMRKMGDDSRSDEKRITATTRQLESMIRLSEAHAKMRLSSTVDLED
FT                   VREAVRLMKSAIKDYATDPKTGKIDMNLVQTGKSVIQRKLQEDLAREIIRILKEYPADS
FT                   MSFNELIKQINEQAQDRVEPSQVSSTLSRLQQEDKVIILGEGVRRSVRLNIRV"
FT   CDS_pept        complement(223090..224844)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000996" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18502543"
FT                   /locus_tag="CAGL0K02453g"
FT                   /product="Similar to uniprot|Q12495 Saccharomyces
FT                   cerevisiae YPR018w CAC1"
FT                   /protein_id="CAG61293.1"
FT                   /db_xref="HOGENOM:HBG123729"
FT                   /db_xref="InterPro:IPR022043"
FT                   /db_xref="UniParc:UPI00003B6BF7"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FN62"
FT                   /transl_table=1
FT                   /translation="MTDKNEKGILSFFQNTISAKVKKSSEVIDLDDHHDDDEQQSVEEG
FT                   TQKQLSPMSDGLQKEATLDTSQDDSQSSNGGTASSSQSESRQSEKNRMRELKRVQREAE
FT                   KLRREQLKAEEKLKKEKKKEEERLRREEEKKKREEEKRLKELQREEEKRKREQAKEEER
FT                   KKKEQLRLQKEEEKRQKEEEKRLKEEAKERAQSRIGNFFRKVSDDANKNVSRKTDYEKY
FT                   FLPFYARDGVEIRQPWTMDTQKLQSSIKTLDDLLKDRNQDASTLDPCSWLKERSLDGIG
FT                   YPIKNTAVSLLQQMTAKEKSDEELQTMLSMVPHKYIKFYENVRPPYIGTYSKEFFLPIL
FT                   DPFSTSITDFNYDYDSDLEWVNEEGEEGGVDNLESGEDDDDEEDDDLASEGEFDGFLDT
FT                   ENGDGNSKTGTNGKKFIGPLIPIVQLRSDISTFDEEDRIYFKKLAAVPLTQMETFSIDP
FT                   NYITPSPSPIKSSSASQRDLKRAATDQNSSGLSTPTQSPNKKSKSIITEDQDLLTLLKE
FT                   VQNSTFSLATVSEIIQKNLPKYNKQTIKNTVKEYAVRSSGKGNEPRKWEIKDLEHWENL
FT                   QKAGEHKE"
FT   CDS_pept        225092..225544
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000995" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17443416"
FT                   /locus_tag="CAGL0K02475g"
FT                   /product="Similar to uniprot|P32601 Saccharomyces
FT                   cerevisiae YPR017c exchange factor for SEC4P "
FT                   /function="guanyl-nucleotide exchange factor activity "
FT                   /biological_process="small GTPase mediated signal
FT                   transduction"
FT                   /protein_id="CAG61294.1"
FT                   /db_xref="GO:0005085"
FT                   /db_xref="GO:0007264"
FT                   /db_xref="HOGENOM:HBG123730"
FT                   /db_xref="HOGENOM:HBG203950"
FT                   /db_xref="InterPro:IPR007515"
FT                   /db_xref="InterPro:IPR011057"
FT                   /db_xref="InterPro:IPR011323"
FT                   /db_xref="UniParc:UPI00003B6BF8"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FN61"
FT                   /transl_table=1
FT                   /translation="MASTGKVRKARCQFTECASSLISVPAVDSKTTDRLIYFPGAIMEK
FT                   YKIMETREGADAQKEYEFLVVPEFWDFDNIGVSRDLCQVTEDRDNAEFKFEWDGHTWEL
FT                   IHCQRYLACAECDRGPIGLLCEVQDANDHSSTRKICLLSIASVDCK"
FT   CDS_pept        226058..226795
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000230605" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21045942"
FT                   /locus_tag="CAGL0K02497g"
FT                   /product="Strain CBS138 chromosome K complete sequence "
FT                   /function="ribosome binding"
FT                   /biological_process="mature ribosome assembly"
FT                   /protein_id="CAG61295.1"
FT                   /db_xref="GO:0042256"
FT                   /db_xref="GO:0043022"
FT                   /db_xref="HOGENOM:HBG311487"
FT                   /db_xref="HOGENOM:HBG589638"
FT                   /db_xref="InterPro:IPR002769"
FT                   /db_xref="UniParc:UPI00003B6BF9"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FN60"
FT                   /transl_table=1
FT                   /translation="MATRTQFENSNEVGVFSKLTNTYCLVAVGGSENFYSAFEAELGDS
FT                   IPIAHTTIAGTRIVGRMTAGNRRGLLVPTQTTDQELQHLRNSLPDSVKIQRVEERLSAL
FT                   GNVICCNDYVALVHPDIDRETEELISDVLGVEVFRQTISGNILVGSYCALSNQGGLVHP
FT                   QTTIQDQEELSSLLQVPLVAGTVNRGSAVVGAGMVVNDYLAVTGLDTTAPELSVIESIF
FT                   RLQDAQPDAISGNLRDTLIETYS"
FT   CDS_pept        complement(227541..228185)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19350347"
FT                   /locus_tag="CAGL0K02519g"
FT                   /product="Similar to uniprot|P32488 Saccharomyces
FT                   cerevisiae YMR081c MBR3"
FT                   /protein_id="CAG61296.1"
FT                   /db_xref="HOGENOM:HBG123731"
FT                   /db_xref="UniParc:UPI00003B6BFA"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FN59"
FT                   /transl_table=1
FT                   /translation="MQVGLENIFERSVQDPCCLIEDEMDTYTEFPKYDYSHCQAGQDEL
FT                   HGYTSLRKYNSVPSIPLQHNTQHIIPVSPTQARDHTTRRRSSLYSADPSHTCRRSHSNA
FT                   NILCTPTQNRSKRNSLCSPHSSRPQEGPMRSRSQSVVAIPSHLLSIEKYITSELDTNIS
FT                   PTINPSTKANPPFLSSQSSSDSGSYTSDYTRPPTTRRRSSFKVSLASSFSS"
FT   CDS_pept        complement(230312..231277)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000210451" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19350348"
FT                   /locus_tag="CAGL0K02541g"
FT                   /product="Strain CBS138 chromosome K complete sequence "
FT                   /function="magnesium ion binding"
FT                   /function="ribose phosphate diphosphokinase activity "
FT                   /biological_process="nucleoside metabolic process "
FT                   /biological_process="ribonucleoside monophosphate
FT                   biosynthetic process"
FT                   /protein_id="CAG61297.1"
FT                   /db_xref="GO:0000287"
FT                   /db_xref="GO:0004749"
FT                   /db_xref="GO:0009116"
FT                   /db_xref="GO:0009156"
FT                   /db_xref="HOGENOM:HBG247648"
FT                   /db_xref="HOGENOM:HBG519284"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR000842"
FT                   /db_xref="InterPro:IPR005946"
FT                   /db_xref="UniParc:UPI00003B6BFB"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FN58"
FT                   /transl_table=1
FT                   /translation="MPTNSIKLLAPDVHRGLAKLVAKRLGIELTDCKLKRDPSNEVSFS
FT                   IGESVRDQDIFIITQIGSGTVNDRVLELLIMINASKTASARRITAIIPNFPYARQDRKD
FT                   KSRAPITAKLMADMLTTAGCDHVITMDLHASQIQGFFDIPVDNLYAEPSVVRYIKENVK
FT                   YEDAIIISPDAGGAKRAATLADRLDLNFALIHKERARANEVSRMVLVGDVTDKICIIVD
FT                   DMADTCGTLAKAAEVLLDNGHAKSVIAIVTHGVLSGNAIANINNSRLDRVVCTNTVPFE
FT                   DKMPQCPKLDVIDISSVLAEAIRRLHNGESISYLFKNYPL"
FT   CDS_pept        complement(231812..233572)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000190616" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21045943"
FT                   /locus_tag="CAGL0K02563g"
FT                   /product="Similar to uniprot|P38748 Saccharomyces
FT                   cerevisiae YHL010c"
FT                   /function="zinc ion binding"
FT                   /protein_id="CAG61298.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG142394"
FT                   /db_xref="HOGENOM:HBG604662"
FT                   /db_xref="InterPro:IPR001607"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR011422"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR018957"
FT                   /db_xref="UniParc:UPI00003B6BFC"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FN57"
FT                   /transl_table=1
FT                   /translation="MLHTVNEGTSLTYKLVLEFENREQQSNSYNIFTNHSDQKHSVIHH
FT                   TKNKSSDSFQDWRTSDIMLERVNITKKKNSESDKDIVTSEYLGHGIIKLFKSGTETDKD
FT                   DAETKDIITVPGEDTMVSILFVPTYFTIHDLLHYYIGDEIVNNQVSDFRILRNKQKGFG
FT                   FNFMVLMKFRESTAAKNFKDEFNGKRFSKMDPETCHVAYIKEIIFAKKLFPGDEKKELP
FT                   YLLNDPFTTVRENTNADHDVELPTCPVCLERMDSETTGLITIPCQHTFHCQCLDKWKNS
FT                   KCPVCRLSSFRLSRDTLRKHGNKEKCSECGSSENLWICLICGHVGCGRYNSRHAIKHFE
FT                   ETSHCFAMDSKTDRVWDYAGDNYVHRLVENEVDGKLVESVGRVDDRKAGIGSSFQPSTS
FT                   SNYKDDDDKDLRVNFMRNREYHLEYVEVLISQLESQSEYYEMKMQDTYKMTDEIENLNQ
FT                   KLKDMQKENKNLKEVVDRNDQIKKDLESKIIEDKLIIKGLQENLAFRDEKIESIEQRLK
FT                   DQEEQNKELQDQLKDIMFYLESRDKFDQAPDEVKEGTILVQPGVTTTKSKKKRNKKKVP
FT                   KLPPKIDDIQ"
FT   CDS_pept        complement(233972..235078)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18502544"
FT                   /locus_tag="CAGL0K02585g"
FT                   /product="Strain CBS138 chromosome K complete sequence "
FT                   /function="protein dimerization activity"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="sequence-specific DNA binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /protein_id="CAG61299.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0043565"
FT                   /db_xref="GO:0046983"
FT                   /db_xref="HOGENOM:HBG123732"
FT                   /db_xref="InterPro:IPR004827"
FT                   /db_xref="InterPro:IPR011616"
FT                   /db_xref="UniParc:UPI00003B6BFD"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FN56"
FT                   /transl_table=1
FT                   /translation="MSKDKGKNLAKSRTKATTKVKKVTKGKNNNDNSHENSVTPHGQIS
FT                   PHYLQAYLNSANLTMGTNFLNVPMGTAQVPPPFIQHGNTEMIKTASIPPSGPNASAYSI
FT                   EASVNPHAQSVPPNYFMPPQFAHSTQPIIKHEDGLDAQIMSNTSIDKSETQSQTGTPND
FT                   LEVSFPSISSGNASISGKDKFNEEGLTEDEIKARKKAQNRAAQKAFRERKEARLKELEN
FT                   KLSDIEKNRDLLVNELEDLRRLNMEINEENRILLRKGDTVYKLEPNEVAENGKFSFPSE
FT                   DEFFAQVVLGKYNAEGAKHSNDFEDDANKLLTVPKTWSYLHRLSEEKNFDVLCLMERLK
FT                   GREVSHKNGPAYYKNVIDTLVEEACLEN"
FT   tRNA            complement(235675..235748)
FT                   /gene_name="tRNA-Val (AAC)"
FT   CDS_pept        236721..237842
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000294684" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20197151"
FT                   /locus_tag="CAGL0K02629g"
FT                   /product="Similar to uniprot|P53912 Saccharomyces
FT                   cerevisiae YNL134c"
FT                   /function="oxidoreductase activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAG61300.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG447528"
FT                   /db_xref="HOGENOM:HBG454398"
FT                   /db_xref="InterPro:IPR002085"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI00003B6BFE"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FN55"
FT                   /transl_table=1
FT                   /translation="MSTPQTMQAAVIDGDHLTLKEVPVPELRDGFVLVKNRAVAGNPTD
FT                   WKHITWKIGPQGSIAGCDIAGEIVKLGPNVDTNKFKVGQKVYGFVHGASVKHPDNGGFA
FT                   TYSALDSKIAYTVDDSFEVSGKDQIPEGAIKYYEDVATLPISLTTAGAVLTTNFNINLE
FT                   WQPSEAQRDFPILFWGGATAVGQLLIQVAKKLHGYKKIIAVASKKHEAHLKSYGADDVF
FT                   DYHDADVIEQIKNKYPDIQNLVDCVSNNDTIKQVYAVASETKPATIVQLTTLSINDIPE
FT                   SERKDNKTIVGCLLYCASGEEIPFGAFTLPANPEFREKVIKFIEFISPKVTAGDIHHIP
FT                   VKVYKNGLNDVQQILDDIQYNRNSGEKLVAVLN"
FT   CDS_pept        complement(238200..240083)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094280" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18502545"
FT                   /locus_tag="CAGL0K02651g"
FT                   /product="Similar to uniprot|P38750 Saccharomyces
FT                   cerevisiae YHL008c"
FT                   /function="transporter activity"
FT                   /cellular_component="membrane"
FT                   /protein_id="CAG61301.1"
FT                   /db_xref="GO:0005215"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG059845"
FT                   /db_xref="HOGENOM:HBG398590"
FT                   /db_xref="InterPro:IPR000292"
FT                   /db_xref="UniParc:UPI00003B6BFF"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FN54"
FT                   /transl_table=1
FT                   /translation="MVDDTYYITPHEAALALVATAMKKARITFDALVLNSILGGVVFCS
FT                   GSLLYLAIHCESPELWDKNPGVVNFLGGIVISIGLFYVVILGADLYNSNILYFSVAFLR
FT                   RAVSIWDVLISWSVSWLGNLAGNLFVSYVIIYLSGIGHSEEWKAGTIKIAEQKASFSFI
FT                   QTFLKAIGGNFYVALAIYLQLLAKPLHVKFLAILIPIFTLVCIGLTHVVADEAMLFLGM
FT                   YNGANVSVGKYIWKLLIPATIGNFIGGFVFAAYIPFYLHLVVVERDKEKLSLPEYDERD
FT                   EQPELNVDSRVVRVPRKEAESEKIDDDTEDEDDSTDKDNNEYLSEKGPLNDNSSTATDN
FT                   EVQPYLEQIGPTMSRPASDISINSSESSVQRRYDYEGYRTRSHPNVPVTGGYTTSRSLR
FT                   EVKTTPNLKRRRTLRSPPGVFPVRGMGEPLLREKTIENPYYTKKHKGKILRETAKHIKD
FT                   AHDIGDTHEDNPHTVSNENYLKLVKTIETEEEKDYRSSSGYNVLNNKPGAHLERFMTGM
FT                   IKKTTSRSRGEESNDIDSRMDLSEATTQAVFPHNNISAADSYSSVGEARKTASENLGSL
FT                   FKAVSRPFENPHKRPKNINDIEQQLEEAGISKRAADAANTVGGMENYSDID"
FT   CDS_pept        complement(241338..244085)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000234202" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19350349"
FT                   /gene_name="STE20"
FT                   /locus_tag="CAGL0K02673g"
FT                   /product="Serine/threonine-protein kinase STE20 "
FT                   /EC_number="2.7.11.1"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /biological_process="response to pheromone"
FT                   /cellular_component="cytoplasm"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG61302.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="GO:0019236"
FT                   /db_xref="HOGENOM:HBG203842"
FT                   /db_xref="HOGENOM:HBG537393"
FT                   /db_xref="InterPro:IPR000095"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR015750"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI00003B6C00"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FN53"
FT                   /transl_table=1
FT                   /translation="MSNANQKENVPSLGLPRTHGTLNVNALKATDILKHKGKLNEVNSD
FT                   QSTTNENDEVQEEAVFLDDPVHFTRVSSSSELSAALSVNTTEQEQDEEKGTEHAELEPA
FT                   EEDTVEVDTIRNNGDKTYSTIRESASDFETTNNTLIEISKNSSTYSSTEFLNNNNNGIS
FT                   NSNRATIDSESKLRMNKLREGSSTSLSNDSNGFNGMISSNQASTVLSTPSQKPSSTTNT
FT                   ITKANNGGSTRAQKEKHTSPKLPSTVTAPSSHRKSADLSKTNKLPSTTAKRTPKQAVTS
FT                   SSPKEPAKRKSSTSKMKGMFSSLVQNMKRNSSDNRKSASSLSSVSSSSSSTLKISTPYN
FT                   PKHIYHVGVDARTGEYTGLPEEWERLLASSGISRKEQQQNMQAVIDIVNFYQDVADHTG
FT                   EEKVIKTFDPKKQNPLVRDSLSKYEQVDDNRTSYASGGTPTLEQNGFHTSSTPRSRTSL
FT                   TSPTAGYSMISTPPMATQEKYIPTRPAPKPPGQQTPSSNASLTPKMQNATMSPIKENIS
FT                   SPVTKSEVDDELLLSKKNASLPKLPSDDSSSHKKSATDSAPTSVETDTETVKVPPIPKT
FT                   TPTVPAKASRRSNEKKKEERERNKKLLYAKLTEICSPGDPKSKYRDLIKIGQGASGGVY
FT                   IAHDTESEDSVAIKQMNLEKQPKKELILNEILVMRESKHSNIVNFIDSYLAKGDLWIVM
FT                   EYMEGGSLTDVVTHCLLSEGQIGAVCRETLKGLQFLHSKGVLHRDIKSDNILLSLKGNI
FT                   KLTDFGFCAQINENNLKRTTMVGTPYWMAPEVVSRKEYGPKVDIWSLGIMIIEMIEGEP
FT                   PYLNETPLRALYLIATNGTPKLKEPEALSDTLTKFLDWCLKVDPSERATATELLDDPFI
FT                   TEIAEDNSSLSPLVKLARIKKLEEQEEDAGTDETEPETTPDTTI"
FT   CDS_pept        complement(244992..245459)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000142331" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17443417"
FT                   /locus_tag="CAGL0K02695g"
FT                   /product="Similar to uniprot|P38751 Saccharomyces
FT                   cerevisiae YHL006c"
FT                   /protein_id="CAG61303.1"
FT                   /db_xref="HOGENOM:HBG123734"
FT                   /db_xref="UniParc:UPI00003B6C01"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FN52"
FT                   /transl_table=1
FT                   /translation="MVLEVVRNLLDEDINCASRRKSLIIVLGYDARSKLESLKNYKDEP
FT                   LTVNSILRSRRDVHVLFLNSLQYIFMYLIKLEVQPDSHTHLVIYGLDSLINEMCQEDSL
FT                   DLNQVRAANLIFQTAYRVSRQNQLQEVLFIAYDQKKWDKLEPLRKYWQEVC"
FT   CDS_pept        245911..247104
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000248605" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17443418"
FT                   /locus_tag="CAGL0K02717g"
FT                   /product="Similar to uniprot|P32902 Saccharomyces
FT                   cerevisiae YHL004w MRP4"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="small ribosomal subunit"
FT                   /protein_id="CAG61304.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="GO:0015935"
FT                   /db_xref="HOGENOM:HBG058162"
FT                   /db_xref="HOGENOM:HBG397638"
FT                   /db_xref="InterPro:IPR001865"
FT                   /db_xref="InterPro:IPR005706"
FT                   /db_xref="InterPro:IPR018130"
FT                   /db_xref="UniParc:UPI00003B6C02"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FN51"
FT                   /transl_table=1
FT                   /translation="MSLRALRGFLIGTRNLPLRGIRYQSTSTGTSNNVDVNENTDDLYL
FT                   MKQQELNNVVVQQLKEFSKMSQAEIDNYLNNSKGAEPTEKEQLLEQELRNLFQKYSQDN
FT                   QLLGGLDTAEEGHSRAVEEILQTKRFPFLVPSASDKPYSPQELYLRQAHHGSHVAKLGA
FT                   RVEQVFSPNRDIYTPPTPEKMSIEKLMAAGVHLGQSTSLWRSSTQPFIYGEYNGIHIID
FT                   LNQTLAYLKRAAQVVEGVAERGGVILFLGTRKGQKVALEEAAKRTHGYFVSTRWIPGTL
FT                   TNSTEISGGWEKHEVDLQDKPTGRPLQTDEKSRIVKPDLLVVLNPTENRNALNEAMKSR
FT                   VPTIGIVDTDSEPSFLTYPIPGNDDSLRSVNLLLGVLAKAGERGVKNRIRKASEMKQ"
FT   CDS_pept        complement(247481..248776)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000216359" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21045944"
FT                   /locus_tag="CAGL0K02739g"
FT                   /product="Strain CBS138 chromosome K complete sequence "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAG61305.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG058582"
FT                   /db_xref="HOGENOM:HBG738741"
FT                   /db_xref="InterPro:IPR006634"
FT                   /db_xref="InterPro:IPR013599"
FT                   /db_xref="InterPro:IPR016439"
FT                   /db_xref="UniParc:UPI00003B6C03"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FN50"
FT                   /transl_table=1
FT                   /translation="MKDTYAEKGESPALNRRQNLTVKTRDRRSSSVGRIDLGDTVPSIS
FT                   TMNETKYSKLEAKRRKRALMGSDENDLDLMRKLWYSYREVNYRHSWVTPLLILFSVYSA
FT                   YLTSGNRTETNPLHMFVAISYRIGDTDRYGKGIKDLAFIFYHMIFFTFLREFLMDVVIR
FT                   PITRILNITSRHKVKRMMEQMYALFYCGCSGPFGLYIMYHSDLWLFKTKEMYNSYPDFT
FT                   NPFLYKVFYLGQAAFWSQQACVLVLQLERPRKDYKELVFHHIVTLLLIWSSYVFHFTKM
FT                   GLSIYITMDISDFFLSLSKILNYLDSIFTPPVFLVFVGSWIYLRHVVNIRILWSVLTEF
FT                   KTEGNYVLNFATSQYKCWISQPIVFVLIFALQLVNLYWLFLIFKILLRLIFKGEQKDER
FT                   SDSESDESTMPGTPADDNITICINESSKEKDE"
FT   CDS_pept        249893..251245
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000094361" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17443419"
FT                   /gene_name="HSE1"
FT                   /locus_tag="CAGL0K02761g"
FT                   /product="Class E vacuolar protein-sorting machinery
FT                   protein HSE1"
FT                   /biological_process="intracellular protein transport "
FT                   /cellular_component="endosome membrane"
FT                   /protein_id="CAG61306.1"
FT                   /db_xref="GO:0006886"
FT                   /db_xref="GO:0010008"
FT                   /db_xref="HOGENOM:HBG525065"
FT                   /db_xref="HOGENOM:HBG735279"
FT                   /db_xref="HSSP:1OEB"
FT                   /db_xref="InterPro:IPR000108"
FT                   /db_xref="InterPro:IPR001452"
FT                   /db_xref="InterPro:IPR002014"
FT                   /db_xref="InterPro:IPR003903"
FT                   /db_xref="InterPro:IPR008942"
FT                   /db_xref="UniParc:UPI00003B6C04"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FN49"
FT                   /transl_table=1
FT                   /translation="MPSLEVKLRKAVLAATDGKLRSDNWQYIIGVCDLVKEDPEDASQI
FT                   VMEMIEKRLGQNDANVMLRSLALVVALAENCGSRLKQQVSSKHFTGILAQLLESGDVHM
FT                   TVKKEIAKVVKQLSDSFKSDPSLKTMGDLNTRIRRKWPGLLEEPEKPSKQKVSHQEATD
FT                   EDQELQRALKMSLEEFEKSKQQSNGSAVQSNSLQDHNQGQQQPQQQTTSGIRRVRALYD
FT                   LNANEQDELSFRKGDVIVVLEQVYRDWWRGSLHGKIGIFPLNYVTPITEPSPVESQREQ
FT                   QIEEGVLSQAQNVQVLSAKMQMASGKGLSELNQDPEFNDLYSTVTPIRPHVTKLIGKYA
FT                   KEKDDVIALRQVLLNAESTYNELLDRAAKSYSIPNTQAPPYAPAVTSQPGYVSNNTYQT
FT                   TNGQYTQHNITPQQQYQVPSQNYQSQPPSMQSNHYIGYQHPGINDQPPPNY"
FT   CDS_pept        251638..252426
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000036539" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18502546"
FT                   /gene_name="CAP1"
FT                   /locus_tag="CAGL0K02783g"
FT                   /product="F-actin-capping protein subunit alpha "
FT                   /function="actin binding"
FT                   /biological_process="actin cytoskeleton organization "
FT                   /biological_process="actin filament capping"
FT                   /cellular_component="F-actin capping protein complex "
FT                   /protein_id="CAG61307.1"
FT                   /db_xref="GO:0003779"
FT                   /db_xref="GO:0008290"
FT                   /db_xref="GO:0030036"
FT                   /db_xref="GO:0051693"
FT                   /db_xref="HOGENOM:HBG352343"
FT                   /db_xref="HOGENOM:HBG397839"
FT                   /db_xref="InterPro:IPR002189"
FT                   /db_xref="InterPro:IPR017865"
FT                   /db_xref="UniParc:UPI00003B6C05"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FN48"
FT                   /transl_table=1
FT                   /translation="MSNDFDTIIKNIIKDSPAGELEEVYQDLITIAGENSKETIIDAIA
FT                   EYNVENSIPIDVDGKDVIISKYNKQGTKFVDPVNGIQFSVDHLHQKGLDVEEYSADIDA
FT                   DQKKAITDLGNYLSTNFPGRATFAVLPLEEQSKTAIIIVSTKYNPSNFWNGHWKSEYVY
FT                   DKTEGKLSGTIDIDVHYYEDGNVKFHSSKLVEETNIKDPVASIKELEHKFEQDLQESFT
FT                   DLNEKQFKSLRRRLPITRARVNWGKAIGNYRLGRDAAQGK"
FT   CDS_pept        253188..254438
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000196614" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17443420"
FT                   /gene_name="IPC1"
FT                   /locus_tag="CAGL0K02805g"
FT                   /product="Inositolphosphorylceramide synthase "
FT                   /function="catalytic activity"
FT                   /cellular_component="membrane"
FT                   /protein_id="CAG61308.1"
FT                   /db_xref="EMBL:AAD28745.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG058159"
FT                   /db_xref="HOGENOM:HBG397262"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR016118"
FT                   /db_xref="UniParc:UPI000006A36E"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Y797"
FT                   /transl_table=1
FT                   /translation="MRLGRWFAILSSKLCSDTDVTKLERSLDVRVTLRRLRSYRPTIGD
FT                   TVHYSFLSMILLYSYFANPLPFIVKTLIAMILMTLFVVPMTSQFFFNALPILTWLILYF
FT                   TSSHIPNSHRPSISVEVLPAIETILYGDNLSEILAAWQNTILDILAWIPYGLFHFGAPF
FT                   VVAIVLFIFGPPTVLQGYAFAFGYVNLFGVLFQNIFPAAAPWYKIHYGLQVANYSIKGM
FT                   PGGLSRIDDLLGVNLYSSGFKNSAVVFGAFPSLHSACATMEALFFSYCFPSLTPLFIFY
FT                   VWWLWWSTMYLTHHYFVDLTAGSVLAYFIFQYTKYTHLPIVDPNLLFRWSYDSIEFYDV
FT                   KNNDPLSITNNDIESIPLNTIELDTEEVFNIEREKSRTPELSHAVSSSSLANGRSQTYP
FT                   NTGNTFKSKTRLSKLVI"
FT   CDS_pept        255258..255719
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000177218" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17443421"
FT                   /locus_tag="CAGL0K02827g"
FT                   /product="Similar to uniprot|P36108 Saccharomyces
FT                   cerevisiae YKL002w"
FT                   /biological_process="protein transport"
FT                   /protein_id="CAG61309.1"
FT                   /db_xref="GO:0015031"
FT                   /db_xref="HOGENOM:HBG202451"
FT                   /db_xref="HOGENOM:HBG464741"
FT                   /db_xref="InterPro:IPR005024"
FT                   /db_xref="UniParc:UPI00003B6C06"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FN46"
FT                   /transl_table=1
FT                   /translation="MKAQLQAISLRIQAVRSSDQMTRSMREATGLLAGMNRSMNLPQLQ
FT                   KISMEFEKQSDLMDQRQEFMDEAIDNVMGDELEENEDADEIVNKVLDEIGIDLNSQLQN
FT                   TPQHELKLPGEAESQNGVAETVGASGSGGDTKMSPDDDLQARLDSLKRQ"
FT   CDS_pept        complement(256016..257362)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000233871" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17443422"
FT                   /locus_tag="CAGL0K02849g"
FT                   /product="Similar to uniprot|P38755 Saccharomyces
FT                   cerevisiae YHR001w OSH7"
FT                   /biological_process="steroid metabolic process "
FT                   /protein_id="CAG61310.1"
FT                   /db_xref="GO:0008202"
FT                   /db_xref="HOGENOM:HBG052619"
FT                   /db_xref="HOGENOM:HBG332907"
FT                   /db_xref="InterPro:IPR000648"
FT                   /db_xref="InterPro:IPR018494"
FT                   /db_xref="UniParc:UPI00003B6C07"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FN45"
FT                   /transl_table=1
FT                   /translation="MKDSLKIKGNSASHSSTSLSESMSKVSISSKSNENIDTDDIDEND
FT                   ESGQNILLSIIAQLKPGCDLSKITLPTFILEKKSMLERITNQLQFPDIVLDAHQEKDEL
FT                   QRFVKIVKWYLAGWHIAPKAVKKPLNPVLGEHFTCYWDLPNKQQAFYIAEQTCHHPPES
FT                   AYFYMIPESNIRVDGVVIPKSRFLGNSSAAIMAGETILQFLDMKDKDGKPEKYTLSQPN
FT                   IYARGILFGKMRMEVGDHMIIKGPKYEVDVEFKTKGFISGTYDAIEGVIKDKKGKEYYQ
FT                   ISGKWNDIMYIKDLREKHAKKTVLFDTHKNKPLKPKVRPLEEQGEYESRRLWKKVTDAL
FT                   AVRDHEVATEEKFKIEDYQRQLRKKRLEDGVEFHPKLFRKANPGDDIDHYIYKHIPEGD
FT                   DYEAQIKSILEIAPILPGQKFTEKFAIPAFKKHEIQEKSMSQLSLHKAK"
FT   CDS_pept        join(258618..258626,258815..259042)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000163401" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20197152"
FT                   /locus_tag="CAGL0K02893g"
FT                   /product="Strain CBS138 chromosome K complete sequence "
FT                   /protein_id="CAG61311.1"
FT                   /db_xref="HOGENOM:HBG059856"
FT                   /db_xref="HOGENOM:HBG395929"
FT                   /db_xref="InterPro:IPR019182"
FT                   /db_xref="UniParc:UPI00003B6C08"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FN44"
FT                   /transl_table=1
FT                   /translation="MVSYISRLAAAPGLHFGKISFKNLLNYSPNLMVWGATSFAGILVF
FT                   VEGWPLFQQTLFQKIPVFGSHWIKEIPPEDKSN"
FT   CDS_pept        259855..260883
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000165726" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19350350"
FT                   /locus_tag="CAGL0K02915g"
FT                   /product="Similar to uniprot|P38702 Saccharomyces
FT                   cerevisiae YHR002w LEU5"
FT                   /function="binding"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="mitochondrial inner membrane "
FT                   /protein_id="CAG61312.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0005743"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG541806"
FT                   /db_xref="HOGENOM:HBG735918"
FT                   /db_xref="InterPro:IPR001993"
FT                   /db_xref="InterPro:IPR002067"
FT                   /db_xref="InterPro:IPR002167"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="UniParc:UPI00003B6C09"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FN43"
FT                   /transl_table=1
FT                   /translation="MTKTNNRQAVDKNSLDYVVRSGLAGGVSGSCAKTLIAPLDRIKIL
FT                   FQTSNPHYSKYAGSLVGLYEAAKHIWINDGIRGFFQGHSVTLLRIFPYAAVKFVAYEQI
FT                   RSILIPSREYESHWRRLASGSLAGLCSVFITYPLDLTRVRLAYVTEHKRVKLRDIVKTI
FT                   YHEPASEGLTSHLLVPKWFAHWCNFYRGYVPTVLGMIPYAGVSFFAHDLIHDIMKSSLM
FT                   APYAVKQLSSQEELERKKLRQKTPLRTWAELVAGGLSGILSQTAAYPLEIIRRRLQVST
FT                   LSPRKMYDHKFQSISSIARIIYQEKGWRGFFVGLSIGYIKVTPMVACSFFVYERMKWHL
FT                   GI"
FT   CDS_pept        complement(261102..262418)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000174058" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21045945"
FT                   /locus_tag="CAGL0K02937g"
FT                   /product="Strain CBS138 chromosome K complete sequence "
FT                   /function="binding"
FT                   /function="catalytic activity"
FT                   /protein_id="CAG61313.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG072594"
FT                   /db_xref="HOGENOM:HBG621057"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR009036"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI00003B6C0A"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FN42"
FT                   /transl_table=1
FT                   /translation="MGKDHWKLVAVTAAVTITLTKIAEVAWKKYVEQKDAITQQVSVKK
FT                   MLKREYDDNLFREQLARNYAFLGEDGMEKLKNQYIVVVGAGGVGSWVVTMLIRSGCKKI
FT                   RVIDFDQVSLSSLNRHSCATLEDVGASKVDCLKAHMEKIAPWCQIEAINSLWNKENGEE
FT                   LLLGGGKPTMVVDCIDNIDTKVDLLEFTYSNKIEVISSMGASTKSDPTRINVGDITITE
FT                   EDPLARAVRRRLKIKGITTGINVVFSAEKPDPRKAKLLPLPDDEYSKGKVGELSALKDF
FT                   RVRILPVLGTMPGIFGLTIATWILTKVSGYPMNPIEGKNRIKVYDGIYQSLAGQMTRIG
FT                   MPDQRVPIALKEVGYIVEEVFRGKSPVSGFSTRLTLSKWDPKKPVSLQNVVVLTKEEQK
FT                   EHEQRILNGKEALSDVYSQDVIDLVNQRFEEELYYSRYR"
FT   CDS_pept        complement(262936..264330)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000246647" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20197153"
FT                   /locus_tag="CAGL0K02959g"
FT                   /product="Similar to uniprot|P38757 Saccharomyces
FT                   cerevisiae YHR004c"
FT                   /function="phosphatase activity"
FT                   /protein_id="CAG61314.1"
FT                   /db_xref="GO:0016791"
FT                   /db_xref="HOGENOM:HBG059851"
FT                   /db_xref="HOGENOM:HBG397156"
FT                   /db_xref="InterPro:IPR004274"
FT                   /db_xref="InterPro:IPR011948"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniParc:UPI00003B6C0B"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FN41"
FT                   /transl_table=1
FT                   /translation="MNALSYVYEYLVLPIDHFKVKKNRKEQLVDSKHVVDNEEHTNQDT
FT                   EGNDKCLNTKAQIRVNDDSVLKLRKVNPLIQDKDGAQKDRDSKTRNVSNNKIEIKPVSD
FT                   EDEEKDIDGQMSRGLKFFIVVWSIITFFPNYILIKPTLFVWFILTFPLSLIEHSVRRRG
FT                   KATENEHLSQSPATNKDNSPSKRLNVIEEAIEDDLISGEVMELQKDALKGSLLPTNKDS
FT                   SQNSSQKDRGKKTTSTPSHTSNILGTKSMGRFQFPKKLIPRSILYSEKKKTLVIDLDET
FT                   LIHSVSRGTTHSNSSQAHIIEVRFAISGVSTLYYVHKRPYCDLFLSKVCKWYNLIIFTA
FT                   SMKEYADPVIDWLESSFSGSFTQRMYRNHCIARDGVGYIKDLGNIKDPYSKNATIPLTD
FT                   VVIIDNSPVSYAMHVDNAIQVEGWISDPTDTELLNLLPFLEALRYTTDVRNVLALKNSE
FT                   KAFQLS"
FT   CDS_pept        265614..266450
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17443423"
FT                   /locus_tag="CAGL0K02981g"
FT                   /product="Similar to uniprot|Q04751 Saccharomyces
FT                   cerevisiae YMR069w"
FT                   /function="N-acetyltransferase activity"
FT                   /protein_id="CAG61315.1"
FT                   /db_xref="GO:0008080"
FT                   /db_xref="HOGENOM:HBG123735"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniParc:UPI00003B6C0C"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FN40"
FT                   /transl_table=1
FT                   /translation="MTNNELYGTNVNDSFLHHVLDCFPKVITTKSNLPKDIEDVQLQRK
FT                   VLVIDGDDYCLANKALTNEVVLRSKHIKESKNILSSLLELLDQNLGQKYEISSKEMYGN
FT                   KKPWKENKIEEMNTEGMIYVSYWTKVDDEHTVPLLFLSFMLTEEENLTHNDPVSSVIFL
FT                   YEIQISKELRKQGLGQYFLSNCLFQCAKRLLDNDSLNLEFPFAGIELTVFADNLPAINL
FT                   YQKLGMTHTPESPKDVLYDQNTRRRTRNSRKINNKNESPRILIKKPLYYMYWKPIL"
FT   CDS_pept        277585..279528
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21045946"
FT                   /locus_tag="CAGL0K03003g"
FT                   /product="Similar to uniprot|P54785 Saccharomyces
FT                   cerevisiae YMR070w MOT3"
FT                   /function="nucleic acid binding"
FT                   /function="zinc ion binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAG61316.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG123736"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="UniParc:UPI00003B6C0D"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FN39"
FT                   /transl_table=1
FT                   /translation="MKDGASEDCNPSSAVEEDRGRHAAPINHLGSSNKANEIAVADREH
FT                   TFSIRKLYPISENVSRVKSQQQEVPYQRNLPTINGTETESARQNLQHAFDKYSKNNNLT
FT                   PKAVQPALNQGVRYIWTKTNPVPRVGNSTVSLSNSSEGSSGAMVNNNDHALDNALNTSV
FT                   TKGQNDPRLSHILSSSNGNIDTTVAKHSLRKEEKSSLEISNNFDHQAQAPKGLDLSAVD
FT                   TTSQPGLYTTTGSQVHPVTQHYQYNGSKMPYDWSNSLRQRIGNSNTAGQVYFVGTPPDA
FT                   PNRSHDYTHLYANTAPLPQGVSYVWHAHGPPFLASNSNTTESYSGSTLVAATTNQAKIA
FT                   SPSVSYGNNTHPENTPRLSVSNIHQLTPNQKGASFQRPLQSILPIIPSHTQSKFANVKL
FT                   DQDKQTNFGNQIMFNSSENTPPLAHQVVYADNRLGSVPNNAISYNADASRAPIGPPIGS
FT                   AGVYYNPNYTYVMQEQPKTVSDNVVSRINSHPILGQTNYLLPRADPSLTTQLGVTNEMM
FT                   FGNQGEKIEVSSLAFPHRCHLCPKLFKRKSWLKRHLLSHSQQRHFLCPWCNSRHKRRDN
FT                   LLQHMKLKHVPNLLQEINSRNMRFNWPILERLSKQIDGTIEYPDTKTLIHEGLLNKDEL
FT                   KNILNTVIDKHN"
FT   CDS_pept        complement(283076..283579)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000066042" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20197154"
FT                   /gene_name="TVP18"
FT                   /locus_tag="CAGL0K03025g"
FT                   /product="Golgi apparatus membrane protein TVP18 "
FT                   /cellular_component="Golgi membrane"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAG61317.1"
FT                   /db_xref="GO:0000139"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG053911"
FT                   /db_xref="HOGENOM:HBG395726"
FT                   /db_xref="InterPro:IPR019365"
FT                   /db_xref="UniParc:UPI00003B6C0E"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FN38"
FT                   /transl_table=1
FT                   /translation="MALGITQFINIAGLLKDLKSFNFSVYGKWFGYINIFLCIALGIAN
FT                   LFHVSAVIAFGIVGIVQGLIILFIEIPFLLKICPLSDRFIEFIKRFETNGYRCIFYTLM
FT                   AIVQYCSLAVMTTSLLVLGITLTISAVSYGIAFTKHQEFANTNIIKNPTDEDFPHDAVV
FT                   REML"
FT   CDS_pept        284084..284689
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17443424"
FT                   /locus_tag="CAGL0K03047g"
FT                   /product="Similar to uniprot|Q02486 Saccharomyces
FT                   cerevisiae YMR072w"
FT                   /function="DNA binding"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG61318.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="HOGENOM:HBG123737"
FT                   /db_xref="InterPro:IPR000910"
FT                   /db_xref="InterPro:IPR009071"
FT                   /db_xref="UniParc:UPI00003B6C0F"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FN37"
FT                   /transl_table=1
FT                   /translation="MLALNLIRGVSRSAGVRFLQTSPIVWSKTAEGAKGKDKDAKSGVS
FT                   RKDLIKQFGPKRPAAAFILYTVQERANATAENPGLSTKEISAVLGEKWRQLSEYEKEPY
FT                   FQKTQQALEEYKTKKQEFEAMLPPKKPLSPFLLFSNEVREEIKSQNPSLSFGDLASLIG
FT                   RRWKSLGEYEKKKYYDRYAENKSSWEQEVQRKLQNFKL"
FT   CDS_pept        complement(285190..285774)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000012418" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20197155"
FT                   /locus_tag="CAGL0K03069g"
FT                   /product="Similar to uniprot|Q04772 Saccharomyces
FT                   cerevisiae YMR073c"
FT                   /function="heme binding"
FT                   /protein_id="CAG61319.1"
FT                   /db_xref="GO:0020037"
FT                   /db_xref="HOGENOM:HBG142664"
FT                   /db_xref="HOGENOM:HBG395445"
FT                   /db_xref="InterPro:IPR001199"
FT                   /db_xref="InterPro:IPR018506"
FT                   /db_xref="UniParc:UPI00003B6C10"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FN36"
FT                   /transl_table=1
FT                   /translation="MQMERDKMAFKVPQMKPPQINVSDEPRSVLMDVPVQASCSTLRAG
FT                   GYRNKVKLAPGHSALDWQEMVSTKGKAGKLITGIDSIREDPKVLEHFKEVNSPQSLIQL
FT                   ERGVPTYAIRPPLCIDAHELARHNTAEDCWTVINGKVYSISSYLSFHPGGAKILIDKSS
FT                   GQDSTVLFNRYHRWISVEKMLETCLVGVYVG"
FT   CDS_pept        complement(286946..287335)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000194121" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18502547"
FT                   /locus_tag="CAGL0K03091g"
FT                   /product="Similar to uniprot|Q04773 Saccharomyces
FT                   cerevisiae YMR074c"
FT                   /function="DNA binding"
FT                   /protein_id="CAG61320.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="HOGENOM:HBG411861"
FT                   /db_xref="InterPro:IPR002836"
FT                   /db_xref="UniParc:UPI00003B6C11"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FN35"
FT                   /transl_table=1
FT                   /translation="MDAELQALREARLAELKRGTSDSNGGSNGGAPQERIGSSISRFLE
FT                   PEALERLSRVSLVRPDRAQAVENYLKQLVSTGQLRNKVSEKDIVQILDGVAREQNKKNE
FT                   TKIIFDRRETVEDDVELEDDDDFFD"
FT   CDS_pept        287882..289165
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000087628" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19350351"
FT                   /locus_tag="CAGL0K03113g"
FT                   /product="Similar to uniprot|P38746 Saccharomyces
FT                   cerevisiae YHL014c"
FT                   /function="GTP binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAG61321.1"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="HOGENOM:HBG489518"
FT                   /db_xref="HOGENOM:HBG586249"
FT                   /db_xref="InterPro:IPR002917"
FT                   /db_xref="InterPro:IPR004396"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR013029"
FT                   /db_xref="InterPro:IPR023192"
FT                   /db_xref="UniParc:UPI00003B6C12"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FN34"
FT                   /transl_table=1
FT                   /translation="MKPTTNKKAKMKLPNILDALKVTNNPTSGIVGLANVGKSTFFQTI
FT                   TNSHLGTAANYPYATIDPEVAKVPIPSPELPVLQKLYQSGKVIPAALTIYDIAGLTRGA
FT                   SEGHGLGNKFLSDIRHVDGIFNLVRGFKDENITHIEGNVDPVRDLSVVQDELILKDLEF
FT                   IDNVREKASRKLRMLSKNSKEYQEYNFEIELLGKLEEHLYDGKRISNFKNEDEKWNVDE
FT                   IKVLRRNNFLTAKPSLTLLNVSPEEYLQLHSQNTLENAAFSKEVTEWLKEYSPNDDLIY
FT                   FSAEYEKNYLEYTKNNDKSGLAQYCKNVAGTDINTSDKRTALPDIILRMKHLLGLISFY
FT                   TCGPLEVRQWNIRRGNNAQEAAGVIHTDLQETFISADIINYESLRDIEPPLDESYLKKK
FT                   GLIKRVGKQYIMEENDIALFKAAGGKTR"
FT   CDS_pept        complement(289619..289978)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000270245" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18502548"
FT                   /locus_tag="CAGL0K03135g"
FT                   /product="Similar to uniprot|P38701 Saccharomyces
FT                   cerevisiae YHL015w URP2"
FT                   /function="RNA binding"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="small ribosomal subunit"
FT                   /protein_id="CAG61322.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="GO:0015935"
FT                   /db_xref="HOGENOM:HBG236852"
FT                   /db_xref="HOGENOM:HBG317444"
FT                   /db_xref="InterPro:IPR001848"
FT                   /db_xref="InterPro:IPR005729"
FT                   /db_xref="InterPro:IPR018268"
FT                   /db_xref="UniParc:UPI00003B6C13"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FN33"
FT                   /transl_table=1
FT                   /translation="MSDIQKDKVQEQEAPQIIKIRMTLTSTKVKQLENVSANIIRNAEQ
FT                   NNLVKKGPVRLPTKVLRISTRKTPNGEGSKTWETYEMRIHKRYIDFEAPVSIVKRITQI
FT                   TIEPGVDVEVVVASN"
FT   CDS_pept        291381..293555
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000106394" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18502549"
FT                   /locus_tag="CAGL0K03157g"
FT                   /product="Similar to uniprot|P33413 Saccharomyces
FT                   cerevisiae YHL016c Urea active transporter "
FT                   /function="transporter activity"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="membrane"
FT                   /protein_id="CAG61323.1"
FT                   /db_xref="GO:0005215"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG051317"
FT                   /db_xref="HOGENOM:HBG397209"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR019900"
FT                   /db_xref="UniParc:UPI00003B6C14"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FN32"
FT                   /transl_table=1
FT                   /translation="MGEFKAPLPQGAGYAIVLGLGTVFAVGMILTTYMLRRYQKEIITA
FT                   EEFTTAGRTVKTGLVAAAVVSSWIWCSTLLTSASKQLDGMLGGYSYSAGACFQIVAFAI
FT                   LAIKTKQKAPNAHTYLELVRKRYGKIGHCCYLFYAFATNILVTAMLLTSGAAVFESMTG
FT                   MNSVASCFLLPVGVVIYTLFGGIKATFLTDFIHTCVIIVIIMVFAFKVYATSDVLGSPG
FT                   KVYDLVREAAKRHPVPHNAQGEYLTMSSRSGGIFLIINLVGNFGTVFLDNGYWNKAISA
FT                   SPAAALPGYVMGGLAWFAVPALLSVTMGFACLATETLKSFPTYPDPLTPEQVSAGLVLP
FT                   AAAVSVMGKGGAVATCLMVFMAVTSAMSAELIAVSSVFTYDIYRIYINPSADGKRLIYS
FT                   SHFACVVFGLCMSGFSVGLYYAGVNLGYLYELMGIIISSAVLPVVLTLCWKGQNIIAAV
FT                   VSPILGTALAIMSWLVCTKSLYGEITLATSFEDYPMLTGNLVALLSPAIFIPILTFLFK
FT                   PQNYDMELFKEISRVDETKEILEAYPEIEPIISKTQIAHESEGSLIESDYNKEDEKDAV
FT                   THIKTTEKHELDRIDTENLSEYDAQEEKKLKRALNWAYFLCIFFALAFLVVWPMPMYGT
FT                   KYIFSKRFFTGWVVVMIIWIFISAFCVCVFPVWEGRHGIYTTCRGIYWDLTGQSYKLKE
FT                   WQETNPSELHVVQSQKSIRPKISRIDDLIE"
FT   CDS_pept        complement(293765..295462)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000176489" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17444485"
FT                   /locus_tag="CAGL0K03179g"
FT                   /product="Similar to uniprot|P32857 Saccharomyces
FT                   cerevisiae YKL039w PTM1"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAG61324.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG058182"
FT                   /db_xref="HOGENOM:HBG327762"
FT                   /db_xref="InterPro:IPR009637"
FT                   /db_xref="UniParc:UPI00003B6C15"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FN31"
FT                   /transl_table=1
FT                   /translation="MISTLPWTYWFLLFLAVLTVVRSPFVEANKKHVNDRMRVVCSGMY
FT                   SKEARGGKVDPFIGFDLEKLYPTQHDYEPGVIAVIYDFRDYQHIGIELPNGEVQYVCDE
FT                   YSIGKGLCKESQLNHFIIQDVIYDPFSDSTKGLSNEVLTFSHNYLGKHQSVYPVMKTGY
FT                   YCVRTATISSSIRFDVAINFRNAFGKIDAAEIDNIRLYGWLSLGYLVSMSMYFFQLWKN
FT                   KDDLLPLHRYIMIFFSFLTIETVSIWIYYLLKNEKGNITPTKVYMVFISLMSAGKASFT
FT                   YFLLLIIALGYGIVYARLNKTLVNRCRAFAILNFFLYSAYLIQSYAQNPESTSITILIT
FT                   AVPTVLLMFVFFFLILRAITKTTSYLKGQRQTYKLSVYNRLLIVIYATLVCIFIGLILC
FT                   AFAYLGMNAIEIIEKHWMIRFYLTDFWPSLVYFFAFISFAYIWRPTGTTFMLTTSQQQP
FT                   EELENVMGLEMDDLDEFSDEFDMDDYAESETSEHRVHGINEAERQNIDDIFANNEPNMD
FT                   DVFSDQNELQDTDVISNFSGHNSDEDLVPNASNTKQSINDIANPKTRK"
FT   CDS_pept        complement(295826..296152)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000007680" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17444486"
FT                   /locus_tag="CAGL0K03201g"
FT                   /product="Similar to uniprot|P38744 Saccharomyces
FT                   cerevisiae YHL018w"
FT                   /function="4-alpha-hydroxytetrahydrobiopterin dehydratase
FT                   activity"
FT                   /biological_process="tetrahydrobiopterin biosynthetic
FT                   process"
FT                   /protein_id="CAG61325.1"
FT                   /db_xref="GO:0006729"
FT                   /db_xref="GO:0008124"
FT                   /db_xref="HOGENOM:HBG203837"
FT                   /db_xref="HOGENOM:HBG398968"
FT                   /db_xref="InterPro:IPR001533"
FT                   /db_xref="UniParc:UPI00003B6C16"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FN30"
FT                   /transl_table=1
FT                   /translation="MFNKIVKSEAERVSAADLQKALKQLKGWTHDNSRLVREVAFKDYQ
FT                   LTWAFLTQVAMRSHLWGHHPLITTSYTSVRLELQTHDLEMSPGVSNIDVKLAKQIEKYI
FT                   SQHQ"
FT   CDS_pept        296371..298167
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000033997" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20197392"
FT                   /locus_tag="CAGL0K03223g"
FT                   /product="Strain CBS138 chromosome K complete sequence "
FT                   /biological_process="intracellular protein transport "
FT                   /biological_process="vesicle-mediated transport "
FT                   /cellular_component="clathrin adaptor complex"
FT                   /protein_id="CAG61326.1"
FT                   /db_xref="GO:0006886"
FT                   /db_xref="GO:0016192"
FT                   /db_xref="GO:0030131"
FT                   /db_xref="HOGENOM:HBG058183"
FT                   /db_xref="HOGENOM:HBG203836"
FT                   /db_xref="InterPro:IPR008968"
FT                   /db_xref="InterPro:IPR011012"
FT                   /db_xref="InterPro:IPR018240"
FT                   /db_xref="InterPro:IPR022775"
FT                   /db_xref="UniParc:UPI00003B6C17"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FN29"
FT                   /transl_table=1
FT                   /translation="MSSSIYIFDETLEPLVSKSVKGLPNVNELGDLFRYHVRQSQNPII
FT                   DVYNWRFVYIKRDTLYFVAVVDAADDAIANYLAILTYLEQLYQLFRDYVGVKVLDRNLV
FT                   LDNTLLVMELIDETLDYGIVQLTEPSIMKDYIRVRVNLPEQRIMLEEIWNTDSDSDSDG
FT                   NSKRKHKHKSKGDKDKPALGKVPLSKEELDKVLKTSKDKVYKKIKDNINELEKIGKFRG
FT                   KDEYDDDANENETFINSYIAKTTIMPVSWRAKGIHYAKNEFFLDVIEKLQYLVDLESGM
FT                   VRRSLIHGQIVCRSYLSGMPKLKMSLNKLLQNDKQFISQVQFHQCVSLDSIEKVIKYAE
FT                   EHSDELKTLKHTEHNAESEIEFIPPDGDFTLCSYELKRHIRDPPMVKLCSFEITPKWKK
FT                   YKLKISAAVETHFKPTNSTSKLDVKIPISKVFKDYQIDLKKPIKFKTSNGRVVYNISDD
FT                   FLLWEIGVIKGGKMHGSKEDISKFDNVATMAAEFGLFNEEEYERERKERETSMNPPPLR
FT                   TGPKLEDIYKETHEENDGYNSVGQKPKNNLNLLSMDFEIPYCTCSGLKVEYLKIDEDQL
FT                   QYQSFPWVRYKTINDDEYAYII"
FT   CDS_pept        complement(298216..299646)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21046253"
FT                   /locus_tag="CAGL0K03245g"
FT                   /product="Similar to KLLA0F25410g Kluyveromyces lactis "
FT                   /protein_id="CAG61327.1"
FT                   /db_xref="HOGENOM:HBG123738"
FT                   /db_xref="UniParc:UPI00003B6C18"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FN28"
FT                   /transl_table=1
FT                   /translation="MLLFGSARRCVHGWSHVAKQLGKYGVDEVAISKLRLLQENTAIRC
FT                   GVLMNTRQGSFGSAFVTDKEALGSSWVPTLINRWVNEDKTPVLMKYGDQFREINGEVRT
FT                   FEIPSSFLKETNAEILEIPEQDQSKDKRLPHVHDGCHVYLDIRGDPTVSQPTWPTIEIE
FT                   DVLSKGKLLLTNQIDSQMALESLLKYNNSTISEYLNKQNASNFDRIRAKLVDKLKDGNL
FT                   IRTELKSSIRRYLQSTDRDISNEKRLIGKRDLTNEEIDKWAECSHKTLRDEIVPSFLSF
FT                   ARAHLSLWKLYTYSPAKLKLNFMEYCMIPLYKVHEIENSAKVLEANMFREFDLETVSAQ
FT                   VMTPILPTTEIQKIGRIQTEINKAIYKQFFTIQLPMVLCALLGVVSEQFSAYYMGSLAA
FT                   LGIVLGFWRCMKQWQYILNGYTRKVAFLLKDRIELRRAELKKLSDRCFEEKALAAKKKK
FT                   ELLEPLLEVDLRQKNKKC"
FT   CDS_pept        299919..301382
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000141706" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18502824"
FT                   /locus_tag="CAGL0K03267g"
FT                   /product="Strain CBS138 chromosome K complete sequence "
FT                   /protein_id="CAG61328.1"
FT                   /db_xref="HOGENOM:HBG058184"
FT                   /db_xref="HOGENOM:HBG203834"
FT                   /db_xref="InterPro:IPR013927"
FT                   /db_xref="UniParc:UPI00003B6C19"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FN27"
FT                   /transl_table=1
FT                   /translation="MDTRRGWIHNYISFSGLSEEDVEAAEALDVLRNSHVDADVEVEED
FT                   RSKKRVRDGEDEDGGHVRRRKASVRDRSDSRMSQLSNVSNASTEERVVRVNSHEDSQSK
FT                   RQEEESLFDKVCRNSNEILTNMGSFFEEMNSNVFMEGGSDVPEEHPNGYVRPRRDSRSI
FT                   STTGADADTESQGTQGSYNGKWDTWSSRSYNDRQYYSKRKALSEALAKGRYNLREYKLT
FT                   MSIESKKRLITCLHLLKLANKQLSDKVAYLQDAVEKEQELANGEEVKKETRALNGEHSG
FT                   PQNDDDLEFYDASESVDQNSGDLGLEIVGTVKKVYSLISKYTGSSLPEPARSQVRESLL
FT                   NLPSNWNTSVHNGFKNNGTGIMTASSSTDSLSSYSSILPVSSNGKYLILAKESLNMVQS
FT                   VIDVVDSTLGRAEEWVKQKQELKEMIKKKFLEQQEHQKMLGIGTESLDQNESSVKKEQP
FT                   TTHISISSITNSTNTLDTVKEEDMHLQKV"
FT   CDS_pept        301825..302718
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000283048" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17444487"
FT                   /locus_tag="CAGL0K03289g"
FT                   /product="Similar to uniprot|Q03161 Saccharomyces
FT                   cerevisiae YMR099c"
FT                   /function="carbohydrate binding"
FT                   /function="isomerase activity"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /protein_id="CAG61329.1"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="GO:0016853"
FT                   /db_xref="GO:0030246"
FT                   /db_xref="HOGENOM:HBG401999"
FT                   /db_xref="HOGENOM:HBG737737"
FT                   /db_xref="InterPro:IPR008183"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR014718"
FT                   /db_xref="UniParc:UPI00003B6C1A"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FN26"
FT                   /transl_table=1
FT                   /translation="MSIEETDSQVVITHPSNSNTSVTILKYGATVTSWKLNGEEQLWLS
FT                   TAAKLDGSKPVRGGIPLVFPVFGKNQSDELLSKLPQHGFARNSTWEFLGQVKSNPPTVQ
FT                   FGLNPKIANQELVKLWPLDFNLILTIELGEDFLKTAIEVENASEENMKFNWLFHTYLHI
FT                   EDIEDTMVSNLVGMKVYDQLLKESFIDKHPVVTFHQETDSIYQNVDSDRLIQVVGKGKP
FT                   LHTVKRENLPDAVVWNPWVDKSAGMGDFEPKDGFKNMVCVEPGHVSDFVVLPPGQKWSA
FT                   AQILSKQELNYQAIEP"
FT   tRNA            complement(302969..303041)
FT                   /gene_name="tRNA-Ala (AGC)"
FT   CDS_pept        303720..305528
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000066045" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21046254"
FT                   /locus_tag="CAGL0K03333g"
FT                   /product="Similar to uniprot|Q03162 Saccharomyces
FT                   cerevisiae YMR100w involved in budding "
FT                   /function="zinc ion binding"
FT                   /protein_id="CAG61330.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG058148"
FT                   /db_xref="HOGENOM:HBG203424"
FT                   /db_xref="InterPro:IPR002893"
FT                   /db_xref="UniParc:UPI00003B6C1B"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FN25"
FT                   /transl_table=1
FT                   /translation="MRDSNHRSISNNKPVITITSTVYDRRALDIESTVPLINSLNHLTY
FT                   LTSNSAKIRETIANDGALDRLVSILHNCHLSLHEILDKDLEFFKTHERAKSIYKRKRLA
FT                   LCAWKWTLAFQCLVLTGTRGTEQIRKKVVLAGVIPVLATVLDNYMLFHKHYDFIRDETL
FT                   DFEIDEILTFDSYKLLRKNSEETYEEYISYLIGRDKLKPTDFKRFSVEELTTPIMTCAT
FT                   DFRDVWQRYNDSPLPTPSDKSNAKLEENCFYENDEEKFLVSTPRSFFIGKIIPKQDDVI
FT                   WSLQLLAFISKYTYMKQKLQNVELIDSLSFRSMIERYKKRKMTTFSNNLSPLSISKNLS
FT                   EKDENIVGDIKDESDITNLQMKINNPIIKEIMECGKRCLKIEKKRKECKPKCRTCILNM
FT                   KSPPYIKNLQLNKYFDRLWNYQKVSKRLTDETWNSFISKQLINAFPLVEKYTITDKNTH
FT                   DIIYWSSVIMRNSCRKNEVTGVRQCANFSCGKWERYPREFAKCRRCKRTKYCSRECQLE
FT                   AWKHHRYWCHEVTSSNKSSSMNTETNTPGGTGNDSSTMMARTEGGTILQTNTAGLMLQQ
FT                   HTPDLTHTEEMAGQFSNDNEDINGME"
FT   CDS_pept        complement(305791..306819)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000006053" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21046255"
FT                   /locus_tag="CAGL0K03355g"
FT                   /product="Similar to uniprot|Q03175 Saccharomyces
FT                   cerevisiae YMR101c"
FT                   /function="di-trans,poly-cis-decaprenylcistransferase
FT                   activity"
FT                   /protein_id="CAG61331.1"
FT                   /db_xref="GO:0008834"
FT                   /db_xref="HOGENOM:HBG372223"
FT                   /db_xref="HOGENOM:HBG627837"
FT                   /db_xref="InterPro:IPR001441"
FT                   /db_xref="InterPro:IPR018520"
FT                   /db_xref="UniParc:UPI00003B6C1C"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FN24"
FT                   /transl_table=1
FT                   /translation="MIHLIRNLFICVVEVMSIGSSSVTKFISDYATVLFYYCKSFYYIN
FT                   VITTSIQKMLIFALRTGPVPAHVAFIMDGNRRFAKSKDIPLRKGHEAGGETLLTLVYIC
FT                   KTLGVKCISAYAFSIENFNRPREEVETLMNLFGDKLDEFAQKANDYKDPLYGSSLRIVG
FT                   DRSLISPELRERIENVEKLTENSEKFILYICFPYTSRNDIFQTVTKVTDKYVQSNIIDS
FT                   NLSINEFTKSMHFKEYSDNCDILIRTSGHKRLSDFMLWQVNEHATMEFSTSLWPQFNFF
FT                   QMYLIILRWSMFKMFQIYNMNNVSKHSKFGSKLYKPYKTILKYIFSERLPDPPMAVPVT
FT                   NR"
FT   CDS_pept        complement(307358..310294)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000757" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18502825"
FT                   /locus_tag="CAGL0K03377g"
FT                   /product="Similar to uniprot|Q03177 Saccharomyces
FT                   cerevisiae YMR102c"
FT                   /protein_id="CAG61332.1"
FT                   /db_xref="HOGENOM:HBG203425"
FT                   /db_xref="HOGENOM:HBG252596"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="UniParc:UPI00003B6C1D"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FN23"
FT                   /transl_table=1
FT                   /translation="MTRFNFAIGHDEDGTTDLGKVATDTTTTTGSSIPVRSSMDSDSFS
FT                   HDEDAELSRSMDDSQDAREVKSMNSEYSSDDGSKDRTKKEINSAEYSADIQPLQFKMSR
FT                   RRTTQFDGTESSKASRKANASGNGSDPIKTLRFDEGSLSSSPTAIASDATRASLQRDTF
FT                   AKVREHIQRGSVGNSGLTRSDFNPFAFIDREQFETYLKEPRYIRIFKKRSRSSKQFRRL
FT                   FLAQELKTTDEFDDIEAMSASLLSQPDGLKPNTSITNATLNGNNFHDNINDPNHDMHSD
FT                   KTFSGTACPVLPTSGHLEPAKNTKAIWSTKFSIDGKYMATGSRDGVLRLWKVLSTPVER
FT                   WGLDSSIDSAHLTSAKSLRLQQNQHGSSHGGPLGSPAMRRDTFDNIDAKENSSNLYAPV
FT                   FQPTPVRTYKEHLHDVLDMDWSKNNFLISASMDKTAKLWHPSKMRSLKSFQHPDFVTCV
FT                   KFHPTDDRFFISGCLDQKCRLWSILDDEVSFEFNCRDLVTSLTLTPGDGTYTIVGTFNG
FT                   YIHVLQTKGLEHITSFHVTAKKTHENTHEVLCPSNDSKVRHGPRVTGLQCFNSLIDNSL
FT                   RLVVTSSDSRIRVFDLTRRKLIEILRGFQCGSSQHKAQISVYRNQPIVINSSDDHWVYG
FT                   WRLKSSDPVEINKKAKKHGMSRSGSIRGLFSKSISRSSSQGSEDRQSLRNTLKLSSLLP
FT                   IPHSSHSDGVMKNSDYFSFHAHNAPVTTVTMAPEETSKTLSLSNDPICELSLEFFEPSD
FT                   EVDIIKLKDTQKGGHDNIPATKTPVTTSLAKPTPVEVIGSILISTDSNGLIRVFRADMS
FT                   KSIRARVLQKLQKYNREMGKQYGSTDSLVSENDKSRPNLGTVGHQPSTNSTSFLSSTGS
FT                   TNTTTVGSGSKASITRNHSFRSLKAFKSPTANFSNTALGATMNRAPRESISSVRSDSTS
FT                   NTMTPMSFPGLKCHVCDGTKFEPLTRSSGSQDKSYFCVDCKTLLNNFR"
FT   CDS_pept        complement(311316..313427)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000233033" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17444488"
FT                   /locus_tag="CAGL0K03399g"
FT                   /product="Strain CBS138 chromosome K complete sequence "
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="CAG61333.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG330930"
FT                   /db_xref="HOGENOM:HBG537393"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR000961"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="InterPro:IPR017892"
FT                   /db_xref="UniParc:UPI00003B6C1E"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FN22"
FT                   /transl_table=1
FT                   /translation="MYSWKKFKFGKSKDEKEQKKDKLFHFHHKHTGSDVSDNFGNGNDK
FT                   EKSVDSLPSSSEITPYPSDLPSQNTNGNNSSRNDTMVNSNSSNRISSASSAKGPGSSSS
FT                   TIKDVPLGGENERSSSHIDQVSQKSATSTKKTSTPSTGVMTIKVYNGDGFRLPFPITSN
FT                   KKILSRLLESGIASDNHDTSLEVEAILQRISRLELTNSNSNENLLPGDIATQSIPSTIK
FT                   LPNSVPLNPLLYFTIEFDNTVATIEPESGTMAQPIFNKISTFDVTRKLPQLNIDVFVRI
FT                   PSILLPPKQWQQEMGAQDEKLQALLDKINTNQDVHLDSFQLPVNLLIDSAATIRLYNHH
FT                   WVELRDGLGKINISVDYKPSRNKPLSIDDFDLLKVIGKGSFGKVMQVRKKDTKKIYALK
FT                   AIRKSYIVSKSEVTHTLAERTVLARIDCPFIVPLKFSFQSQEKLYLVLACINGGELFYH
FT                   LQREGRFDLSRSRFYAAELLCALDTLHKMDVIYRDLKPENILLDYQGHIALCDFGLCKL
FT                   NMKDEDKTDTFCGTPEYLAPELLLGQGYSKVVDWWTLGVLLYEMLTGLPPYYDENVPKM
FT                   YKKILQDPLVFPDGFDRDAKDLLIGLLSRDPQRRLGYNGADEIKNHPFFSQLSWKRLLM
FT                   KGYIPPYKPPVTSATDTSNFDQEFTREKPIDSVVDEYLSESVQKQFGGWTYVGSEQLGN
FT                   SLVQGGSIR"
FT   CDS_pept        complement(314680..316386)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000009550" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17444489"
FT                   /locus_tag="CAGL0K03421g"
FT                   /product="Similar to uniprot|P37012 Saccharomyces
FT                   cerevisiae YMR105c Phosphoglucomutase 2 "
FT                   /function="intramolecular transferase activity,
FT                   phosphotransferases"
FT                   /function="magnesium ion binding"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /protein_id="CAG61334.1"
FT                   /db_xref="GO:0000287"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="GO:0016868"
FT                   /db_xref="HOGENOM:HBG009334"
FT                   /db_xref="HOGENOM:HBG286308"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="UniParc:UPI00003B6C1F"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FN21"
FT                   /transl_table=1
FT                   /translation="MSQIESVPTKPYQDQKPGTSGLRKKTKVFEDQPNYVENFIQSVME
FT                   AIPEGAKGAVLVVGGDGRYYNDVILQKIAAIGAANGVKKLVIGQNGLLSTPAASHIMRT
FT                   YKEKCTGGIILTASHNPGGPENDMGIKYNLSNGGPAPEPVTNKIWEISKKLTHYKIVKD
FT                   FPELDLTKLVENKKYGPLLVDVIDTTDAYIQLLKEIFDFELIHKFIAKQRKEKGWKLLV
FT                   DSMNGVTGPYAKAIFVDEFGLDSKEVLQNWHPQPDFGGLHPDPNLTYAHTLVERVNKEK
FT                   IEFGAASDGDGDRNMIYGYGPAFVSPGDSVAIIAEYANEIPYFKKQGIYGLARSFPTAS
FT                   AIDRVAKKHGLNCYEVPTGWKFFCALFDAKKLSICGEESFGTGSNHVREKDGIWAIMAW
FT                   LNILAIFNQRHPDKEASIKTIQNEFWDTYGRTFFTRYDYEKVETDKANKVIENLRQYVA
FT                   DSGTKGSKFPTDSALTVVDAGDFSYTDLDGTISSHQGLYVILSNGARFVVRLSGTGSSG
FT                   ATIRLYIERYTDDKSKYSLDAQEYLKPIIKSIVQFLDLKTILGTEEPTVRT"
FT   CDS_pept        complement(317197..319044)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000066046" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18502826"
FT                   /locus_tag="CAGL0K03443g"
FT                   /product="Similar to uniprot|Q04437 Saccharomyces
FT                   cerevisiae YMR106c"
FT                   /function="ATP-dependent DNA helicase activity "
FT                   /function="DNA binding"
FT                   /biological_process="double-strand break repair via
FT                   nonhomologous end joining"
FT                   /protein_id="CAG61335.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0004003"
FT                   /db_xref="GO:0006303"
FT                   /db_xref="HOGENOM:HBG058143"
FT                   /db_xref="HOGENOM:HBG203427"
FT                   /db_xref="InterPro:IPR005161"
FT                   /db_xref="InterPro:IPR006164"
FT                   /db_xref="InterPro:IPR016194"
FT                   /db_xref="UniParc:UPI00003B6C20"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FN20"
FT                   /transl_table=1
FT                   /translation="MSEATSVLIDVDVEPLIIAKVTAYLEYMLLDKARRGRKTDYVSAY
FT                   LVNHTETQNSQDVPHVVRLCDFLAPTTEGAIALLRQLALVRREYRGDNILQALLLASID
FT                   GRDYFGKRKVAKQLMIFTDKVSELDLSAEELQTLHEELDSRIILVDCSTHPHQNAQGSQ
FT                   WDALVRTVKGSMSFHIDELLLRITQTVPKVVKPVTVFSGQLRLGASLENIVDLEPHRRD
FT                   EAAAADNPKKRQFPFGFRTEANYADDHCLCIGVQGYPATKKTGSLQKKTVVKDASKPGF
FT                   VPVKSVIDYELRDNEVEGEGKGKGEGDAPPITVARESITKAYRYGTDYVVLPSSLEDQL
FT                   VYQTYAGLDIRGFMNMSDMHRHFLTSESVFVVSSSSSADQITFSALIDAMIQIDKIAIG
FT                   RYVPKNNSDVQMCMLYPMILEKENGTHVRTLILNRLPFTEDERIAIFPRLTREDDKKSE
FT                   KDETIDQLMAGFVESRSMDDLPRVEEKKYYEFYEDSVRDTTLVLPMKSKDETRERDPLM
FT                   VPAMGLHRQLQVMLEYLHQVVINKSEKFDPPELQDHLKAKITPHIVSDFPELEELVNLL
FT                   ELKKVEPKSKEFKPPAPAEPVPSLEELLKRGEAAREGES"
FT   CDS_pept        319329..319613
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000758" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17444490"
FT                   /gene_name="SPG4"
FT                   /locus_tag="CAGL0K03459g"
FT                   /product="Stationary phase protein 4 "
FT                   /protein_id="CAR58050.1"
FT                   /db_xref="HOGENOM:HBG398744"
FT                   /db_xref="InterPro:IPR020485"
FT                   /db_xref="UniParc:UPI00017BD8A9"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4UN34"
FT                   /transl_table=1
FT                   /translation="MPSFWDSFAVYNRNKHAKGDVHGGHMSQNMGGQPMYLQAKEHADI
FT                   KKKEDGTLEAKIETPDGPRLVDVSNMTQQEFERTYNSLRKGEPNNRVNF"
FT   CDS_pept        320030..322063
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000258448" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17444491"
FT                   /locus_tag="CAGL0K03465g"
FT                   /product="Similar to uniprot|P07342 Saccharomyces
FT                   cerevisiae YMR108w Acetolactate synthase "
FT                   /function="acetolactate synthase activity"
FT                   /function="flavin adenine dinucleotide binding "
FT                   /function="magnesium ion binding"
FT                   /function="thiamine pyrophosphate binding"
FT                   /biological_process="branched chain family amino acid
FT                   biosynthetic process"
FT                   /protein_id="CAG61336.1"
FT                   /db_xref="GO:0000287"
FT                   /db_xref="GO:0003984"
FT                   /db_xref="GO:0009082"
FT                   /db_xref="GO:0030976"
FT                   /db_xref="GO:0050660"
FT                   /db_xref="HOGENOM:HBG323037"
FT                   /db_xref="HOGENOM:HBG460149"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR012846"
FT                   /db_xref="UniParc:UPI00003B6C21"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FN19"
FT                   /transl_table=1
FT                   /translation="MTRRGLTDPMIRISGVVARACRRSAAYQVCKYSVRAVPRPEPSPS
FT                   FNVDPDTAAANTGSGVKLSSKLKNVATQKMDNSFVGLTGGQIFNEMMARNNVDTVFGYP
FT                   GGAILPVYDAIHNSDKFKFVLPKHEQGAGHMAEGYARASGKPGVVLVTSGPGATNVVTP
FT                   MADALADGIPMVVFTGQVPTTAIGTDAFQEADIVGISRSCTKWNVMVKNVAELPLRINE
FT                   AFQIATSGRPGPVLVDLPKDVTAAILRTPIPVKSTLPSTALQQLTAGVQDQFVIENIKK
FT                   SADLINIAKNPVLYVGGGILNNVDGPRLVKELSERAQIPVTTTLQGLGAFDQEDPKSLD
FT                   MLGMHGCATANLAVQNSDLIIAVGARFDDRVTGNITKFAPEARKAALEGRGGIIHFEIT
FT                   PKNINKVVEAQVAVEGDAASNLSKLIPLVFPVKERPEWFEKINKWKKEFPYSYSLETPG
FT                   SRIKPQTAIAKLSKIANATSKEVIVTTGVGQHQMWAAQHWTWKNPRTFITSGGLGTMGY
FT                   GLPSAIGAQVAKPDALVIDIDGDASFNMSLQELSSAVQANAPVKILVLNNEEQGMVTQW
FT                   QSLFYEHRYSHTHQLNPDFVKLAEAMGMKGMRVKDQAELEKTLKEFVDYQGPVLLEVEV
FT                   EKKVPVLPMVPAGKGLHEFINYDPEMEREQNELRHKRTGGKH"
FT   CDS_pept        322859..326512
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000260265" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17444492"
FT                   /gene_name="MYO5"
FT                   /locus_tag="CAGL0K03487g"
FT                   /product="Myosin-5"
FT                   /function="ATP binding"
FT                   /function="actin binding"
FT                   /function="motor activity"
FT                   /cellular_component="actin cortical patch"
FT                   /cellular_component="myosin complex"
FT                   /protein_id="CAG61337.1"
FT                   /db_xref="GO:0003774"
FT                   /db_xref="GO:0003779"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0016459"
FT                   /db_xref="GO:0030479"
FT                   /db_xref="HOGENOM:HBG501769"
FT                   /db_xref="HOGENOM:HBG717149"
FT                   /db_xref="HSSP:1YP5"
FT                   /db_xref="InterPro:IPR001452"
FT                   /db_xref="InterPro:IPR001609"
FT                   /db_xref="InterPro:IPR010926"
FT                   /db_xref="UniParc:UPI00003B6C22"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FN18"
FT                   /transl_table=1
FT                   /translation="MAILKRGARNKTHQEPAKRGGNNIKKAAFETSKKKEVGVSDLTLL
FT                   TSISDESINDNLKKRFLNGTIYTYIGHVLISVNPFRDLGIYTDAIMKSYQGKNRLEVPP
FT                   HVYAISEAMYYNLKAYNENQCVIISGESGAGKTEAAKKIMEYIAATSSTHSESIGKIKD
FT                   MVLATNPLLESFGCAKTLRNNNSSRHGKYLEIRFNSQFEPCAGNITNYLLEKQRVVGQI
FT                   TNERNFHIFYQFTKGASDNYRQTFGVQLPEQYVYTSASKCTSVDTIDDVKDFEATIKAM
FT                   QVIGLAQEEQDQIFRMLAAILWIGNISFIENEEGNAQVRDTSVTDFVAYLLQVDSQSLI
FT                   KALVERIVETNHGSRRGSVYHVPLNIVQATAVRDALAKAIYNNLFEWIVDRVNKSLHAY
FT                   PGADKSIGILDIYGFEIFEHNSFEQICINYVNEKLQQIFIQLTLKSEQDTYAREKIQWT
FT                   PIKYFDNKVVCDLIEAKRPPGIFAAMNDSVATAHADSSAADQAFAQRLSLFSSNPHFEQ
FT                   RQNKFVIKHYAGDVTYDVLGMTDKNKDQLQKDLVELVGTTTNAFLTTLFPNQVDKDNKR
FT                   RPPTAGDKIIKSANELVETLSKAQPSYIRTIKPNQTKSPNDYDDHQVLHQVKYLGLQEN
FT                   VRIRRAGFAYRQGFEKFVERFYLLSPRCSYAGDYTWTGDILEAVRLILQDALIPEKEYQ
FT                   LGVTQVFIKTPETLFALENMRDKFWHNMAARIQRAWRRYLQRRIDAAVKIQRTIKERKE
FT                   GNKFEKLRDYGTSLLGNKKERRSMSLLGYRAFMGDYLSCNESKSNGSYIKRQAGISEKV
FT                   VFSFHGEALHSKFGRSAQRLKKTFILSPTTLYIIGQVRVQNAMQYTADYKINVNSILQL
FT                   NMTNLQDDWVGIVLANSSMPDPLINLSFKTELITHLKTLNSKIQVKVGPTLEYQKKPGK
FT                   MHSVKCQVSDTAPKYGDVYKSSTIFVRRGNPANSKSKKKPRKKSSGMSAPTTQSSKTLA
FT                   PPRMSSNNQNTTVSQSLNGGMNVKPQTPASRSAKKPAPPPPGSKKPAPQPMAKKPAPHP
FT                   TPQAQMQTQTQIPASQSSATQSSIPPPPPPPPSKTSEPQFEAAYDFPGSGNPSELPLMK
FT                   GDIVYITKEEPSGWSLAKTLDGSKSGWVPTAYMVKHEGAKAPPPAPAVTASQPAIQNQS
FT                   QPASAQTVAATSQVPASFGDGLVSALAARANKMRVESDEEAAASSDNDDDW"
FT   CDS_pept        complement(326872..328455)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000271515" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19350606"
FT                   /locus_tag="CAGL0K03509g"
FT                   /product="Aldehyde dehydrogenase"
FT                   /function="aldehyde dehydrogenase [NAD(P)+] activity "
FT                   /biological_process="cellular aldehyde metabolic process "
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAG61338.1"
FT                   /db_xref="GO:0004030"
FT                   /db_xref="GO:0006081"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG439831"
FT                   /db_xref="HOGENOM:HBG752218"
FT                   /db_xref="InterPro:IPR012394"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniParc:UPI00003B6C23"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FN17"
FT                   /transl_table=1
FT                   /translation="MAEILNYTELSEIDAKISISRNYFQQNRKELANQKNVRSADNKQR
FT                   QFWLKKLYWSVKDHEEQILEALEKDFHRSRQESISLEYVKLLGDILHLIEGIPKWNKPK
FT                   KVRDNSAPFMFGNINIEKISRGNVLVISPFNFPVLLALAPVACALSAGNTVILKPSEMT
FT                   PHCALVLEDIVKSCQLPEGVLQIVQGGVEQTTKLINSESLDMIFYTGSPRVGSIVAQAA
FT                   AKNLVPCVLELGGKSPTFITGSLQKKNLETALKRIFFGAFGNAGQICVSPDYLLVHESI
FT                   YDDVVKESGKVMKELYPDLNEHTEYTHMIHKASYDKTLEKLQKTKGRKVSAADVKIDNT
FT                   SGKLMIPPTIVFDSDWDDALMEEENFAPVLPVIKYTDIDATIDKILSKHDTPLVQYIFS
FT                   EKQKEIDHILARLRSGDCIICDTTIHVGIKDAPFGGIGQSGYGNYGGVYGFDAFSHERI
FT                   VLKQPFWVDFLLKLRYPPFTAKKVKLLKLATERQPWFDREGNDHRSYKLIAMFSVTCAL
FT                   LAVGVKSFFV"
FT   CDS_pept        complement(329108..329485)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000000759" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18502827"
FT                   /gene_name="MED11"
FT                   /locus_tag="CAGL0K03531g"
FT                   /product="Mediator of RNA polymerase II transcription
FT                   subunit 11"
FT                   /function="RNA polymerase II transcription mediator
FT                   activity"
FT                   /biological_process="regulation of transcription from RNA
FT                   polymerase II promoter"
FT                   /biological_process="transcription"
FT                   /cellular_component="mediator complex"
FT                   /protein_id="CAG61339.1"
FT                   /db_xref="GO:0006350"
FT                   /db_xref="GO:0006357"
FT                   /db_xref="GO:0016455"
FT                   /db_xref="GO:0016592"
FT                   /db_xref="HOGENOM:HBG059042"
FT                   /db_xref="HOGENOM:HBG203430"
FT                   /db_xref="InterPro:IPR019404"
FT                   /db_xref="UniParc:UPI00003B6C24"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FN16"
FT                   /transl_table=1
FT                   /translation="MSKSTLEQPEYVKERLESLAEVDRQLCSMLQEASQVAFTYGEVLR
FT                   GNAMMKPQFQEHVSAFYSTLDNASGKLKKEIELLDENVGNRLLPINVNKKALGQDDDKL
FT                   KEQMETLKEFLKTDNEETSTS"
FT   CDS_pept        330861..332201
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000019981" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17444493"
FT                   /locus_tag="CAGL0K03553g"
FT                   /product="Strain CBS138 chromosome K complete sequence "
FT                   /function="ATP binding"
FT                   /function="tetrahydrofolylpolyglutamate synthase activity "
FT                   /biological_process="folic acid-containing compound
FT                   biosynthetic process"
FT                   /protein_id="CAG61340.1"
FT                   /db_xref="GO:0004326"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0009396"
FT                   /db_xref="HOGENOM:HBG228659"
FT                   /db_xref="HOGENOM:HBG744947"
FT                   /db_xref="InterPro:IPR001645"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR018109"
FT                   /db_xref="UniParc:UPI00003B6C25"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FN15"
FT                   /transl_table=1
FT                   /translation="MSIRLGLGRIGRLLEFIGNPHQHLKVLHIAGTNGKGSVCTYLSTV
FT                   LQQQRTHFRVGKFTTPHLIHVTESISINDQPIPNSQYLSIRNQLDILNSEHRLGCTEFE
FT                   LLTCTALQYFKEMECHWCVVEVGLGGREDATNIIPGSFKLCCGITKIGLDHESFLGNTL
FT                   EEIAREKAGIITEGVECAVIDGSNDKTVLDKVKQHCESMHCKLIITEGSMNSHTVRTAA
FT                   WGTIEFNQKLPLNGEYQIFNLRVALAILDELQRSKYINVSRQELVAGLDQVQWPGRLHD
FT                   LDFCFLLSEGDDRKKLTFPVLIDGAHNASAAIELSKHLRKQFGDKPLTFVIAVTAGKNL
FT                   NTLLRPLLRAQDRVIATKFSSVDGMPWIQPTDPKDLSSFIKSKFTTNCISENSLCDVFN
FT                   LLSEEYYHNDASEISPVIVCGSLYLCGELLRMHKRNSQTKGTNAESS"
FT   CDS_pept        complement(332625..333698)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000142006" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17444494"
FT                   /locus_tag="CAGL0K03575g"
FT                   /product="Similar to uniprot|Q04471 Saccharomyces
FT                   cerevisiae YMR114c"
FT                   /protein_id="CAG61341.1"
FT                   /db_xref="HOGENOM:HBG398582"
FT                   /db_xref="HOGENOM:HBG690672"
FT                   /db_xref="InterPro:IPR003738"
FT                   /db_xref="UniParc:UPI00003B6C26"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FN14"
FT                   /transl_table=1
FT                   /translation="MCGRFALMYDSWEVAEQIQRGFNLEINPVVSTSREDNTDTHYNAS
FT                   FNVSPTNMSAVYKNKDKGELRYMKWGLVPHWTKDLKSFKSYSTFNARLETLQESRLWIH
FT                   PCKSNRCAVPISGYYEWKTSGTKKGGSKTNIHKTPYYVTRSDGKLMFLAGMYDYVPAED
FT                   FYSFTIITAPAPKNLKWLHERMPVVIEPGTREWDSWMDPEKKDWSQKELNEILEPRYDE
FT                   DHMISYQVSPEVGKTTNNGENLIKPILKADKNKFEKLIKKELDETKVHDSIKNEHDQGK
FT                   LKTESNNTIKRENESSVKTENDNDKLYRGNNKGYKPKTKDDSLVKKESKEGNAKKKRNI
FT                   TDMLRSSSKQSPKKQKR"
FT   CDS_pept        334102..335559
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248851" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19350607"
FT                   /locus_tag="CAGL0K03597g"
FT                   /product="Similarities with uniprot|Q04472 Saccharomyces
FT                   cerevisiae YMR115w"
FT                   /function="binding"
FT                   /protein_id="CAG61342.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG059436"
FT                   /db_xref="HOGENOM:HBG397959"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniParc:UPI00003B6C27"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FN13"
FT                   /transl_table=1
FT                   /translation="MIVRSTARLARLGGVSLRRFTPGVTVQLRKNGTKKDSSYEQGKEN
FT                   IKNTAPIYGQKRWVYTVAGLSLLGFAIRQYYWSSKNQLPPSVAENVRKAVWHESDQGGN
FT                   NYRKALQYYIMVIDELSNSNFDALSDEYTRLELKLAEMYEKLGMIQECKDVFKELLSRF
FT                   YEALLTTNKVLEDKRSDLIRKDLRVLIKSLELNTDVEYGKKLLLSHLLLVQEEILTRSP
FT                   ELKQFFENRKSKAEEATKSSLHMPRLYDADSFEAFVNEKNIKLDENGYMILDLSKNSSA
FT                   WEPYKEEFFTARDLYTAYCLSSKDIAAALSCKLTSVEWMVMADMPPGQILLSQANLGSL
FT                   LYLQAEKFDSDILKLQKKIEEDAELKENPAILKALRFLHKNRDSCIKMAYKSYESIVSF
FT                   YKKNTKLRFHTKDQLDPSVVQAIALSIYGLGVLNLHDGVYVKAETLLKDALSLSKDTEF
FT                   VELSKEAELELKKAMSLKVQKQQQQDV"
FT   CDS_pept        complement(335752..336357)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20197393"
FT                   /gene_name="SPC24"
FT                   /locus_tag="CAGL0K03619g"
FT                   /product="Probable kinetochore protein SPC24 "
FT                   /biological_process="cell division"
FT                   /biological_process="mitosis"
FT                   /cellular_component="condensed chromosome kinetochore "
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG61343.1"
FT                   /db_xref="GO:0000777"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0007067"
FT                   /db_xref="GO:0051301"
FT                   /db_xref="HOGENOM:HBG059439"
FT                   /db_xref="InterPro:IPR013252"
FT                   /db_xref="UniParc:UPI00003B6C28"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FN12"
FT                   /transl_table=1
FT                   /translation="MASTEEIVQMMQEASAEFAEADDVSFLDKMNSNIAQLEQQLREQM
FT                   DESRQNIAKLEINLIDTEKSIGSLRELMKDATDEATIMKGSDKLNNLIDELQATENEIQ
FT                   MMNSEIEKKVSKLVEDEDNTSSEYEMISKELEQEYDPVFASNILKLKLYRSLGVRLDLD
FT                   NNQILIQNKELGTIDTLPLEDELTEFFKVKYIWSRIGK"
FT   CDS_pept        336673..338466
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000034100" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17444495"
FT                   /locus_tag="CAGL0K03641g"
FT                   /product="Similar to uniprot|P54074 Saccharomyces
FT                   cerevisiae YMR119w"
FT                   /protein_id="CAG61344.1"
FT                   /db_xref="HOGENOM:HBG123739"
FT                   /db_xref="UniParc:UPI00003B6C29"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FN11"
FT                   /transl_table=1
FT                   /translation="MNETFNELFPYLNQSSHSLLANDNPLARFPNVLYRLSLSFHDAIN
FT                   SQYMEVWSGQEISSTLQSFNDIIGFFFSEYSVLCFTIAVLLNRLITTISRRNRVNRANL
FT                   RPEINTLSHVSCILLLTWVMYELIEGLIKVKIYNADVPKIPLSLYFMVFSWSYCVETVI
FT                   SLLSNSTPLEGSDYTIFEISIEFYLLQRKRINIIDQTEFLPDCLMAISNRVMIHVLEMY
FT                   KMRNYRLLGSASLNLVHITYLMYVSIKYGVSSIPILTRFRHFPKVFSLFIVLISLVSYL
FT                   LAYIIRFDPFTNKNRNPDELQFYSFMKNWRKHLNFTGEEDFSPMLSKLAILLTSASSIS
FT                   ERGTRYEYPSVNINHELDTRYNEKLRAIQQVRFNETPRNGRRESVVRALTKPILEAKQN
FT                   IPFLSNMLDSFKLVLVHLCEILRGNEEAEYIDTDDSDADKEVSETPTRRFSLSKDTSWY
FT                   DDSYSEDEDYQDSDATELSLEEDLADDDILELRDDMSTLLQDELDPLMLQDHLLHSRLT
FT                   RSGLHKRHQEPSLGQVSDNREDTRDYSCVVCKTNDRNVIMWPCSCFAVCDDCRVSLSVR
FT                   GFNTCVCCRAPVSGHSKTHAT"
FT   CDS_pept        339486..339752
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17444496"
FT                   /locus_tag="CAGL0K03663g"
FT                   /product="Similarity"
FT                   /protein_id="CAG61345.1"
FT                   /db_xref="HOGENOM:HBG123740"
FT                   /db_xref="UniParc:UPI00003B6C2A"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FN10"
FT                   /transl_table=1
FT                   /translation="MSSSSRVSSSLSSMSSRVSSSIGTNSALVTNGAVAASSVAASANS
FT                   TSSHKSSKTKNGAVSMIASPVSWKYGVAIGAFLAGSFVLGAGI"
FT   CDS_pept        340046..340306
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248859" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19350608"
FT                   /locus_tag="CAGL0K03685g"
FT                   /product="Similar to uniprot|Q03880 Saccharomyces
FT                   cerevisiae YMR123w PKR1"
FT                   /protein_id="CAG61346.1"
FT                   /db_xref="HOGENOM:HBG059443"
FT                   /db_xref="HOGENOM:HBG756741"
FT                   /db_xref="InterPro:IPR013945"
FT                   /db_xref="UniParc:UPI00003B6C2B"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FN09"
FT                   /transl_table=1
FT                   /translation="MSFFTSLWQSIFEPGTSPQLIIATHISFAALLVSLLWLIYSTHII
FT                   HFYFLFVIAFLLWITVIWFIAELKSAKLKSNEELSKSTKAE"
FT   CDS_pept        340734..343466
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20197394"
FT                   /locus_tag="CAGL0K03707g"
FT                   /product="Similar to uniprot|P39523 Saccharomyces
FT                   cerevisiae YMR124w"
FT                   /protein_id="CAG61347.1"
FT                   /db_xref="HOGENOM:HBG123741"
FT                   /db_xref="UniParc:UPI00003B6C2C"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FN08"
FT                   /transl_table=1
FT                   /translation="MDAGITALNRKHQQQPQQFNIRNNLLKSDIGGIDITQELPVKNGE
FT                   KEEMPFPPHPPQQQYPPQYPPQYPPQHPQQHPQQHAQQHAQQQYQMPPVSAQRMYAAPQ
FT                   QQQVQQQPYFQQNMYQRTPYAPAQGNPYPRSQSLTQKSSISGFFKQKGYHSPFGKSKKG
FT                   SSGGDDDDNEEGADIIEDPSASVITYNDIRKNANKGGDKYGYGGDTAPIIPTIVTTDKN
FT                   TSNTDYRKYMTTQKKLAMNRMAKQGTPQTPSPPSKLQQYQQYQQMMPPNGSNPRAMSLQ
FT                   GFGSGSPFYQQSGPGNSPNNRLPNGQFMGDSRANSMMSAQNPMMRGPPQHAQPMYQQPN
FT                   FSGTMTTPGPRNTSPNRVPMNNQRPGPMNSQQSFNGPTGNISADRAMSLQTTSSRPMVN
FT                   MSEQKPVSDDLPPNPYLSQNARPYTEPINTNIDDNVKRNDNENHITATSPLKNQLYVAP
FT                   LSIPDDEEPTPGRSIAGSGKLNVLKLSKPQQEENMVKEIQVMKPSIEDHEEQQKSSNNE
FT                   DWNDIKKGLTEDALSHENRTSLVEDGLGSLKLDDRTKLGQPQRQSVDTYSSTFSDSPSK
FT                   KVNSNKVTGLYKLENMTDMDQYQTAQEFVDDTKLNSRANENRVESGSSSVYDNPYGSTT
FT                   SEKKIIDAEDERSKRRESLIKAKNILRNFSSEQRLSKRPTSETSVDSDYSAQDDTFTYK
FT                   QKDNKASASGNLTSTPTKSAQTNLQNEAETVDFVFSDTHSKAYEPIYSKHDSSMSDHAK
FT                   LKEKTFVIKEEQLNLLKENETLMREVTLVSTELAESIQRETVLEQKIRSLASGQKSSDV
FT                   ENSDNDFEREQEEQLSIVEFETEMRKKSAKIVELIQQLNDERLKRFIAEEQILLQERGA
FT                   KPSRPQLIYRIEQLNIQLEAKSQKLNDLQARLDKLEHNS"
FT   CDS_pept        join(343858..343882,344361..346921)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000066047" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17444497"
FT                   /locus_tag="CAGL0K03729g"
FT                   /product="Similar to uniprot|P34160 Saccharomyces
FT                   cerevisiae YMR125w STO1"
FT                   /function="binding"
FT                   /biological_process="RNA metabolic process"
FT                   /protein_id="CAG61348.2"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016070"
FT                   /db_xref="HOGENOM:HBG059446"
FT                   /db_xref="HOGENOM:HBG398745"
FT                   /db_xref="InterPro:IPR003890"
FT                   /db_xref="InterPro:IPR015172"
FT                   /db_xref="InterPro:IPR015174"
FT                   /db_xref="InterPro:IPR016021"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI00017BD8AF"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FN07"
FT                   /transl_table=1
FT                   /translation="MFNRKRKGDFDDEDYHDYRPRMPKRQRIPPVVQLCKEMMPDIRTI
FT                   GESVKAFEEDIQFLSDAIVNEFGHEEYFNDALLQTFRAVVLEQPQKLPAIALLTMVVNS
FT                   RNEAAGKGVVNFFFSELQKYCNQSVDPEYKPESSDTGPWNKIKLILRFLATLSPMLLND
FT                   ELISIFKDFLQLSIDLNQSDTNKRNPLSEALYTNTLLNIPYLFFFNRNDDDLKQKVGSL
FT                   LEFVEDNYKVKSTEINLLREYNNGAPFDSAELVQLVLSNVKKSLMDDLKDLEQLFPDWI
FT                   HLLTEQSGDQGFNDPLQLPSIEDLAEYMDLGHQRGSVDSMWHTPRYVFKVYVPNETHDF
FT                   ETVIPITTYAGQLFNDIIIDLVESLEFNRKEVARQVVSLDLFFKKGIFAEPGISIAQLS
FT                   NVYEENPLATTFKIEDLAIETIISLIFKLPDVSQPFAYFYTLLVEICQNSPKAIAPVFG
FT                   RAFRFFYSHLKNMDFELRLRYLDWFSIQMSNFNFSWKWNEWEDDSKNLSKSFYDPNINF
FT                   IRNLIHKELRLTSNPIDVEESLPEEFKQYLDSSYIAHDALVAYYQSFYVDYTVEPINIK
FT                   KNDFYFKHESSPLRDVVVELLDYIHKPNNTREVSELEQLLEKIKANHGSIIKNFDRFII
FT                   VLIVQALLESGSRSLSHANKYISDLKDDFKYVLDKIELDQDQKEFIIIEAVIRFWNSNS
FT                   QNGYLIVDAFKFAELVSSRSIINFALNEELANNYGLVDSTAIEAIFRTLSHEITLEIEH
FT                   ADDFEFVLEKLCIIINNTVSQLNIQLDEDIDVPQIFELTDGDNASDLAAYDLKWKYYTS
FT                   IVFIKSLLRKYSLKYKSLSDKILGNLDTAVPHQSTKEQIKIWLGELNSI"
FT   CDS_pept        complement(347231..348400)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000066048" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17444498"
FT                   /gene_name="DLT1"
FT                   /locus_tag="CAGL0K03751g"
FT                   /product="Defect at low temperature protein 1 "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAG61349.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG203436"
FT                   /db_xref="HOGENOM:HBG253461"
FT                   /db_xref="UniParc:UPI00003B6C2E"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FN06"
FT                   /transl_table=1
FT                   /translation="MILQEQRRLRLWLYKSSLFISVLFLIGFSIVLPVDSIVQAIQSEN
FT                   NGFNTIIVIGSLAVFFVAAVTILIGRMLLHKSCLKDIPRRYIPVTNADLPHKSSRKMVI
FT                   HNMERSKKLSGLFKTPKDPVIHPGLEPPARCDDPNTPKILPEYLNYKICIKSATDRLKY
FT                   YGLFLNSASDDVKSSQTFTDLVKSQFIKGNHNKRQVQRAKDFIELYERIRFSGDEVSRS
FT                   EFIQFAENCIYFSDLMITMDITKVGLGNISTRSQLSFNIAGSSVDRKLRKLNTARSNQI
FT                   SRLSSGQYPDITAFRYDTSNSDYHRQETDEDDFALDDMDYFPSVPPYMIRRNSTNTVSM
FT                   RIPTSNSDDQYNLGFNEIGDEDIQNNDQIRRYMSNTSKTDSFKTVIHNG"
FT   CDS_pept        complement(348963..350024)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000066050" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19350609"
FT                   /locus_tag="CAGL0K03773g"
FT                   /product="Similar to uniprot|P40963 Saccharomyces
FT                   cerevisiae YMR127c SAS2 silencing at HMR "
FT                   /function="transferase activity, transferring acyl groups
FT                   other than amino-acyl groups"
FT                   /biological_process="regulation of transcription "
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG61350.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0016747"
FT                   /db_xref="GO:0045449"
FT                   /db_xref="HOGENOM:HBG059449"
FT                   /db_xref="HOGENOM:HBG396237"
FT                   /db_xref="InterPro:IPR002717"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniParc:UPI00003B6C2F"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FN05"
FT                   /transl_table=1
FT                   /translation="MNVEENDDLYGILAEKNIKFVQLGLFKKFETWYGTAVYFNSENKK
FT                   LGFYDETQMKPGQQGNGYGRGSKIIKGKTVKKKKMTNKALSSLNDHALSNIQLKSNPKT
FT                   SDNQFWLDTLYVCEYCFKYTDVKDDFVNHVHQCSFKEKAPGRIKYKSPQYTIRRVKGSK
FT                   HQLFCQCLCLFTKLYLDNKSVFFKLDHYEFYIVYETGKTIPMAFFSKDLVSYNQNNLAC
FT                   ILTLPPYQRMGLGSLLIEFSYHLSRLEGIVSGPELPLSPFGLIGYLRYWSLVICWQLCE
FT                   GDLSNFERLSIQDISLATGIRISDIIPTLKHLNCIIDENHINLKVLKQWLKTHTKPGQN
FT                   PFMINEEYLLIDD"
FT   CDS_pept        350378..354265
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000201240" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18502828"
FT                   /locus_tag="CAGL0K03795g"
FT                   /product="Similar to uniprot|Q04217 Saccharomyces
FT                   cerevisiae YMR128w ECM16"
FT                   /function="ATP binding"
FT                   /function="ATP-dependent helicase activity"
FT                   /function="nucleic acid binding"
FT                   /protein_id="CAG61351.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0008026"
FT                   /db_xref="HOGENOM:HBG525455"
FT                   /db_xref="HOGENOM:HBG757997"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR002464"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR007502"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR011709"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="UniParc:UPI00003B6C30"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FN04"
FT                   /transl_table=1
FT                   /translation="MGTYRKRFNEKARAGQMAKLKELKRVRNKQFLRHLDDGSEEAKDE
FT                   KKQVEDTNSVLLKPMTEEEKEIKKRKLEELFTPKESKVSRTKKKRLEKFIEHQLKREEK
FT                   KELIGKLQDYKIDTSLLTSSKKLGQGRQTKKERFAEALELEKQGRASELTKDILYEEHD
FT                   VKEWEGIEGEPKKRTPDYTYSDSDQDLSDNNNESGISNDDDEANDEEDFESKFGNTASS
FT                   FIDRRPASTGGMGGGFGFGFANVTKVKPLKQTSKKKYNWKQKVAMEEMKRKNVEDMDDF
FT                   DTSSETDGTDFDSEDNDVDQSMEGDHSEHNNEDREDESSDKEVSSEQEHSGDSSSEISD
FT                   LTDGIENTEKKNVAEEFKSWANNEIRRLEGRDVDVEMPSLSFKVEPTFRPEDMDDGLKQ
FT                   THIPIDEGLKRKAFFVNVERKPEIMAQRLNLPVVAEEHTIMEAIHHNDVVIICGETGSG
FT                   KTTQVPQFLYESGYGSPDSTEHGGMIGITQPRRVAAVSMAERVSNELGNHGDKVAYQIR
FT                   FDSTSKEDTRVKFMTDGVLLRELMEDFLLSKYSAIIIDEAHERNINTDILIGMLSRCVK
FT                   LRAKKNNEDPKRYNKLKLVIMSATLRVSDFSENSSLFSSPPPILKIEARQFPVSVHFNR
FT                   KTAFNYADEAFRKTCKIHQRLPPGAILIFMTGQNEITAMVKKLRKRFPFKTKNKSLALE
FT                   FEATKVKVDPRTAAMEEEDIDLTVHDKDEKRFLEDIEYENENENVTDDNSDDEEGFDEE
FT                   LTDDQTPDDPLYVLPLYSLLPTKEQMKVFESPPKGSRMCIVATNVAETSLTIPGVRYVV
FT                   DCGRVKERKYNNSNGVQSFEVGWVSKASADQRSGRAGRTGPGHCYRLYSSAVFDRDFEQ
FT                   FSKPEILRMPVESVVLQMKSMAIHNIVNFPFPTPPDKESLKKAIELLQYLGALDDKEKV
FT                   TEDGKKMSLFPLSPRFSKMLLVSNEHGCMPYIVSIISALSVGDPFLTEQELGIQQAQVV
FT                   KRDDGNESAQLEFIDSQEVERVKNLRNKFYKSRVKFSKLDKYSDVFKLLSVTCAWNYVP
FT                   NKQRDDFVRSNFLRRKVMDEIEKLRRQLTYIVKSNTSKESIAINITNEDLRTDLPSEIQ
FT                   LKMLKQMICVGFIDKVAIRADALYPEEAKITNRTVINKIPYLPVMGKLANDVNDSFVYI
FT                   HPSSMINNIGELPPKFIVYNTLNLSANNVTRLVPLCDIKSTPLANVARKGMLLSYSKPI
FT                   TGQGLKVINIAPTERYCYVVPRFGSQKDSDLQVGWDLNPIPVHQVKQNGVWTVDKFITN
FT                   KNYKNAEHQRK"
FT   CDS_pept        354834..358787
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000115596" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17444499"
FT                   /locus_tag="CAGL0K03817g"
FT                   /product="Similar to uniprot|P39685 Saccharomyces
FT                   cerevisiae YMR129w nuclear pore protein "
FT                   /protein_id="CAG61352.1"
FT                   /db_xref="HOGENOM:HBG059451"
FT                   /db_xref="HOGENOM:HBG203438"
FT                   /db_xref="UniParc:UPI00003B6C31"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FN03"
FT                   /transl_table=1
FT                   /translation="MSSNRWNMFSDTPRGDHWLNSPGMSSPKKRVHDPQIKTKEFKNAE
FT                   DGFLYNRKDVPTEMHFENSKKYDGVNTTAHVNNERKDNKLRKVDQLPLVSTEALDISRQ
FT                   RALVISVFFLIQAYKIYDNMALQSGLPISGFAIGSNMFNFLFKYLIVDAAFFFTLPVLN
FT                   IPKLTFPTWVVISQVLLVTSFNIALCNNKTTVLFGMLLSAWKKFNAKEFTITGNTIKNR
FT                   QAPDYSSHFKGALTVKILPENTAFLNPFQSSYCFPLDGVQGVDTSMNVPIRVNSSSALE
FT                   LIQIEYTDLYTKERELLNFTSKSFSIMDDYHRKDSIDGTEKSSEVKYLTIPLKRIGIYQ
FT                   LKTVIDANNLNLKIQPSQLIVPHCPTITVVGFGDRNRCVGDSDVMKMELHGVPPLKLSY
FT                   TKEVDGVQYTYFDSNLQPENFDSPLMNGQKAFFSDSHLNNPKWARSHPIVITLDNTIQK
FT                   SGTYKYKINKLIDGFGNEMDYSTLTDSQLQEYDLTYDFFVHGIASAYLSEKFNPNKLMK
FT                   KSIFLNIKSDRLKKTEYTADLEFINERGVSKKFTVKTSSESKEIEVSEPGLYKILKVKS
FT                   EFCPGVVSGKSNVLVTKPVAPELNVVSKPILDECVGQVGLNFDLSFTGVPPFTVPVKIY
FT                   RIENNNRVIHDTKYIKSESSRKHFSYGPKHEGTYEIVFESISNNIFSEAIPLQPGKDYT
FT                   FQTSMRVKPGARISKNKNIELCLGHKNNVAVELRGEPPFELSYDIVETSSNKRSSYSKK
FT                   DLNTNIHDIELPPFKLGGEYILSLVSVKDAKGCVVSLSEADAKINVRRDIPTVAFASTD
FT                   REQNIFIKEGGTAKVPIKLGGIAPFKINYEQIDHEGNTIKTFKEMFSSNSDFALSIQEA
FT                   GLYKLTGVKDKTCEGKVEDKLASVAVKYLDKPSFVVQANKRTQKMDALTFKNDDVCELE
FT                   EASVDLSLIGSPPFILKYDLITPAGKKSQEEIQVATKYVSLKFPSSEAGVYTMIIKSLS
FT                   DSNYDETSLQNIAHKSVTVAVRQSVNPAPMIELLDSGKIIRTCFTNLEQADLMEPFKLK
FT                   INRGKAPFVVTVNVYHESTSRVDQFVINDVDGEYLSASEIYKDLKMGNHEIRIVKVVDA
FT                   NGCVNENMLSSVTTLQLSVVEAPKIHLLDSTSDYCVGDYVSYQLNGVPPYQIGYEFNGI
FT                   QLKFTEKSSQFVRYASEPGVISIRTLQDAASKCVVDFQKPGLATEHEKLSLIIHPIPSV
FT                   TVSQGKYTVADIHEGDQVEVIFSFEGTPPFSLTYIRAEDPTVNGKQQVIETHKITDIYE
FT                   YEYRVVTSLQGTYEAIEVADAHCFAKNDAFFQM"
FT   CDS_pept        359152..360066
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000141737" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17444500"
FT                   /locus_tag="CAGL0K03839g"
FT                   /product="Similar to uniprot|Q04223 Saccharomyces
FT                   cerevisiae YMR130w"
FT                   /function="catalytic activity"
FT                   /protein_id="CAG61353.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="HOGENOM:HBG123743"
FT                   /db_xref="HOGENOM:HBG203439"
FT                   /db_xref="InterPro:IPR005834"
FT                   /db_xref="InterPro:IPR011949"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniParc:UPI00003B6C32"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FN02"
FT                   /transl_table=1
FT                   /translation="MVFPKKIPIQNWNSKISLRTPKLITFDAYNTLYATVLPVMEQYSN
FT                   VASIYGVKVDPQELSANFPSVYSKLKLEHPNYGKNTGISAKQWWQIMITEVFKPIKLSD
FT                   DVVEAILDRFGSCEAFFVYPDLIALLKGIRQKYPDVIFGVISNADPYAGDVIKSFGLDK
FT                   YFDGNIYLSYDVGFSKPDQKIYEYALDDILNRFPDLIKNCSKEEFKQFCWHIGDEKIND
FT                   MEGPAKTGLVGILIDRVNKYGYFDGSFADIKHDLDMHKIDNNSLESWEIGIKQTDTFQV
FT                   SDREYVISNLRTLATILDVQVNE"
FT   CDS_pept        complement(360277..361818)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000036730" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21046256"
FT                   /locus_tag="CAGL0K03861g"
FT                   /product="Similar to uniprot|Q04225 Saccharomyces
FT                   cerevisiae YMR131c Ribosome assembly protein "
FT                   /protein_id="CAG61354.1"
FT                   /db_xref="HOGENOM:HBG020798"
FT                   /db_xref="HOGENOM:HBG630213"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="InterPro:IPR022052"
FT                   /db_xref="UniParc:UPI00003B6C33"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FN01"
FT                   /transl_table=1
FT                   /translation="MSKRSLDSSADERVVSARTGSQSVPKSYSTADGEQISDSGMIEDL
FT                   SDNFESDEDIIEIDGEDDEDEDEITDESAFLQKKEAKAKETIEKDNQQEKGGEELYLPH
FT                   MSRPLGPDEVLEADPTVYEMLHNVNMPWPCLSLDIIPDTLGSERRNYPQSILMTTATQA
FT                   SKKKENELMVLSLSNLTKTLLKDEEEEEEEEDDDDVEPIIENENIALRDTTNRIKVSPF
FT                   ASQSQEVLTATMSENGEVYIFDIGAQAKCFNSPGYQIPKQSKRPVHTIRNHGNVEGYGL
FT                   DWSPLIKSGALLSGDCSGQIYLTQRHTSKWVTDKQAYSVGNNKSIEDIQWSKTESTVFA
FT                   TAGCDGYIRVWDTRSKKHKPAISVKASNTDVNVISWNEKIGYLLASGDDNGSWGVWDLR
FT                   QFTPDNAANIQPVAQYNFHKGAITSIAFNPLEESIVAVGSEDNTVTLWDLSVEADDEEI
FT                   KQQTEETKELKEIPPQLLFVHWQKEIKDVKWHKQIPGCLVSTGTDGLNIWKTISV"
FT   CDS_pept        complement(362204..362818)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000041378" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19350610"
FT                   /locus_tag="CAGL0K03883g"
FT                   /product="Similar to uniprot|P40206 Saccharomyces
FT                   cerevisiae YMR132c"
FT                   /protein_id="CAG61355.1"
FT                   /db_xref="HOGENOM:HBG112124"
FT                   /db_xref="HOGENOM:HBG591261"
FT                   /db_xref="InterPro:IPR008532"
FT                   /db_xref="UniParc:UPI00003B6C34"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FN00"
FT                   /transl_table=1
FT                   /translation="MVYFYESQPELGYDGYQVIIGKDKFENDLLIKYGYRELNYMWFHT
FT                   DKYSSGHVYLKMKESEKSLGDVPKAVVEDCLQLCKSESIQGNKMPECTIIYTPWHNLRK
FT                   NRYMKPGEVSFKSVKNCKKTVCYNRDNKILNRLSKTRVEIYDDVEKLLHEAKKSKDPNY
FT                   FTDYISRNRDSLVEAEKVRKQLSKLAKQKKKKETEEEFYNN"
FT   CDS_pept        363233..364318
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17444501"
FT                   /locus_tag="CAGL0K03905g"
FT                   /product="Strain CBS138 chromosome K complete sequence "
FT                   /biological_process="reciprocal meiotic recombination "
FT                   /protein_id="CAG61356.2"
FT                   /db_xref="GO:0007131"
FT                   /db_xref="HOGENOM:HBG123744"
FT                   /db_xref="InterPro:IPR004354"
FT                   /db_xref="UniParc:UPI00017BD8B4"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FMZ9"
FT                   /transl_table=1
FT                   /translation="MNGYKECLRLSVMRYSKYQGQISAPHGFASAFAPLDLTLWSHITG
FT                   TSECPMFLVLLVTSDSKACRLKILSMQIEHEDILIKDNTIVSFVQFSAQSPVISCKYLT
FT                   QVDKFQYLNRFQIEFNSNEYMVAYGILTQIGFKIKKARRVNSEENEVQDKLATSQQSQM
FT                   LIFSQRENIIPSPNYKNINNLNYPSGDPPRHRQDLCSTHKNVDTTLLNSLPLVHIGDNL
FT                   RNSTSSSDKTPPIKKGGNQEIVNANHNIVKLSDKIHPYIIPNESAQLIIPEIKFGNISD
FT                   IIDSENNAPLNKQFLTTVNTEEICNTNTTDVTKHTKPVITKRLLKRKLRDKLFMIWVRR
FT                   IEKYFINIEKKSKHKSSRKHN"
FT   CDS_pept        364639..365346
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000761" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20197395"
FT                   /locus_tag="CAGL0K03927g"
FT                   /product="Similar to uniprot|P40207 Saccharomyces
FT                   cerevisiae YMR134w"
FT                   /protein_id="CAG61357.1"
FT                   /db_xref="HOGENOM:HBG058813"
FT                   /db_xref="HOGENOM:HBG203441"
FT                   /db_xref="UniParc:UPI00003B6C36"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FMZ8"
FT                   /transl_table=1
FT                   /translation="MSSWKNQYFCFEEKVIEKLKETPYVHQFIHDQHSARITLFLLVIG
FT                   TIAFFNELWITIEMSLIQKETYDELNLGRIDEGLKLHRMIVSDEYHGREYKDEKSGIVI
FT                   EEFEDRDKFFAKPVFVSELTVDCNIEKNGKTILERPLSFHIEFTPEEWELEKRPEFGCP
FT                   LSLLRLKLYHLFRDSRFYTELVDPSTDSFTVSKGVIIYNKMGELLPASVDSVQLCFLKI
FT                   ETGCHINATFVIN"
FT   CDS_pept        complement(365526..367043)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000112720" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21046257"
FT                   /locus_tag="CAGL0K03949g"
FT                   /product="Similar to uniprot|P40208 Saccharomyces
FT                   cerevisiae YMR135c"
FT                   /protein_id="CAG61358.1"
FT                   /db_xref="HOGENOM:HBG058814"
FT                   /db_xref="HOGENOM:HBG203442"
FT                   /db_xref="InterPro:IPR006595"
FT                   /db_xref="InterPro:IPR013144"
FT                   /db_xref="InterPro:IPR019589"
FT                   /db_xref="UniParc:UPI00003B6C37"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FMZ7"
FT                   /transl_table=1
FT                   /translation="MSDIRTDDNSSKSESLGRSSRISDGYKVYGNVTFSRDEWKGIVRK
FT                   YAKLGEMYNNKSVGAFESTNSNLKGSTGTRLSSNPSTQAGTMDLPSVREPSIPKLLLNY
FT                   FVTMAFEESSLRMAKELGYIQTNKDSIEFNSYYKIKERAHIIHLIKTGSISQAMDSIST
FT                   VFGVEVLENSVDTDLSVFAADKRSQVVQNINSKNDKNSLSSSDESEVDTYGDDDIHFKL
FT                   LLLNLIEMIRIQHIKIKSGEVTELDNKFILDLIAYSQEKLAMKAARNDKHMKELELTMT
FT                   LLLFPMQSLVDKKESPKLPESLRNLYSLSLRSHVADIVNRKLLKYIVNSNLMRDSPGKE
FT                   KFRDVSIIIDPRGYFLQSESMVNTNILKIKTKDEFKDDLYNDDRYKNNTKTFEKYKNEF
FT                   QNEDGSNNSLTGSNSYWAETTEMLRRQSNTTSSSDNDQSSYSENDNNDSKNKKQTTHNA
FT                   SKNGLLKEDGNLSEFQFEPKLVQIMRLWAWTENQLHVNDIGIPRVEN"
FT   CDS_pept        367761..368840
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000225141" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18502829"
FT                   /locus_tag="CAGL0K03971g"
FT                   /product="Similar to uniprot|P28737 Saccharomyces
FT                   cerevisiae YGR028w MSP1"
FT                   /function="ATP binding"
FT                   /function="nucleoside-triphosphatase activity"
FT                   /protein_id="CAG61359.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0017111"
FT                   /db_xref="HOGENOM:HBG460402"
FT                   /db_xref="HOGENOM:HBG724153"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="UniParc:UPI00003B6C38"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FMZ6"
FT                   /transl_table=1
FT                   /translation="MSRKFDLKAIADISVLVGTGISLYYLINRLLNDVENGPMSGRSKE
FT                   AREQQSQKWDKLVELNPDLKKVQLSSYERTILSSVVIAEDIDVTFNDIGGLDNVISDLH
FT                   ESVIYPLTMPEIYTNNPLLKAPSGVLLYGPPGCGKTMLAKALAKESGANFISVRMSTIM
FT                   DKWYGESNKIVDAMFSLANKLEPCIIFIDEIDSFLRERSSTDHEVTANLKAEFMTLWDG
FT                   LLNNGRVMIIGATNRINDIDDAFLRRLPKRFLVSLPNIEQRTKILEVLLGNTELDKANF
FT                   DLSLIAKCSGGLSGSDLKELCREAALNAAKEAMKEKRNLIQKGLEATEVKLRPLTTYDF
FT                   LINMKTIEAVQMLSQAPQD"
FT   CDS_pept        complement(369490..369963)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000115608" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18502830"
FT                   /locus_tag="CAGL0K03993g"
FT                   /product="Similar to uniprot|P53218 Saccharomyces
FT                   cerevisiae YGR030c POP6"
FT                   /function="nucleic acid binding"
FT                   /protein_id="CAG61360.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="HOGENOM:HBG123745"
FT                   /db_xref="HOGENOM:HBG204341"
FT                   /db_xref="InterPro:IPR002775"
FT                   /db_xref="InterPro:IPR020224"
FT                   /db_xref="UniParc:UPI00003B6C39"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FMZ5"
FT                   /transl_table=1
FT                   /translation="MEGRVQYEGTNVEIDLSNFSQCSEYIKNQILPTMLGEPNTEFNYI
FT                   TTKVSKNDKIKDKVSSLEKNVKDNNFVIIASYGDHIQKMVTIVEILKKNFAKDTKLHQW
FT                   NRLHSFEHIKPEKNELLEVRTKVPIMVTALSLADEKEAPQKLTMASNQFYRQS"
FT   CDS_pept        370244..371089
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000028067" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17444502"
FT                   /locus_tag="CAGL0K04015g"
FT                   /product="Similar to uniprot|P53219 Saccharomyces
FT                   cerevisiae YGR031w"
FT                   /protein_id="CAG61361.1"
FT                   /db_xref="HOGENOM:HBG502488"
FT                   /db_xref="HOGENOM:HBG748003"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="UniParc:UPI00003B6C3A"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FMZ4"
FT                   /transl_table=1
FT                   /translation="MIAPLLRKYSSQASALQLAYDHLPGKNSQLSPVVILHGLFGSKLN
FT                   NRTIGRGINSNLGRDVYLVDLRNHGSSPQSPMHDYQSMRLDLEKFVDDHKLENPIVMGH
FT                   SMGAKVAMQACLYNPKRYKMLISIENAPVNVMPNGKFVQYIDLLERQVGHQVTLKTVEE
FT                   RLSKLEKNELVLKFLMTMLRRDREGAIESKLPLGILREAIVKGKISEWDVKDRRYNGPS
FT                   LFIRGTESAYIADEYIVPISTYFPNFELRDVKGGHWINVENSSACIEYISEFIDRKEDI
FT                   "
FT   CDS_pept        373375..379068
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000216604" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19350611"
FT                   /gene_name="FKS2"
FT                   /locus_tag="CAGL0K04037g"
FT                   /product="Beta-1,3-glucan synthase catalytic subunit "
FT                   /function="1,3-beta-D-glucan synthase activity "
FT                   /biological_process="1,3-beta-D-glucan biosynthetic process"
FT                   /cellular_component="1,3-beta-D-glucan synthase complex "
FT                   /protein_id="CAG61362.1"
FT                   /db_xref="EMBL:ADO14236.1"
FT                   /db_xref="GO:0000148"
FT                   /db_xref="GO:0003843"
FT                   /db_xref="GO:0006075"
FT                   /db_xref="HOGENOM:HBG056034"
FT                   /db_xref="HOGENOM:HBG332273"
FT                   /db_xref="InterPro:IPR003440"
FT                   /db_xref="UniParc:UPI00003B6C3B"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FMZ3"
FT                   /transl_table=1
FT                   /translation="MSYDQGGNGNWQNTDPNGNYYYNGAENNEFYDQDYASQQPEQQQG
FT                   GEGYYDEYGQPNYNYMNDPQQGQMPQQQPGGYENDGYYDSYYNNQMNAGVGNGLGPDQT
FT                   NFSDFSSYGPPPFQNNQANYTPSQLSYSNNGMGSNGMNMSGSSTPVYGNYDPNAIAMTL
FT                   PNDPYPAWTADPQSPVSIEQIEDVFIDLTNKFGFQRDSMRNIFDLFMTLLDSRTSRMSP
FT                   DQALLSVHADYIGGDTANYKKWYFAAQLDMDDEVGFRNMNLGKLSRKARKAKKKNKKAM
FT                   EEANPEDAAEVLNKIEGDNSLEASDFRWKTKMNMLTPIERVRQVALYMLIWGEANQVRF
FT                   TSECLCFIYKCASDYLESPLCQQRTEPIPEGDYLNRVITPIYQFIRNQVYEIVDGRYVK
FT                   REKDHNKIIGYDDVNQLFWYPEGITKIVLEDGTKLTDIPSEERYLRLGEVAWNDVFFKT
FT                   YKETRTWLHLVTNFNRIWIMHVSVYWMYVAYNSPTFYTHNYQQLVNNQPVPAYRWASAA
FT                   LAGTVASAIQLFATVCEWWFVPRKWAGAQHLSRRFWFLCGILGVNLGPLIFVFAYEKDT
FT                   VQSKAGHAVAAVTFFIAVATVLFFSIMPLGGLFTSYMQKSSRRYVASQTFTASFAPLQG
FT                   LDRWLSYLVWVTVFAAKYSESYFFLILSLRDPIRILSTTTMRCTGEYWWGSKLCRHQSK
FT                   IVLGFMIATDFILFFLDTYLWYIVVNTVFSVGKSFYLGISILTPWRNIFTRLPKRIYSK
FT                   ILATTDMEIKYKPKVLISQIWNAIIISMYREHLLAIDHVQKLLYHQVPSEIEGKRTLRA
FT                   PTFFVSQDDNNFETEFFPRNSEAERRISFFAQSLATPMPEPLPVDNMPTFTVLTPHYSE
FT                   RILLSLREIIREDDQFSRVTLLEYLKQLHPVEWECFVKDTKILAEETAAYENEETQDPE
FT                   KSDALKTQIDDLPFYCIGFKSAAPEYTLRTRIWASLRSQTLYRTVSGFMNYARAIKLLY
FT                   RVENPEIVQMFGGNAEGLERELEKMARRKFKFLVSMQRLAKFKPHELENTEFLLRAYPD
FT                   LQIAYLDEEPPLNEGEEPRIYSALIDGHCEMLENGRRRPKFRVQLSGNPILGDGKSDNQ
FT                   NHALIFYRGEYIQLIDANQDNYLEECLKIRSVLAEFEELNAEPVYPYTPGVKYEDQKTN
FT                   HPVAIVGAREYIFSENSGVLGDVAAGKEQTFGTLFARTLAQIGGKLHYGHPDFINATFM
FT                   TTRSGLSKAQKGLHLNEDIYAGMNALLRGGRIKHCEYYQCGKGRDLGFGTILNFTTKIG
FT                   AGMGEQMLSREYYYLGTQLPVDRFLTFYYAHPGFHLNNLFIQLSLQMFMLTLVNLHALA
FT                   HESILCIYDRNKPKTDVLYPIGCYNFSPAIDWIRRYTLSIFIVFWIAFVPIVVQELIER
FT                   GLWKATQRFFRHILSLSPMFEVFAGQIYSAALLSDMTVGGARYISTGRGFATSRIPFSI
FT                   LYSRFASSAIYMGARSMLMLLFGTVAHWQAPLLWFWASLSALLFSPFIFNPHQFSWEDF
FT                   FLDYRDYIRWLSRGNNKYHKNSWIGYVRMARSRITGFKRKLIGDDSEKAAGDANRAHRT
FT                   NLILAELIPTAINAGSCFIGFTFINAQTGVKATDDDRVNSVLRVVLCTLGPIAVDVGVL
FT                   FFCLGMSCCSGPLFGMCCKKTGAVMAAVAHGVSVVIHIGFFIVMWVLEGFNFTRMLVGV
FT                   ATVIQCQRFIFQLMTILLLTREFKNDHANTAFWTGKWYGSGFGYMAWTQPMRELTAKVI
FT                   EMSEFAADFVLGHVILFAQFPVLCIPAIDKFHSIMLFWLKPSRHIRPPIYSLKQSRLRK
FT                   RMVKRYLTLYIIIFLVFAGAIVGPAVAASHVPQDIGHTLTGPFHNIVQPRNKSNNDTGL
FT                   QISTYSNHYYTHTPSLKTWSTIK"
FT   CDS_pept        complement(379642..380289)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000093236" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17444503"
FT                   /gene_name="TIM21"
FT                   /locus_tag="CAGL0K04059g"
FT                   /product="Mitochondrial import inner membrane translocase
FT                   subunit TIM21"
FT                   /biological_process="protein transport"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="mitochondrial inner membrane "
FT                   /protein_id="CAG61363.1"
FT                   /db_xref="GO:0005743"
FT                   /db_xref="GO:0015031"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG058380"
FT                   /db_xref="HOGENOM:HBG204342"
FT                   /db_xref="InterPro:IPR013261"
FT                   /db_xref="UniParc:UPI00003B6C3C"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FMZ2"
FT                   /transl_table=1
FT                   /translation="MVLRSRPLASIPRVQFYSSKGKSKGKTSGEKKPEHKKIPVWHKLK
FT                   ALTSFTASSLLVVGGVGVSGVVLYLILSELFSPSGDTMLFNRAVTLVEDNEEVRKLLQC
FT                   NDSSFKKERLKAYGELVTNDRWTRNRPIVSTQKIDKYGKCHHFMRFHLESKKKLGLVHV
FT                   EAVDSEQNYKPNFVSMYIDIPGEKRFYIIRPKLRQVVRPKSIFGFPWGSRKE"
FT   mat_peptide     complement(379645..380244)
FT                   /gene_name="TIM21"
FT                   /locus_tag="CAGL0K04059g"
FT                   /product="Mitochondrial import inner membrane translocase
FT                   subunit TIM21"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FMZ2 "
FT   transit_peptide complement(380245..380289)
FT                   /gene_name="TIM21"
FT                   /locus_tag="CAGL0K04059g"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FMZ2 "
FT   tRNA            380646..380717
FT                   /gene_name="tRNA-Arg (CCG)"
FT   CDS_pept        complement(381023..381727)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000201506" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21046258"
FT                   /locus_tag="CAGL0K04103g"
FT                   /product="Similar to uniprot|P53223 Saccharomyces
FT                   cerevisiae YGR036c"
FT                   /function="catalytic activity"
FT                   /cellular_component="membrane"
FT                   /protein_id="CAG61364.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG058366"
FT                   /db_xref="HOGENOM:HBG395435"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR016118"
FT                   /db_xref="UniParc:UPI00003B6C3D"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FMZ1"
FT                   /transl_table=1
FT                   /translation="MNATTHRNIIPFDDTYILYDPDDVLSFLSAYFSLLPILILTFYLS
FT                   WFIITRELESCIIALGQLCNEIMNNIVKNIIKQDRPYWVGDSFQENSIRSGYGMPSAHS
FT                   QFMGFTLSYFTLSLLVAPLSTNRKRSRFEAVSLFLILVVLSACVTFSRVYLHYHSVEQV
FT                   LVGFTLGLFNGSAYLLVVRVIRSLGLWNWLLSWPIARILYMKDNFNLAPVTLKQEYESF
FT                   WKTISSKSQKKE"
FT   CDS_pept        complement(381995..382255)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000261845" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19350612"
FT                   /locus_tag="CAGL0K04125g"
FT                   /product="Strain CBS138 chromosome K complete sequence "
FT                   /function="acyl-CoA binding"
FT                   /protein_id="CAG61365.1"
FT                   /db_xref="GO:0000062"
FT                   /db_xref="HOGENOM:HBG112574"
FT                   /db_xref="HOGENOM:HBG715417"
FT                   /db_xref="InterPro:IPR000582"
FT                   /db_xref="InterPro:IPR014352"
FT                   /db_xref="InterPro:IPR022408"
FT                   /db_xref="UniParc:UPI00003B6C3E"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FMZ0"
FT                   /transl_table=1
FT                   /translation="MVSQLFEEKAKAVNELPTQPSQDEMLKLYGLYKQATVGDNTKEKP
FT                   GIFNMKDRYKWDAWEKLKGMSQEEAEQKYIELVDELIAKYN"
FT   CDS_pept        383129..383776
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000192740" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21046259"
FT                   /locus_tag="CAGL0K04147g"
FT                   /product="Similar to uniprot|P53224 Saccharomyces
FT                   cerevisiae YGR038w ORM1"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAG61366.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG131632"
FT                   /db_xref="HOGENOM:HBG593106"
FT                   /db_xref="InterPro:IPR007203"
FT                   /db_xref="UniParc:UPI00003B6C3F"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FMY9"
FT                   /transl_table=1
FT                   /translation="MSDYKPFPAYQGNSNVSAQGSRLRSSSQVSTGASDPVKDHRRKRS
FT                   SSIISHVEQETFEDDVDQQLLPNMNASWVNQRGAWIIHIVVIVLLKMFYNILPGITAEW
FT                   SWTLTNMTYIIGFYIMFHLVKGTPFEFNGGAFDNLTMWEQIDHETLFTPSRKFLLAVPI
FT                   ALFLVSTHYAHYDLNLFLWNLAVTIFVGVVPKLAWAHRLRISIPGVMRAQIS"
FT   CDS_pept        384567..385763
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000233024" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21046260"
FT                   /locus_tag="CAGL0K04169g"
FT                   /product="Similar to uniprot|P14681 Saccharomyces
FT                   cerevisiae YGR040w KSS1"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="CAG61367.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG537393"
FT                   /db_xref="HOGENOM:HBG755340"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI00003B6C40"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FMY8"
FT                   /transl_table=1
FT                   /translation="MPRTITFNIPKEYKLVDLVGEGSYGIVCSATHLPTGNKVAIKRIR
FT                   FPDSPPSDDGQGVPRLEEDDEHDNIAKVALIRTIREIKILSHFNNHENIITIFEKIKPM
FT                   QSINFKEIYLVQELMETDLSRILASSNTLTVDHIQYFLYQILRALKAIHSAKVIHRDLK
FT                   PSNILLNSNCDLKICDFGLARTYDPDDDASTMNGNNVGFLTEYVATRWYRAPEIMLNFQ
FT                   DYSTAIDIWSCGCVLAEMLFRKPIFPGKDYHHQLLLILDTLGTPSPEDIEAINYGRAKE
FT                   YILSLPHFPKKDWSQLLGTDNEMLLDILDKLMIFNPKRRITAEQALEHPFLATYHDPKD
FT                   EPNFPPLNFKGDEFWQLDNCMETSNGYGTDDSNNLRANVTRRKLREILYQEMVTPAPR"
FT   CDS_pept        386857..388446
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20197396"
FT                   /locus_tag="CAGL0K04191g"
FT                   /product="Similar to uniprot|P53226 Saccharomyces
FT                   cerevisiae YGR041w BUD9"
FT                   /protein_id="CAG61368.1"
FT                   /db_xref="HOGENOM:HBG123746"
FT                   /db_xref="UniParc:UPI00003B6C41"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FMY7"
FT                   /transl_table=1
FT                   /translation="MSTSVSETDNVSNNSSASDRFSSNEDSQESHNRASSQPIFIEILS
FT                   TNSNSENGSYQVILNDTVINSTRNTPTKSGIKIPSNSTTPQHIVNGRSLSNTPKSNSSR
FT                   IRLEQPIPRAPAQVVQRPSMDSIQLDRSIHNASHASSIGTIATTALMNKTLSSDSISVT
FT                   QRNPNSSRISINQSKSPARKQSPSMAKPQLVHNKGKPILLSFDNKSPIEDSEDTPEGRL
FT                   KRNIKLEDSVRLLQEEFKSPSLHTAETATFSTKTKGVYPLEPEKALHSPKSPNRLSRDK
FT                   SSLLNDIPESELLEKIRNSQFLWSGLLKTDSDDTSSVNSEGSELSAQYNEKDVINSNGK
FT                   DSTRRNDGNAKDIPNIKQKRSSLSLNAENTKENTNNNSTFNLLSPEHFYNQNNNVNYDE
FT                   EKFIETSYHVHFKNTYQPIQYTDVYTVSSTDSETAGIFDMYSFWRLLILFLVCLCVPPL
FT                   FFLIAAGNRCGISDYRLMKMVILKKYRLYLYQGFIFNINLGWLRIICFVCGVAELLAAF
FT                   AGIAIGLGVGLT"
FT   CDS_pept        388756..389490
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21046261"
FT                   /locus_tag="CAGL0K04213g"
FT                   /product="Similar to uniprot|P53227 Saccharomyces
FT                   cerevisiae YGR042w"
FT                   /protein_id="CAG61369.1"
FT                   /db_xref="HOGENOM:HBG123747"
FT                   /db_xref="InterPro:IPR018838"
FT                   /db_xref="UniParc:UPI00003B6C42"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FMY6"
FT                   /transl_table=1
FT                   /translation="MSAIVQEYCCQYTDQVRKKHKTWHDGKLKFYTENNRFILYSDPDS
FT                   TLLSSAFVTNSKELESILDQGSFGSAEHRIFGRYIVILEDLISEQHNDPSSAVRKPVVK
FT                   ITKKFHVPNLETTSPLKINNRLISGRFSSGDTKGKTSHMGIEASQLTLKFNKKYKRPTI
FT                   MRQTGNSLLDSDLSKTCDKNNALSAASLENNSKNKDPLLCDNSEPNCTNSERKKGRPSS
FT                   FKVQKRLGRIRKIEHKPINIPQ"
FT   CDS_pept        complement(389609..390607)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000281234" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17444504"
FT                   /locus_tag="CAGL0K04235g"
FT                   /product="Strain CBS138 chromosome K complete sequence "
FT                   /function="transaldolase activity"
FT                   /biological_process="pentose-phosphate shunt"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAG61370.1"
FT                   /db_xref="GO:0004801"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006098"
FT                   /db_xref="HOGENOM:HBG001532"
FT                   /db_xref="HOGENOM:HBG286747"
FT                   /db_xref="InterPro:IPR001585"
FT                   /db_xref="InterPro:IPR004730"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018225"
FT                   /db_xref="UniParc:UPI00003B6C43"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FMY5"
FT                   /transl_table=1
FT                   /translation="MSTENGGNSTLENLRNAGTNVVTDTGEFELISKFKPRDSTTNPSL
FT                   ILAATKNPNYASLIDVAIDYAKAKGGTIEQQTNNAADRLLVEFGKRITDLIPGVVSTEV
FT                   DARLSFDKKGTVDKALQIIKLYEENGVSKDRVLIKIASTWEGIQAARELEAQHGIHCNL
FT                   TLLFNFTQAVACAEANVTLISPFIARVLDWYKANTKNDYNIENHPGVLFVKKTYNYYKK
FT                   HGYKTIIMGASFRTLDEIRALAGLDNATLGIPLLENLQNSTEKIDRVLTPEGAQKDGVD
FT                   MITLIDDEAKYRYEFNSDAMAVEKLADGIRTFAKDTNTLYSLLRTKLEKAN"
FT   CDS_pept        complement(392116..393759)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20197397"
FT                   /locus_tag="CAGL0K04257g"
FT                   /product="Similarities with uniprot|P32338 Saccharomyces
FT                   cerevisiae YGR044c"
FT                   /function="nucleic acid binding"
FT                   /function="zinc ion binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAG61371.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG123748"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="UniParc:UPI00003B6C44"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FMY4"
FT                   /transl_table=1
FT                   /translation="MLRTKDSGFAFLYSNSKSDNDIIAFPSSFNVLTELQRKQPYDSND
FT                   YFDMEYTGSNGLRLGEHDILPPNFTTIDIAIDNEDDEEEGDQNTICSNTLRRTCSAYNT
FT                   NSKDGLCSGDQNCMGGMNMMLMQFKNQYLAGQGISRANVPQQQQNDNTFDYDEQHYTSG
FT                   LPTPTESAGIIRSCLTSPLDFAATIKTEPYVNNTTLLLSQSGPPLSQSSNMPDLLHRER
FT                   SHTLANITPISLSSSSKDDSYFTATVDTKRHSIPMVNTRGVIKKEEPDYSVLQPQHAHI
FT                   DDVSGYGEISAGTSSYRNMVSQWTSGTEPTFNDAVSVGPLSCSMNNASRCDMDVNCHTN
FT                   SDELPLSNINLAMGPTVDSTTDYQSMKDNLSAGCSNDTNGKSLVKQLLEDPYLSDIIQK
FT                   PQKRGLYRCAHCPSTFNNIFEYASHLDEYEVERKHKCPFKNCAWRILGLPRRSDLRRHC
FT                   AIQHKYELYGQLKKDLNLTEDAYPVLRCPVMFCQKEFYRKDAYKRHIAIVHENTSSRFN
FT                   KRLKRIIKECPHFETEEERFNFIRDKVRNK"
FT   CDS_pept        397602..398156
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000951" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18502831"
FT                   /locus_tag="CAGL0K04279g"
FT                   /product="Similar to uniprot|P32564 Saccharomyces
FT                   cerevisiae YGR049w"
FT                   /protein_id="CAG61372.1"
FT                   /db_xref="HOGENOM:HBG123749"
FT                   /db_xref="HOGENOM:HBG204351"
FT                   /db_xref="UniParc:UPI00003B6C45"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FMY3"
FT                   /transl_table=1
FT                   /translation="MTNPELITTTKCIGVTSLGLYAGLLTSTSLITSATPLDVLTGSLK
FT                   NLLCKIGCWATAFGSVSTISLAVSYFLSEKPQRSNTRLAGALIAPITGLYLYASSLANH
FT                   GCCPSKAKESGLPEGHPQVGADAPVCPFSKTTDGSNGSFHKGSIKSDKCYNALLCHLTV
FT                   VTLTTCGVFAKSVFDGFQGLL"
FT   CDS_pept        405248..406315
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000065991" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17444505"
FT                   /locus_tag="CAGL0K04301g"
FT                   /product="Similar to uniprot|P53233 Saccharomyces
FT                   cerevisiae YGR052w"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="CAG61373.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG204352"
FT                   /db_xref="HOGENOM:HBG537393"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI00003B6C46"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FMY2"
FT                   /transl_table=1
FT                   /translation="MPDKSNKYKKLNPIQSGSFSTVYKGYNTETDDFVALKVIPKSKFS
FT                   QRGMANEYNVGKLLSKDEGCPFICSFVDFYEDETNYTLVQEYCECGDFYDFLELSKKKG
FT                   DLNAPSIIKLNFQKVVLQLSYAIKYAHSMGIAHRDIKPENILINYHGDIKLADWGHAIS
FT                   ASSSNDNNIGTDNYRGPETFSAKVSYNTYRSDYWSMGVTLLYLLFSHCPFRCSNIKNEK
FT                   IVYKRLENGETLVYPNCHIFNNYVSDPYKFIYESFFSSVSLSRRRKLFKSSSTKYVAPF
FT                   LWQDMTDMHDMLQMTKIIVDNLMSPNPSKRSLTRFLKHFNAFWTAHQENDIESASSVRN
FT                   IKSNNLKVLGVSGNY"
FT   CDS_pept        complement(407084..407905)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000952" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19350613"
FT                   /locus_tag="CAGL0K04323g"
FT                   /product="Similar to uniprot|P53234 Saccharomyces
FT                   cerevisiae YGR053c"
FT                   /protein_id="CAG61374.1"
FT                   /db_xref="HOGENOM:HBG123750"
FT                   /db_xref="HOGENOM:HBG204353"
FT                   /db_xref="UniParc:UPI00003B6C47"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FMY1"
FT                   /transl_table=1
FT                   /translation="MLKRYHYARRIRLNHIRDLNQKRFIVSNYDDPNDVNYGQMTDYLR
FT                   EKGVPLLLQENLKEETLDDAIVLRLLPSTHPYIPNLHGILQYKTSMNAIRLIMRKFVLE
FT                   ENSRLKVLSSRRIRGDDDQIKYQCNISPYLTNHDKLLIRWQSCLPQTAGTVEPDEEDMN
FT                   KTISFSSNDVLRTQTSSGESPILDYILQKPAKTISTLAPNVLSKHITLGNRISAMNNDD
FT                   SLDNEYTRIVNGTFVFEFNEDNSKILVHTIENVELIDYERKINVPKNAFAC"
FT   CDS_pept        409067..411010
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000193775" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19350614"
FT                   /locus_tag="CAGL0K04345g"
FT                   /product="Similar to uniprot|P53235 Saccharomyces
FT                   cerevisiae YGR054w"
FT                   /protein_id="CAG61375.1"
FT                   /db_xref="HOGENOM:HBG063743"
FT                   /db_xref="HOGENOM:HBG409391"
FT                   /db_xref="InterPro:IPR011387"
FT                   /db_xref="InterPro:IPR013979"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniParc:UPI00003B6C48"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FMY0"
FT                   /transl_table=1
FT                   /translation="MSSQFFLKTSKDIELFQGYPDFTQSNSAANAKDDQVISSVLSPCG
FT                   RFFAISTKGNVKVFSGELLEVELLNLTINDVYEIQFSPSGNYMSTWERPSAKDAEHKNV
FT                   KVWYLNKVFTEGEEQEPVFQYQHKPQNGWFMQFSKLDDYALKMFKNEIRIVKINDANKT
FT                   NFHFDQPFATLSKTQENDSQPFSTYQVSPADFPTICTFTPEKGGKPAQLSIWSITEGKI
FT                   TKKIASKTFFKADSCQLQWNPQGNAVLCVATTDFDSTNKSYYGENTLYLLSFQGVNGAV
FT                   GNNSVRVSLAKGPVHDISWSPTSRQFGVISGYMPATIQFFDLRGNVVHSLEKQPKNTIL
FT                   FSPSGRYILIAGFGNLQGSVQILDRHDKFKSLTVFNAANTSVCKWSPGGEFIMTATTSP
FT                   RLRVDNCIKIWHVSGTLVFAKEFEELLKVDWRNTCKYKTLKDHPHVIKDWTPLNNTDAA
FT                   SLDPQIASPKKDLAIHESAKEYEAKHPKRDAKTGNGSTQSKSASTGGAYKPPHARRAAA
FT                   VANNRSVPGASPKVQRAIPGLIPGLPVNEGSAAANKNRKRRANKKANSGTGEGAEKAES
FT                   PAAPSITSTEPAKEASPEEKKIRSLLKKLRAIEMLKEKQAAGEKLQDLQVKKIETEGKF
FT                   REELAALGWKEE"
FT   CDS_pept        413033..414781
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000187297" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17444506"
FT                   /locus_tag="CAGL0K04367g"
FT                   /product="Strain CBS138 chromosome K complete sequence "
FT                   /function="amino acid transmembrane transporter activity "
FT                   /cellular_component="membrane"
FT                   /protein_id="CAG61376.1"
FT                   /db_xref="GO:0015171"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG177066"
FT                   /db_xref="HOGENOM:HBG448377"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniParc:UPI00003B6C49"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FMX9"
FT                   /transl_table=1
FT                   /translation="MTDNKRSFLSQLNVFNKDNYQISSKKSEEGVYSNETEEASDVETG
FT                   QQFTTELDQGEKRLGLFSCIGLICNRMLGTGVFAVSSTIYTLSGSIGLALILWAVGAII
FT                   AISGLYVYMEFGTAIPKNGGEKNYLEAIVKKPKFFITCMYASYVFFLGWAAGNSVNTAV
FT                   MFLTAADAEITKWNQRGIGVAVVFFCFAVNAISVKAGLYLQNLLGIFKVGIVLFISVTG
FT                   WVALGGGLKHGYQSHNFHNAFEGTNKATAYGVVNALYNVIWSFVGYSNVNYALGEVKDP
FT                   VRTLKIAGPTSMVCLAIIYIFVNIAYFAVVPKEKLISSKLILAADFFDICFGGHSKRVA
FT                   AALVGLSALGNVMSVIFSQGRIIQQLGREGVLPFSNFFASSKPFNSPMVGLFQHFIICM
FT                   ITIIAPPPGDAYNIILNLISYPMNIVNFVVSAGLLWIYWQRRQGKIEWNPPIKAGVFVT
FT                   TFFMLSNIYLIVAPYVPPTHGESVYEHAPYWIHCVVAWGIFAFGGFYWFVWVKVLPKWG
FT                   NYRLETKDILGEDGFWRVQVIKVPNETDKDHQEQSDESGTERADTFELDYIHLEPSKDT
FT                   AKSHLD"
FT   CDS_pept        415639..418443
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000247903" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20197398"
FT                   /locus_tag="CAGL0K04389g"
FT                   /product="Strain CBS138 chromosome K complete sequence "
FT                   /function="DNA binding"
FT                   /protein_id="CAG61377.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="HOGENOM:HBG190514"
FT                   /db_xref="HOGENOM:HBG204354"
FT                   /db_xref="InterPro:IPR001025"
FT                   /db_xref="InterPro:IPR001487"
FT                   /db_xref="UniParc:UPI00003B6C4A"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FMX8"
FT                   /transl_table=1
FT                   /translation="MSEEGEFGELRTDLRKQYEAIFSLKEESGANIFPIFNVLPIKKDY
FT                   PDYYAIIKNPISLNTLKKRLPHYTSPQDYVNDVSQIPWNAKTYNSKGSLIYIYADILEK
FT                   FLRNVSVPQLQAKYTNVNYPNLGPLPDEIEEMKKKEAMMKIRTASASPVALGNANEVPA
FT                   RSGSNSPLPLTSMSNTPQPVTEVKQPIPQQNGGINGYNTSRQNMAMQGNNSTANRRMEQ
FT                   TVISMGPSRVPMAQISSRVSPHPILPNRSMSSTPISHSPGAILKPSIQQRLQTRRGRPP
FT                   IIDLPYLLRIKNIMKMIKREVDDNNQTLTLTFEKLPDPERHPAYRQIISNPVCLDDIRR
FT                   RVKTRKYKNFGSFQDDFTLMIENYKKYNQNNPMLLNTARLMEYHFRKLVEIELSKPDSD
FT                   FLPEGELRYPLENIEVRGKIYEIGDWVLLNNANDPNKPVVAQIFKLWYTSDGTKWLNAC
FT                   WYFRPEQTVHRVDRLFYKNEVVKTGQYRDHLINDLIGKCYVVHFTRYQRGNPATPYEGP
FT                   LFICEFRYNESDKVFNKIRTWKACLPEELRDQDEETIPVNGRKFFKYPSPIRHLLRPDA
FT                   TPHDRIPEPTEGDPTAPPLVGAVYLRPKVERDDLGEYSTSDDCPRYIIRPGDPPESGII
FT                   DEVHGTIITSMQTANALPRTSQSTSRLPALKQTKSAASNENMVQPTKGMSYQKPIPPVA
FT                   SNRTMQSHKVPVSTLPQRPEQTIQPQKLSTVEALRQGPIPTNISSVSLNEAVNDMSQQA
FT                   AKSGMRYVTIDVPHSYVLPMAGIPKHNEVMTTDDANRLRGSRYQANNSQSEILWFRGPS
FT                   ISIKERYVDSMNSFNSLDLNRLTVHKKRKLDYEEIEEQGVDTHMSIDDKGNVTTEASPE
FT                   GLLTQGNDMHMDSAHQSDDDDDNAEEEGHLSEKLISTSTIGLRPSAKFIIHKHKYSTIE
FT                   NIIT"
FT   CDS_pept        complement(418596..419447)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000953" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20197399"
FT                   /locus_tag="CAGL0K04411g"
FT                   /product="Similar to uniprot|P53237 Saccharomyces
FT                   cerevisiae YGR057c"
FT                   /protein_id="CAG61378.1"
FT                   /db_xref="HOGENOM:HBG058158"
FT                   /db_xref="HOGENOM:HBG204355"
FT                   /db_xref="InterPro:IPR021713"
FT                   /db_xref="UniParc:UPI00003B6C4B"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FMX7"
FT                   /transl_table=1
FT                   /translation="MILISLGHFCDIHGPTIIIVTQEGEIGNSGNELLLPDYPTESYCE
FT                   SCMVKIPDCDGSDENGADVDTEAEVSTTDTISENTLLPASNVPRSIRSKLGEKSFVSSQ
FT                   YSAIRYQLLTSMIRKAFSEETMIYDGSPSVFYDESKGLNLVMGFKLHDPNARGNERRYC
FT                   LILTIESVDETNAMGLIAAHWHFIVGGFSMMINAIKEKHAQNNDGLESNHDLQKNFTQD
FT                   IGNYLRANKGKCARNLSELTNDKFTFLRIHKWNTYMIDTLCSKLQRADQSSVIKERSKH
FT                   AS"
FT   CDS_pept        420248..421333
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000111928" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19350615"
FT                   /locus_tag="CAGL0K04433g"
FT                   /product="Similar to uniprot|P53238 Saccharomyces
FT                   cerevisiae YGR058w"
FT                   /function="calcium ion binding"
FT                   /protein_id="CAG61379.1"
FT                   /db_xref="GO:0005509"
FT                   /db_xref="HOGENOM:HBG123751"
FT                   /db_xref="HOGENOM:HBG204356"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR018249"
FT                   /db_xref="UniParc:UPI00003B6C4C"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FMX6"
FT                   /transl_table=1
FT                   /translation="MCARKLKYAAGDDLLLYATPKEAMQNTKRNEEDKKPRVRKPNVRT
FT                   PSEPGMGQPMPTGRSSGDYVHGASYVPKHQSLSQPQLQQMPIPNAYSSSKTRPIPQQMI
FT                   GNPVQNLRGNNYGGQGRIVSSPPAMVPPSAAMQRAQAQVSHTPPRIANKSPEVAQNAML
FT                   SRTKGALRDSSQTLSEEDAKDTRIAIQLFHNHDVRGKERLTAEELQNLLQNDDNTHFCI
FT                   SAVDALINLFGATRFGTVNESEFISLYKRVKKWRKIYVDNDINGSYTITMSEFHNSLQE
FT                   LGYMVPVEVSEKLFDQYAEFINPANNAKELKFDKFVEALVWLMRLTKLFRKFDKNQDGV
FT                   AHIQYKEFIDVTLYLGRFLPH"
FT   CDS_pept        421791..423104
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19350616"
FT                   /locus_tag="CAGL0K04455g"
FT                   /product="Strain CBS138 chromosome K complete sequence "
FT                   /function="GTP binding"
FT                   /biological_process="cell cycle"
FT                   /cellular_component="septin complex"
FT                   /protein_id="CAG61380.1"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0007049"
FT                   /db_xref="GO:0031105"
FT                   /db_xref="HOGENOM:HBG123752"
FT                   /db_xref="InterPro:IPR000038"
FT                   /db_xref="InterPro:IPR016491"
FT                   /db_xref="UniParc:UPI00003B6C4D"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FMX5"
FT                   /transl_table=1
FT                   /translation="MIDDNSYELDSLDYLNDASFVLFGEGQIFKEDRRVKPAQDVQRRK
FT                   MLFEELDIGLSMILGQIDKRYAREGMIFNLMVAGRSGVGKTTFINSLFETELIPPTQHQ
FT                   EHGSLPLENYHFLLQNHDGSVNLKLQIVDTPGYANKINNNYCWVPLINYLDEQMTRYVF
FT                   QEEQPYREEEKRDSRVHCCLYFIEACDTQLHPIDIISMRELSSRCNLIPVLSKSDYLTE
FT                   AELTAVKQRVKDVIRLQNIKICRFFQSRDKTKEVYGNVPYCVKIQSMVYHWQKNVIRPL
FT                   EFKTSFDKLQFNELRDLIFGETCTEFVESTETYYERCRQYLLEYRIKNARDDVENNTDL
FT                   RGLQEYLLYHSVAKSRVDEEMTVFTNPTYLDKVSALKQKYTERLIAEDGVFDKWVERLA
FT                   RTQKNFNLEIKNLQSQINAIKETTKVRSTSNATLVQEM"
FT   CDS_pept        424537..425463
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000162289" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17444507"
FT                   /locus_tag="CAGL0K04477g"
FT                   /product="Similar to uniprot|P53045 Saccharomyces
FT                   cerevisiae YGR060w C-4 methyl sterol oxidase "
FT                   /function="iron ion binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="fatty acid biosynthetic process "
FT                   /biological_process="oxidation-reduction process "
FT                   /cellular_component="endoplasmic reticulum"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAG61381.1"
FT                   /db_xref="GO:0005506"
FT                   /db_xref="GO:0005783"
FT                   /db_xref="GO:0006633"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG069422"
FT                   /db_xref="HOGENOM:HBG325679"
FT                   /db_xref="InterPro:IPR006694"
FT                   /db_xref="UniParc:UPI00003B6C4E"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FMX4"
FT                   /transl_table=1
FT                   /translation="MSAVFNNATLTDLVREDTYFKTLANIGKFQPQLNFMEQYWAAWYT
FT                   YMNNDVLATGLMFFLLHEFMYFFRCLPWFIIDQIPYFRKWKLQPTKIPSTKEQLYCLKA
FT                   VLLSHFLVEAIPIWTFHPMCEKLGITVEVPFPSIKKMSLEIALFFVLEDMWHYWAHRLF
FT                   HYGVFYKYIHKQHHRYAAPFGLSAEYAHPLETMSLGFGTVGMPILYVMYTGNLHLFTLC
FT                   VWITLRLFQAVDSHSGYDFPWSLNKFLPFWAGAEHHDLHHHYFIGNYASSFRWWDYCLD
FT                   TESGPEAKVAREERMKSKAEQKAKKTN"
FT   CDS_pept        complement(425890..429930)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000261359" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17444508"
FT                   /locus_tag="CAGL0K04499g"
FT                   /product="Strain CBS138 chromosome K complete sequence "
FT                   /function="phosphoribosylformylglycinamidine synthase
FT                   activity"
FT                   /biological_process="'de novo' IMP biosynthetic process "
FT                   /protein_id="CAG61382.1"
FT                   /db_xref="GO:0004642"
FT                   /db_xref="GO:0006189"
FT                   /db_xref="HOGENOM:HBG021760"
FT                   /db_xref="HOGENOM:HBG335309"
FT                   /db_xref="InterPro:IPR000728"
FT                   /db_xref="InterPro:IPR010073"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="UniParc:UPI00003B6C4F"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FMX3"
FT                   /transl_table=1
FT                   /translation="MAFVQPGPQALSPFRVENLIQDINNVTGSNSIKVVRSCYIHYAQV
FT                   LTELSAEQKNVLEVLLTYDSPLDTQNDEYSKQLFDAIKEDKVGSDLGDDTYLIRILPRA
FT                   GTVSPWASKATNIAAVCGLDHSIKKIERGVALLIKVIPGFPIADHLNELSLKSVFDRMT
FT                   QTLYINEIPPMSALFHFELPKDITTFPLVSDEATGSPKELLQKTNKDLGLALDAGEIDY
FT                   LVHVFVEVLKRDPTDVELFMFAQVNSEHCRHKIFNADWTIDGLKKDLSLFQMIRNTHKT
FT                   TPDYIISAYSDNAAVVDTENQGFFFAPDSTTKEWKATKETIPMLIKVETHNHPTAVSPF
FT                   PGAATGSGGEIRDEGATGRGSKTKCGLSGFSVSDLLIPGHKQPWELDIGKPSHIASSLD
FT                   IMIEAPLGSAAFNNEFGRPCINGYFRTLTTKVKNTQNKEEIRGFHKPIMIAGGLGTVRP
FT                   KFALKNKPITAGSPIIVLGGESMLIGLGGGAASSVASGEGSAELDFASVQRGNPEMERR
FT                   CQQVIDACVSLGDANPIQSIHDVGAGGLSNALPELVHDSGLGAKFDVRRVLTLEPGMSP
FT                   MEIWCNESQERYVLGCSQKDLPIFEEICKRERAPYAVVGFATSENRLLVEDSFLETTPI
FT                   NLDMSILFGKPPKMSREAKTEPLKLPTADLKVIPSLDEAVKRVLNLPSVASKSFLITIG
FT                   DRSVTGLIDRDQFVGPWQVPVADVGVTNTSLGDSICKTGEALAMGERPVNALISAAASA
FT                   KLSVAESLLNLFAADVKSLKHVKLSANWMSPASHQGEGSKLYEAVQAIGLDLCPELGVS
FT                   IPVGKDSMSMKMKWDDKEVTAPLSLNITAFSPVSDTSKTWTPLLKKDSDSVLVLVDLAA
FT                   KKEKSLGGSALLQVFNQVGDSSPTVHDNRTLRGLLEAIIELHNSDIVQAYHDVSDGGLL
FT                   VTLLEMAFASRCGLNVKIPVQDDAVFKSLFSEELGAVFQISASKLETFQQILSKHNVTD
FT                   EYIEIVGSPDFNSQQIKIADANDSVIFEDTRGKLQQVWSSTSYQMQRLRDNPKYADEEF
FT                   ANILDDKDPGLHYTLTFDPSDDLEIPKTLNTIRPKVAILREQGVNGQMEMAWCFQQAGF
FT                   NSVDVTMTDLIDGRVHLDDFVGLAACGGFSYGDVLGAGAGWAKSVLYHEGVRQQFVKFF
FT                   QEREDTFAFGACNGCQFLTRLKDLIPGCENWPTMERNFSEQYEARVCMVEITDETGNEK
FT                   SVFLNGMGGSKFPIAVAHGEGRAKFANDGALQKFESGDLGSIRYVDNYGNVTQRFPYNP
FT                   NGSVNGIAGIRSPNGRVLAMMPHPERVCRLEANSWYPEGKFGEWKGYGPWIRLFRNARK
FT                   WVG"
FT   CDS_pept        complement(430693..431646)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000000954" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17444509"
FT                   /locus_tag="CAGL0K04521g"
FT                   /product="Strain CBS138 chromosome K complete sequence "
FT                   /biological_process="protein insertion into membrane "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAG61383.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0051205"
FT                   /db_xref="HOGENOM:HBG059639"
FT                   /db_xref="HOGENOM:HBG397443"
FT                   /db_xref="InterPro:IPR001708"
FT                   /db_xref="UniParc:UPI00003B6C50"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FMX2"
FT                   /transl_table=1
FT                   /translation="MLRSTIVPRGFSQIPKRHILGNQPYFRPSSRRSISTFQTIADTFT
FT                   TLHDVSGIHWVVLIPVTTFALRTVFTLPLSIWQRRRIVKQQELRKLVAPISSIVKMRLA
FT                   VTSKSAKEKRLESGSDITIAKPVGGLSAENLTPEQITLLAVKETRKRQKLLFKKYGVQM
FT                   WKNAVLPLVQIPLWVTVSMGIRTLTENPLREKLYNNGWLSSVGIDENLYLSEPLEAYPF
FT                   AVPLVLGTLSMLNVEYNGKVIQGDSAKNLGLKLRADNSRLQLGIQTILNVTRIGTVFMM
FT                   GFSSQTALLLSLYWISSQLYSLLQNIFLNWLWPYQR"
FT   CDS_pept        complement(432032..432340)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000172685" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17444510"
FT                   /gene_name="SPT4"
FT                   /locus_tag="CAGL0K04543g"
FT                   /product="Transcription elongation factor SPT4 "
FT                   /function="positive transcription elongation factor
FT                   activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="mRNA processing"
FT                   /biological_process="positive regulation of transcription "
FT                   /biological_process="transcription"
FT                   /cellular_component="chromosome, centromeric region "
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG61384.1"
FT                   /db_xref="GO:0000775"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006350"
FT                   /db_xref="GO:0006397"
FT                   /db_xref="GO:0008159"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0045941"
FT                   /db_xref="HOGENOM:HBG020823"
FT                   /db_xref="HOGENOM:HBG623003"
FT                   /db_xref="InterPro:IPR009287"
FT                   /db_xref="InterPro:IPR016046"
FT                   /db_xref="InterPro:IPR022800"
FT                   /db_xref="UniParc:UPI00003B6C51"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FMX1"
FT                   /transl_table=1
FT                   /translation="MSSERACMLCGIVQTTNEFGRVGCPNCQGIFEEAGVSTMECTSPS
FT                   FEGLVGMCKPTKSWVAKWLSVDANIPGMYAVKVDGRLPPEVVELLPHYKPRDGSQVE"
FT   CDS_pept        complement(432738..434600)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000179304" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17444511"
FT                   /locus_tag="CAGL0K04565g"
FT                   /product="Similar to uniprot|P53241 Saccharomyces
FT                   cerevisiae YGR065c Vitamin H transporter "
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="CAG61385.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG056374"
FT                   /db_xref="HOGENOM:HBG398100"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="UniParc:UPI00003B6C52"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FMX0"
FT                   /transl_table=1
FT                   /translation="MSISKVLKKVIPTVRILPEEMDDVSSTTSVASDLSSVEEIGTEVV
FT                   AKKDDNDKEQNTHGLNNVKKTQIEYTVESDIEDCSDSESDNAGYNAKHINLKKDMPYEL
FT                   RDEAKRSKWNFFYEYEYRFNKEYRKSRRWYEFLYPNHATKSKAERRLLYKIDFLIGFYF
FT                   LVVSWTRSVDSANYVNAYVSNMKEDLHMGGNDYVYTSTISTIGQIVFQIPFMYLMPRVP
FT                   PHYLLPFMDLGWSAFTLACFRAKTLKEMQGYRFMVGSFGAAYYPVSQYIFGSWYAPDEL
FT                   TSRVLLFSYGQLLGSVTSGLLQAKIFKSLDGVCGLAGWRWMFLIDAIAISIPTAIMGFF
FT                   LIPGIPSKCYSLFLTDEEIRIARARNRRNNITDGVDKSKLVPLYKPALWKKVLFNPTFW
FT                   ILAIFDMLSWNVMTIYTGSYTQWLKSNPNYSIVKVNNLSALPACLGFIYITVCALGSDL
FT                   FRSKWFFMVFAQAMNCISCGILMKWDVAESTKWFAFLISYFCIGASACLWTFINDFLRF
FT                   DPQIKAMSWICNYMFSQSSHAWIPMLAWKTVDSPRYKTGYTVSLVFSILYGLWTFVVLF
FT                   FYKNNEKKHALDNGIILYDSSKGENPPAFVNEHMREEDGYFFVK"
FT   CDS_pept        join(437099..437231,438004..438263)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000204097" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21046262"
FT                   /gene_name="RPS22"
FT                   /locus_tag="CAGL0K04587g"
FT                   /product="40S ribosomal protein S22 "
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="CAG61386.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG192816"
FT                   /db_xref="HOGENOM:HBG735443"
FT                   /db_xref="InterPro:IPR000630"
FT                   /db_xref="UniParc:UPI00003B6C53"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FMW9"
FT                   /transl_table=1
FT                   /translation="MTRSSVLADALNAINNAEKTGKRQVLIRPSSKVIIKFLQVMQRHG
FT                   YIGEFEYIDDHRSGKIVVQLNGRLNKCGVISPRFNVKIGDIEKWTANLLPARQFGYVIL
FT                   TTSAGIMDHEEARRKHVSGKILGFVY"
FT   mat_peptide     join(437102..437231,438004..438260)
FT                   /gene_name="RPS22"
FT                   /locus_tag="CAGL0K04587g"
FT                   /product="40S ribosomal protein S22 "
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FMW9 "
FT   CDS_pept        complement(438628..440457)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000179304" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17444512"
FT                   /locus_tag="CAGL0K04609g"
FT                   /product="Similar to uniprot|P53241 Saccharomyces
FT                   cerevisiae YGR065c H+/biotin symporter "
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="CAG61387.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG056374"
FT                   /db_xref="HOGENOM:HBG398100"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="UniParc:UPI00003B6C54"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FMW8"
FT                   /transl_table=1
FT                   /translation="MGIKWKKFIPHLRVLPEDLEGDVSSDNNSSIEEHIHHDDSKSIDD
FT                   DKYHESHVVYAVDTSSNNANGKSSLPINSAHGSVKLQKGIPYELRDEANKSRWKFFDEY
FT                   EYRLNKEYRKSRKWYEFLYPNHISQSKAERRLLYKLDIIVALYFLIVNWSRSVDSSNYT
FT                   NAYVSHMKEDLHFKGNDYIYTSTIANVGSIVFQLPFIYILPRFPAHYVLPIMDFGWSWF
FT                   TFACYRAKSLPELRAYRFILSSFGAAYYPVAQYLMGCWYAPDEISSRVCLFFCGQLLGS
FT                   VTSGLLQARIFKSLNGVHGLAGWRWMFLIDAIAISIPTAILGFFVIPGIPSKCYSLFLT
FT                   DEEIRIARARNKRNQIVDGVDRSKLPHIWSWKVWKKVFFTPTFWVLVIFDLCSWNNMTA
FT                   YSGSYTLWLKSNTSYSIEKVNNLSVLPACLGFAFVFFCAFGSDLFRNKWPFMVFSQCMN
FT                   CISCAILIKWDVASSTKWFAFLITYFSVAASPCLWSFINDFLRHDPQVKAITWIAIYSI
FT                   SQSTYAWIPTLTWKTVDAPRFKTGYIASLIFSAIYGLWTFVVLFFYKRNEKKNALGNGI
FT                   ILYNSSKGESPPTFVETDMVLKNGYYYVKEDCE"
FT   CDS_pept        complement(441550..444591)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20197400"
FT                   /locus_tag="CAGL0K04631g"
FT                   /product="Similarities with uniprot|P53243 Saccharomyces
FT                   cerevisiae YGR067c"
FT                   /function="nucleic acid binding"
FT                   /function="zinc ion binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAG61388.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG123753"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="UniParc:UPI00003B6C55"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FMW7"
FT                   /transl_table=1
FT                   /translation="MQDQPTGKTKRHFCSFCNKAFSRSEHKTRHERSHAGVKPFECQVC
FT                   SHSFVRRDLLQRHIRTVHRILLLRDTGAPSQENEKDATFNVNNVDKLINSMIIVNNTVN
FT                   VGNSTLDSNDTDSSNAQIGATGDHVDQTDDNNGKVTHYTFQPENGKLPQGQATDGQKVR
FT                   SNSVASENRQSQRVSNGYNVKNRVKSKFLSFKQKDLTFGEHGDEAGIISIDYTNNLVLS
FT                   NFSESDISMIIESVESNPNLELLLLIIHIMERKYPHAETSKRILTRVLSFTGITFIESK
FT                   LIAAIQVRYSLLSQRDENLLKFYSLYQDQILEFNDFSVFNLNQWTCLSDFLNASKNQNA
FT                   LVIYQQFKRKFLLDKKSILMPYEILNLLDIESKKKLRNLNNLDYFTNLTYWESVLLNDN
FT                   NFDLLIQLNKNYMRVFENGQQSNLYCLTSFNSKPDGKHCYNYRILSESNWLLLKLLCWN
FT                   KDVNLQDSLNSVKHDICNALIPLMNTLIDSRERLFSIKNDNSKISLIIDALFFQLELFS
FT                   VQLLPKTQENMEGISEFLCNESLQKLIYFWYMTITKTFGKFKTNDKRLKLIKQFINSYI
FT                   KSNTLISGNKKRKLNSGSGTDSPSHEENLKRLEDDLSVILYDMWSNEYQGYHFLIDTVV
FT                   KCIKDDLIEARVLQILDNDCEDVKVKLIDAALRAINNIEFAIKSSESQYVSTLKHRRGS
FT                   TSKSIALPISHDKPSPSLSLQRAMDQSTTYIDKSRLSTGSTQNSNHLSTNSTPTRESFD
FT                   WSGNSSSMYLTSPRVENLPRVRNSISGGMIGNGGRGFRSSNSKIVLPPINLSAIHNPSG
FT                   SPTTSRGSNSTIDGGHSSYVYGNVLMSPQSSVDHNTLPNSTTNHNHNNQNTRLASMPES
FT                   RPAGWGSDPTKDASGTSSTRIGIDVGTTAPNNFTYGILSGYSMGESVNMQSNAASSHVR
FT                   NKNNESALEPKDKSQVHLQTPKSLDNLLKDGSYDRSRKNSLMDGNAVLSPNYQGKSAQS
FT                   NDEVQKDRKIRLPPPSEILNTAST"
FT   CDS_pept        complement(446732..448486)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20197401"
FT                   /locus_tag="CAGL0K04653g"
FT                   /product="Similar to uniprot|P53244 Saccharomyces
FT                   cerevisiae YGR068c"
FT                   /protein_id="CAG61389.1"
FT                   /db_xref="HOGENOM:HBG123754"
FT                   /db_xref="InterPro:IPR011021"
FT                   /db_xref="InterPro:IPR011022"
FT                   /db_xref="UniParc:UPI00003B6C56"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FMW6"
FT                   /transl_table=1
FT                   /translation="MFSLKNLDKRLYDSHGRKKRKKKLVYIDVRTNSIYKDMILIQGTP
FT                   LESPPIPLSGNVVFSVSDNVKVKRIKLRLVCHYKLDFVQLVHDDMASIVKERTKILECT
FT                   WANLLKNSEGETQFDFTKVHKSTKKKTGLLRGIKIWNTSDGDYSSGHHGTSASESVASS
FT                   HSTGHTSSEHGKWYQAGNYEVPFQVQLPNDIPETIEGLQSGSILYNFILEIETEERNNK
FT                   VDVTNKYNFYKYLRILRTLSMNHIAIQEEMMVSNTIRNMLQYQISIPSRAVSIGDESMI
FT                   GLSIKLIPFEKSYYQLDKIMVGLVQEYCVKDRHDEEYVDSSTINPITIASFRDIEGIVP
FT                   DTNELIDSTELKIQYEMPKNLKSITQDCDIMIGDERLGIKKQVMYVRHELSVRIKFIKL
FT                   KDDNKPLEIKLRLPVLLYVSPMKKLLGRRVYFNESTGRIHFRANDYVPLFTPNTGNSTS
FT                   LNQIGLNSAAGDSQGQSDVRDGSQEVPPPLYSEIDQDIVYTGDNVESQLFVESTRRDGR
FT                   NRDSDEIQMETNPGSQLRHYSSNDSNGYMRNQNQPVVATQPPVDTSTPTYEEAQSATVE
FT                   QRPAPTYE"
FT   CDS_pept        455284..455718
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19350617"
FT                   /locus_tag="CAGL0K04675g"
FT                   /product="Similarity"
FT                   /protein_id="CAG61390.1"
FT                   /db_xref="HOGENOM:HBG123755"
FT                   /db_xref="UniParc:UPI00003B6C57"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FMW5"
FT                   /transl_table=1
FT                   /translation="MFLLSFLLFPANCSFWSQKSKRVSFAFFRNTPVLVAQKKKKFIPL
FT                   FRFENTLKNILEFISDDWNSLLWKKCRSILIYLFYTRYSSIKEVATLSVVFKLQRSQKT
FT                   VPSATTTTITTKIPPLCSLFAMTWRQTGIVLYFQSPCLRT"
FT   CDS_pept        459195..460742
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17444513"
FT                   /locus_tag="CAGL0K04697g"
FT                   /product="Strain CBS138 chromosome K complete sequence "
FT                   /function="nucleic acid binding"
FT                   /function="zinc ion binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAG61391.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG123757"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="UniParc:UPI00003B6C58"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FMW4"
FT                   /transl_table=1
FT                   /translation="MTSVLSTIKILDTKTLNTVSEERSKSMHTNNFFTGNSTNSTLSPT
FT                   NSIIQNSQQTIISALTPQATNNYTTQTSVNCQNDSRYSYYNSASVIDRPKLKLPPISSL
FT                   DNFVKTNIYNDSRLRNDTRMVRTVSVPYSATYDKKQVNPQIAPNNTSTQGAPTHAVNRN
FT                   VYTTDYRPLIKSEFSPTSLPTYLPLDTNTSRRESVYLATLKSSSSSPTPSCGSAIKNSP
FT                   PTYHMCPNILPSSDTCSSTNSSTTTNVSYRTSYYLPSNNTSFRSVSFTNKNVNTSNESL
FT                   TEINTLAGSIPNTTLPSSNNMTLQEINLKKALLADYSKTKKKRQCPICHKYFANLSTHK
FT                   STHLTSQDRPHKCIICQSGFARNNDLIRHRKRHWKDDIQNIANLGNTNQQCQNTIQGQR
FT                   ALKKNQLIQLHQIKCAFKCPYNANLIEVDLELNSPETSNSVLEFTPMDCHPTGVFSRCD
FT                   TFKNHLKALHFEYPQKTKREQRSQVPGKCKHCGMKFPNVDIWLNQHVGKSCGFRYHS"
FT   CDS_pept        complement(462359..462817)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21046263"
FT                   /locus_tag="CAGL0K04719g"
FT                   /product="Similar to uniprot|P40159 Saccharomyces
FT                   cerevisiae YNL208w"
FT                   /protein_id="CAG61392.1"
FT                   /db_xref="HOGENOM:HBG123758"
FT                   /db_xref="UniParc:UPI00003B6C59"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FMW3"
FT                   /transl_table=1
FT                   /translation="MCEEEREREREREHHHNHHHGGDALAAIAGGLAGAYAGSHLSSGH
FT                   KKMGGALGAIGGAILGEKLAEHSHHKHHGQEYRDDGPSYNNPPPPMNNMGFAPQDNYRR
FT                   ENNNDYQYDRRGGPARNEYDNYQYSDGQQTYGRPPQGYPGEHQGRQGW"
FT   CDS_pept        complement(463860..465701)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000228135" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17444514"
FT                   /gene_name="SSB2"
FT                   /locus_tag="CAGL0K04741g"
FT                   /product="Heat shock protein SSB "
FT                   /function="ATP binding"
FT                   /biological_process="response to stress"
FT                   /biological_process="translation"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAG61393.1"
FT                   /db_xref="EMBL:AAL86913.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="GO:0006950"
FT                   /db_xref="HOGENOM:HBG334976"
FT                   /db_xref="HOGENOM:HBG396971"
FT                   /db_xref="InterPro:IPR001023"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="UniParc:UPI0000004A4B"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q876N3"
FT                   /transl_table=1
FT                   /translation="MADGVFQGAIGIDLGTTYSCVATYESSVEIIANEQGNRVTPSFVA
FT                   FTPEERLIGDAAKNQAALNPKNTVFDAKRLIGRRFDEESVQNDMKTWPFKVVDVDGAPV
FT                   IEVEYLGENKQFSPQEISSMVLTKMKEIAEAKIGKKVEKAVITVPAYFNDAQRQATKDA
FT                   GAISGLNVLRIINEPTAAAIAYGLGAGKSDKERHVLIFDLGGGTFDVSLLHIAGGVYTV
FT                   KSTSGNTHLGGQDFDTNLLEHFKGEFKKKTGLDISNDARALRRLRTAAERAKRTLSSVT
FT                   QTTVEVDSLFEGEDFEASLTRARFEDLNAALFKSTLEPVEQVLKDAKISKSQIDEVVLV
FT                   GGSTRIPKVQKLLSDYFDGKQLEKSINPDEAVAYGAAVQGAILTGQSTSDETKDLLLLD
FT                   VAPLSLGVGMQGDIFGVVVPRNTTVPTIKRRTFTTVGDNQTTVQFPVYQGERVNCKENT
FT                   LLGEFDLKNIPPMPAGEPVLEAIFEVDANGILKVTAVEKSTGKSANITISNAVGRLSSE
FT                   DIEKMVNQAEEFKAADEAFAKRHEAKQRLESYVASIEQTVTDPVLSSKLKRGSKTKIEA
FT                   ALADALSALQIEDGSAEEYRKAEVGLKRVVTKAMSSR"
FT   mat_peptide     complement(463863..465698)
FT                   /gene_name="SSB2"
FT                   /locus_tag="CAGL0K04741g"
FT                   /product="Heat shock protein SSB "
FT                   /db_xref="UniProtKB/Swiss-Prot:Q876N3 "
FT   CDS_pept        466599..466856
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248270" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17444515"
FT                   /locus_tag="CAGL0K04785g"
FT                   /product="Similar to uniprot|P53869 Saccharomyces
FT                   cerevisiae YNL211c"
FT                   /protein_id="CAG61395.1"
FT                   /db_xref="HOGENOM:HBG058269"
FT                   /db_xref="HOGENOM:HBG626636"
FT                   /db_xref="InterPro:IPR020301"
FT                   /db_xref="UniParc:UPI00003B6C5B"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FMW0"
FT                   /transl_table=1
FT                   /translation="MRPPRNLEEWLYCKLLESEGFHRFVRKVYNKVNGIKETPLQHQAN
FT                   PSEFLYKPTRLHKFRAYRILFWDEMRASLNLPKKSSKFLK"
FT   CDS_pept        complement(467118..469508)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000195804" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17444516"
FT                   /locus_tag="CAGL0K04807g"
FT                   /product="Similar to uniprot|P40157 Saccharomyces
FT                   cerevisiae YNL212w"
FT                   /protein_id="CAG61396.1"
FT                   /db_xref="HOGENOM:HBG053118"
FT                   /db_xref="HOGENOM:HBG328372"
FT                   /db_xref="InterPro:IPR011044"
FT                   /db_xref="InterPro:IPR013863"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniParc:UPI00003B6C5C"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FMV9"
FT                   /transl_table=1
FT                   /translation="MNIIKKFMQLGEKQEISMIPSGEFNLLRSRKSPKSSLECIYNDAM
FT                   LRIRKNGDWNFELVVNKIVEVGDNNNGDDSSDYTDDSVSVLSVASKRREEEWNFELKKD
FT                   LNFSKEWNKNGDAAFVWGNTLGDEEVEKVQFVITPQLSLTEIENFLLTVYRCMYEAEHK
FT                   KSASHVSREQLYKYRPEPPKELFVTESDSYDEENLGVSLSEVNPSQDNTSDNDDLFVDA
FT                   PDNLDSKAKGKKIKTPKKDKTKASSSSSEEHKENNKGVEGEKLCLLNAKVFVYDPFEEK
FT                   FMIQEENVPIALVQSGKYEFWLSMEGKDVDFGLAVSPQANPSFTLSNNSFTFNYTVSRI
FT                   TLSYKIEFNDFKDFTIFENCWSKCIWMALNKKDWEELPKNEQKYIEDSIIADLERDLDT
FT                   ILKLDDEEEESEDEEDNEYSKSVVSSEAFEDPNSGSNKSNSSKGNSSLTVAFRGNRSYV
FT                   VRDDKIGVFKVDDDDDLEFVSAIKNISDKNKKILDPKDPMMYMEDRFMVLSDSKNGDKL
FT                   YKMDIERGKIVDEWEFKDKNVVQYAPTKKFDQLVAEQTLLGISDKSVFKIDPRINTKNK
FT                   IVQDESKDYASKYNFSSLATTKDGYVAVGSKRGDIRLYDRLGIRAKTLIPSLGQAIKYI
FT                   TVSGDGRWLLATCDASLLLMDLSIKSGKNAGNISFLKSTPASENNKTYILQISPEHATH
FT                   ILNYTKKPLCFTKAYFNTGINQKEDRILTSNGPFAISWSMKKVLAGDEKPYKLDWYDST
FT                   VIENNFEYNNKQNVIVALKNDVSLSKIKHFKNVNKSIFKNEPK"
FT   CDS_pept        469984..470607
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21046264"
FT                   /locus_tag="CAGL0K04829g"
FT                   /product="Similar to uniprot|P40156 Saccharomyces
FT                   cerevisiae YNL213c"
FT                   /protein_id="CAG61397.1"
FT                   /db_xref="HOGENOM:HBG123760"
FT                   /db_xref="InterPro:IPR010487"
FT                   /db_xref="UniParc:UPI00003B6C5D"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FMV8"
FT                   /transl_table=1
FT                   /translation="MLIKVPTAVRLYSVKRTPIKPFKEVLKRIQPSNTELSEKSKKNNI
FT                   PEWKKQIISVKKKIGNERWSPSKRLSREEIESVRLLKRSFANITNTELSERFKVSPEAI
FT                   RRILKSNWEPNDEEWEKVQKRWQRRGERIKELYANGGNISSNGHQVVENLVPHKKVIIS
FT                   SGRHMNTFDVIEKKVRSTKPTISIKDQKLKDKKLKLLEISATKR"
FT   CDS_pept        complement(470774..471409)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21046265"
FT                   /locus_tag="CAGL0K04851g"
FT                   /product="Strain CBS138 chromosome K complete sequence "
FT                   /protein_id="CAG61398.1"
FT                   /db_xref="HOGENOM:HBG123761"
FT                   /db_xref="UniParc:UPI00003B6C5E"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FMV7"
FT                   /transl_table=1
FT                   /translation="MAYQESESIQWPDPQRIRNYKARNKTIRTIQSIFSNTGLLFTIFY
FT                   VAVSTIVQPSLERQYNQRIELTAGALLEVRRLTNKLLRRLKSKNSSELELRSNTQEYAD
FT                   RCTQTESRYITDDFESDDDMHNDSDDNSITWNIISKKLVEVKDSLNRYNESCDRPSINM
FT                   ENLTFQSKLVVDQLSVAKDADKLGELSRTSVNNIREMKGWFVNGLVSL"
FT   CDS_pept        complement(471872..473896)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17444517"
FT                   /locus_tag="CAGL0K04873g"
FT                   /product="Similarities with uniprot|Q07684 Saccharomyces
FT                   cerevisiae YDL233w"
FT                   /protein_id="CAG61399.1"
FT                   /db_xref="HOGENOM:HBG123762"
FT                   /db_xref="UniParc:UPI00003B6C5F"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FMV6"
FT                   /transl_table=1
FT                   /translation="MKNNSGLDDVKMAGVKVRNPTTGFNSTYIAKNHDIPTSFTTADVG
FT                   SHKSGSVNGSSPGAAFTLRGTPILGNSTTVSSNNNNKHITGTRQSPSSKLNNNNHYMQA
FT                   MTTQHLLHQQLKTKQNFQMQENSAQEAMKRQLNEGQGQGQYVPSSSVSNKSQTAQAEPP
FT                   QPRSSDTPASFEIETKDSPDYESYESGTTIPLNISLASTHPGENNSLKSNPTSSKEVAD
FT                   KTTESNSNFNTGAFASDIKMKNRETNKSHSNKTSTSVSAHSTPLDNGKESNKNFKDLGK
FT                   PSRNNTNIGSDSSQGNGSERLPLNMDPAKQRYFLFQQQQQQMNKTLSFIHSYRVRKYIA
FT                   NMANLRLYELVGILNRSAGQIGNPEYWNKFVSDVFVSNGLINFSRKLDNNFKQFQFYSA
FT                   LLPMFAIASAELGLVRIETVIQQLITQVLSNGTIFFNCPRCTFTYHYSDGSYVTHFTQL
FT                   KGIFNRNFKIEWIDVCLHSFVPGVEWSFLEALVSDSNRSKEIFEKLSQDKNQTDEEIKS
FT                   GRSQNNFDAIMKLRSYFKVFKNLSIFGIPDDIIRKMQMGHVMSTLKNVMIYDKQQALQN
FT                   GLDGKRNPFDSYVSYVEEKYKPGPEGKDFEASEMQSNSGTPTANDTTTRKRPYPPDGTS
FT                   NTHDQIHSSTPSSAEILASIDIDAKRRRHSGISPRSTDS"
FT   CDS_pept        complement(475558..476625)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19350618"
FT                   /locus_tag="CAGL0K04895g"
FT                   /product="Similar to uniprot|P40154 Saccharomyces
FT                   cerevisiae YNL215w"
FT                   /protein_id="CAG61400.1"
FT                   /db_xref="HOGENOM:HBG123763"
FT                   /db_xref="InterPro:IPR006880"
FT                   /db_xref="UniParc:UPI00003B6C60"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FMV5"
FT                   /transl_table=1
FT                   /translation="MDSELSDIELSNSRPSSIEDEDLYQEEEEEYQDAMDEDDEYNDDG
FT                   ADDNDEEYIEGREAEIKKPKIATKQTIRPPVKKSERISSKRTAATGLQRVRPKRAVTDK
FT                   EVNYSEDSTSVDKAIEAAEAADEKEQELDQDAVNVDVDVEEEDDEEIRSPAKKRQRTVL
FT                   EDEEDAQTSTANNSGSEQLPEEDEEEDNGGISDSLRSDFSNGNGGENGIQEDLDAEDNM
FT                   STPAGDEDNEEVEARENTEDASIIPSNLLPKNKMLISILDDNPFKKKLTEEEIQLRRAE
FT                   NARKRKNLSEKRLEEEKRETLNKLLKKRAGKSRSKVDKDEPENTASTIKPRRPYNSNGM
FT                   VRIIRKRDEDLYCIF"
FT   CDS_pept        complement(477054..479117)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000115833" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19350619"
FT                   /gene_name="CgRAP1"
FT                   /locus_tag="CAGL0K04917g"
FT                   /product="CgRap1p"
FT                   /function="DNA binding"
FT                   /biological_process="regulation of transcription "
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG61401.1"
FT                   /db_xref="EMBL:BAB62800.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0045449"
FT                   /db_xref="HOGENOM:HBG058214"
FT                   /db_xref="HOGENOM:HBG202638"
FT                   /db_xref="HSSP:1IGN"
FT                   /db_xref="InterPro:IPR001005"
FT                   /db_xref="InterPro:IPR001357"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012287"
FT                   /db_xref="InterPro:IPR014778"
FT                   /db_xref="InterPro:IPR015280"
FT                   /db_xref="InterPro:IPR017930"
FT                   /db_xref="InterPro:IPR021661"
FT                   /db_xref="UniParc:UPI00000699AB"
FT                   /db_xref="UniProtKB/TrEMBL:Q96WQ7"
FT                   /transl_table=1
FT                   /translation="MSANDSEQFDTAPNEFVDALETNIHIDPPNQAQSKIDESSRKEKN
FT                   NNDLGVEMTSVDPALTGEDMNEAHTKETAAEQNGEKGIFNGMVFYLNRDSNAHDSIIIV
FT                   EQLKNLILLNGGDIVNKLPNKDSAEAKHIIVVSPYNNTELKTVTSTFIRACVQSNKLLD
FT                   MKNYLVPYDSFNALLDDAMSPPSRQEPTISESSSVNEGQPTASKPPPQNIANKRDIPTK
FT                   KVSANTGVSKTSFTEEEDEFILDVVRKNPMRRTTHTLFDEISHYVPNHTGNSIRHRFRV
FT                   HLSKRLDFVYQVDQYGKLVRDENGNLIKTKVLPPSIKKKFTADEDYELAIAIKQQFYKD
FT                   IYQLDPVTGQSLISDNDPPARVAKRQMMMDPNVQRGSEPPFSKYRVGTRRGPIAREFFK
FT                   QFTENHPTHTESAWRDRFRKFLLEYGVDKYIEYYETQKANNDEPEAMKNLTIRTKRDNF
FT                   PTPGNYGNAAKRQKYEVSSNVENTLKSKGQAGDIPDAELLDEDTMKFISSLKNDLSKID
FT                   NNFGFDYTNEIAEAIRNDFSEEEAIYDNIDPNTIPFPPPIATIDLFLPQFFRMSSTQEF
FT                   IEKIREIIQRDYEPSQAELLMQDLNDEAGIRKTFTSSILGSLSGDLMVLPRYFLNMFSK
FT                   NQNPPIDIPGIWTSGDDDILRRGDEAEVSKLVKRQGAGRVEMRKKFLERNLI"
FT   CDS_pept        complement(479758..480720)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000849" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20197402"
FT                   /locus_tag="CAGL0K04939g"
FT                   /product="Similar to uniprot|P40152 Saccharomyces
FT                   cerevisiae YNL217w"
FT                   /function="hydrolase activity"
FT                   /protein_id="CAG61402.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG058209"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR006186"
FT                   /db_xref="UniParc:UPI00003B6C61"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FMV3"
FT                   /transl_table=1
FT                   /translation="MIPRRIAVLILSLAIILVFFCSFLIDMSENNDNVNTGVRVLKSML
FT                   DSPTLRALSVPEEHHDRQLVFIGDVHGMYDKLLELVDKLNFETTPEMELVFLGDFITKG
FT                   PDSTKVLDWMIKHEGRVHFVLGNNEFSVIMGALDMGLLESKMLNNEQGHDVTGTFKKSH
FT                   AELAQQLNPSHYTYLFKNAAVVLEFDMEKTRQRFIAVHAGILPQDYDFERRHVILKSDV
FT                   FSILNMKFVNEENSMETSREKQTKHWKRWYKLWEKELDNHHTKEQITILYGHDAKKGLN
FT                   LRKYTKGLDSACVKGGKLSAMHYMYDPHSNSYKETLVEV"
FT   CDS_pept        481708..482193
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000190539" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19350620"
FT                   /locus_tag="CAGL0K04961g"
FT                   /product="Strain CBS138 chromosome K complete sequence "
FT                   /function="signal transducer activity"
FT                   /biological_process="two-component signal transduction
FT                   system (phosphorelay)"
FT                   /protein_id="CAG61403.1"
FT                   /db_xref="GO:0000160"
FT                   /db_xref="GO:0004871"
FT                   /db_xref="HOGENOM:HBG058200"
FT                   /db_xref="HOGENOM:HBG395866"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="UniParc:UPI00003B6C62"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FMV2"
FT                   /transl_table=1
FT                   /translation="MTTVPSEIIDWTILNEIVSMDEDDPDFSKGLIIQYIDQATTTFSE
FT                   MDNLLGSIDNLKELDNLGHFLKGSSAALGLQRIAWACERIQNLGRKAEDSFPERTDILK
FT                   NLPDKVSVDEEDKKEEKEEVPQDDKKYLYLIKKALAQARIEFKLARRELSDYYKTEL"
FT   CDS_pept        complement(483181..484860)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000017623" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17444518"
FT                   /locus_tag="CAGL0K04983g"
FT                   /product="Similar to uniprot|P40151 Saccharomyces
FT                   cerevisiae YNL218w"
FT                   /function="ATP binding"
FT                   /function="nucleoside-triphosphatase activity"
FT                   /protein_id="CAG61404.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0017111"
FT                   /db_xref="HOGENOM:HBG000345"
FT                   /db_xref="HOGENOM:HBG635390"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR021886"
FT                   /db_xref="UniParc:UPI00003B6C63"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FMV1"
FT                   /transl_table=1
FT                   /translation="MQSSGKEISQLIACPVCNEKIQFAKINSHLDNCTTGKAQNGQKSI
FT                   TSILGNSNKRKYDTADKASEIIDLDNENNADIPQKKIKIESTENTTNTTNTTNTIKSSD
FT                   YEFRYLQKISHLPLSEKLRPKEIRDYVGQQHILSQESGVLNKYVQEGLVPSMILWGPPG
FT                   VGKTTLARLLTKTASLHGSRYTMVETSATKANAQELRSIFEKGRKEYQLTKRRVVLFID
FT                   EIHRFNKAQQDLLLPHVENGDIVLIGATTENPSFQLNNALISRCHVFVLEKLSETEVII
FT                   ILSRGVALLNKLRNVIWNVKNPLKLSRSILVYLCDISVGDARRALNLLEMIEVSTRHVE
FT                   KELTIEQIREIIKNNNSQGLNTYYDTKGDNHYDTISAFHKAVRGSDENASLYYLGRMLQ
FT                   GGEDPLYIARRMIRIASEDIGIRDNSMLPLAIAAHDAVMKLGLPEADMALVQCCVSLAR
FT                   APKSVEIYRAWKNLRGMLAENKYNLASSEVPMHIRNAPTRLMEELGYHKGYKYNPDYKD
FT                   GIAKQDYFPQEVLDKCEDPNELKFLTGEHFGTKTDPDLNENK"
FT   CDS_pept        485646..487322
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000205434" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17444519"
FT                   /locus_tag="CAGL0K05005g"
FT                   /product="Similar to uniprot|P53868 Saccharomyces
FT                   cerevisiae YNL219c ALG9"
FT                   /function="transferase activity, transferring glycosyl
FT                   groups"
FT                   /biological_process="GPI anchor biosynthetic process "
FT                   /cellular_component="intrinsic to endoplasmic reticulum
FT                   membrane"
FT                   /protein_id="CAG61405.1"
FT                   /db_xref="GO:0006506"
FT                   /db_xref="GO:0016757"
FT                   /db_xref="GO:0031227"
FT                   /db_xref="HOGENOM:HBG177204"
FT                   /db_xref="HOGENOM:HBG736291"
FT                   /db_xref="InterPro:IPR005599"
FT                   /db_xref="UniParc:UPI00003B6C64"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FMV0"
FT                   /transl_table=1
FT                   /translation="MNNKYCTFVLVVLLVATRLYIQPFYSLISDCDETFNYWEPLNLLL
FT                   RGFGKQTWEYSPEYSIRSWSFLLPFYSLLYPLNAVAEIQANWNFYAVRILLGLFSLIQE
FT                   WKLFKEITGTTTLEIANFWLFYQLFNPGWFHASVELLPSAIAMILQLGSINYALKYLST
FT                   SASSNFIGSLTFNMIAGILGWPFVLVLNLPLCIHYVWTHRIISSVRTAFDCSLIFLLIS
FT                   VIVIGIDSLFYGKFAPVAWNIFFYNVLNADEEAGPNIFGTEPFSYYIQNLLLNFPITTL
FT                   GFAVLGVSHWRLWPLWTSAIVWFTVFALQPHKEERFLYPLYGYISLSASILTYKALKVY
FT                   KKYFSFAFVVKLIIVGTVILQSLLRIFALIENYRAPMTVYSELFSRESTSNSTVNVCTG
FT                   REWYHFPNSFYLPNAHRLRFVKSGFDGLLPGDFIEDESIFTAVRAVPKGMNNRNMFDES
FT                   KIWPLEECDYFVDITLPTDGEKDSFTGSNSANRWNAVVCQKFIDGSDSKFLGRAFAVPE
FT                   IIDCMMKEYIPELWTKLYHAKYIDYCLYEKLPSSEYQVNAD"
FT   CDS_pept        complement(487675..488973)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000260959" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20197403"
FT                   /locus_tag="CAGL0K05027g"
FT                   /product="Adenylosuccinate synthetase "
FT                   /EC_number="6.3.4.4"
FT                   /function="GTP binding"
FT                   /function="adenylosuccinate synthase activity"
FT                   /function="magnesium ion binding"
FT                   /biological_process="purine nucleotide biosynthetic process"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAG61406.1"
FT                   /db_xref="GO:0000287"
FT                   /db_xref="GO:0004019"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006164"
FT                   /db_xref="HOGENOM:HBG364928"
FT                   /db_xref="HOGENOM:HBG658237"
FT                   /db_xref="InterPro:IPR001114"
FT                   /db_xref="InterPro:IPR018220"
FT                   /db_xref="UniParc:UPI00003B6C65"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FMU9"
FT                   /transl_table=1
FT                   /translation="MVNVVLGSQWGDEGKGKLVDILVSHYDVVARCAGGNNAGHTIVVD
FT                   GVKYDFHMLPSGLVNPNCKNLLGNGVVIHIPSFFKELETLESKGLNDARGRLFISSRAH
FT                   LVFDFHQRTDKLRELELAGRSKDGKNIGTTGKGIGPTYSTKASRSGLRVHHLVNDNPGA
FT                   WELFESRYRRLLETRKQRYGDFDYDAEEELNRFKQYKESLKPFVVDSVDFLHKSIANNE
FT                   KILVEGANALMLDIDFGTYPYVTSSNTGIGGVITGLGIPPQKIQEVYGVVKAYTTRVGE
FT                   GPFPTEQLNEQGEKLQSIGAEFGVTTGRKRRCGWLDLVLLKYSTLINGYTSLNITKLDV
FT                   LDTFTEIPVGVSYKYKGETLNSFPEDLLTLGNVEVEYVTLPGWNQDITQIKKYDDLPEN
FT                   AKKYLKFIEDFVKVPVQWVGTGPARDSMLEKQI"
FT   CDS_pept        490007..492580
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000247847" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20197404"
FT                   /locus_tag="CAGL0K05049g"
FT                   /product="Strain CBS138 chromosome K complete sequence "
FT                   /function="ribonuclease P activity"
FT                   /biological_process="tRNA 5'-leader removal"
FT                   /protein_id="CAG61407.1"
FT                   /db_xref="GO:0001682"
FT                   /db_xref="GO:0004526"
FT                   /db_xref="HOGENOM:HBG058175"
FT                   /db_xref="HOGENOM:HBG397923"
FT                   /db_xref="InterPro:IPR009723"
FT                   /db_xref="InterPro:IPR012590"
FT                   /db_xref="UniParc:UPI00003B6C66"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FMU8"
FT                   /transl_table=1
FT                   /translation="MSGKKKLNDNQLFKRQKVRDARQIRTESIKNDREGDVSEAGGMLQ
FT                   VGNFINSRRYEIQSLQMAMKSSKSSSSTRVFQALPRKLRRRTASHNVRRIPKRMRNRAL
FT                   REMKKSNIDDNKGKNATTEKKPAKSKYKAHGLTKRQLYKIRMAIKLLRLASRSTSLQLA
FT                   LPRNVTLKNTKIRNKINTLKKTIKSNSSRRLNSQALNNKMGSYDNIGINSLASAPKMRV
FT                   KYLKRQRFFTWLPSHIWNAKRSHMMKRWGYQIPWSPTQKCFKLTHRLGGSTAASDGALC
FT                   MDSSFFGTMILEASNPESQNELDKLAGQLTANKVTKQKYKNGYKWYEGIFYDPSQNFDN
FT                   IIGIGEIMWITDSKLLIRLHPALYGKVFDELCATYSNKIKFTDSRFALASFTVKGAKAL
FT                   TAIASVMRSAKPCESYKQLLSVAKLSDDSILPKYTMFAFDAIDPRYLSKPQLPNVTCDL
FT                   NQITNNILNIQKSFPKEEISMVFNKLADSTSRYESYRNQHTLKMIAKKKSIALRQNSNK
FT                   TGTSNLLPFNDETDPKIPISIIKREKSDDWLVILPWFWFLPYWYQINKISKVYHIGLRQ
FT                   VQQLQYEKKQLYFPDDFPFTKQGYLENSVFKRESSYARWQRKPLGKRVNYEKIRNIHSK
FT                   CLPTIAGELGDPFSCDWKLLQILRNGLKFLSKQGTPIQYIDEKRTGQFDDNQNRIVRNV
FT                   NDLFELYKDVKDNADIDSPTLPIQYRQGSKAYPAMDISKPDHILNVPLSITPISATLID
FT                   KGRPSDNSRIYSIPDQDLNFWKQVAGGIYQANGKKLHEQQIPKPELTNLIGFATSGTFH
FT                   LGLGRGMINGFIDSEALRDNKSRFVLIRNTGTDVYRLAKWESISI"
FT   ncRNA           492841..493676
FT                   /ncRNA_class="snRNA"
FT                   /gene_name="SNR19"
FT                   /locus_tag="CAGL0K05063r"
FT                   /product="U1 RNA"
FT   CDS_pept        complement(494132..494746)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000183445" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17444520"
FT                   /gene_name="SSU72"
FT                   /locus_tag="CAGL0K05071g"
FT                   /product="RNA polymerase II subunit A C-terminal domain
FT                   phosphatase SSU72"
FT                   /EC_number="3.1.3.16"
FT                   /function="phosphoprotein phosphatase activity "
FT                   /biological_process="mRNA processing"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG61408.1"
FT                   /db_xref="GO:0004721"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006397"
FT                   /db_xref="HOGENOM:HBG022057"
FT                   /db_xref="HOGENOM:HBG381219"
FT                   /db_xref="InterPro:IPR006811"
FT                   /db_xref="UniParc:UPI00003B6C67"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FMU7"
FT                   /transl_table=1
FT                   /translation="MDQKQALKFCTVCASNNNRSMESHRILQEAGYEVSSYGTGSAVRL
FT                   PGLSFDKPNVYPFGTPYNDIYNDLLSQSAERYKANGLLQMLDRNRRLKKAPEKWQEGTK
FT                   TFDFVFTCEERCFDAVCEDLMNRGGRLNKIVHVINIDIRDDNENAKIGGRAILELANML
FT                   NEKVSECEQNDTLFEDCILDILTKWQEAHPQLPCLYAPSYY"
FT   CDS_pept        495585..497822
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000217276" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20197405"
FT                   /locus_tag="CAGL0K05093g"
FT                   /product="Similar to uniprot|P32795 Saccharomyces
FT                   cerevisiae YPR024w protease"
FT                   /function="ATP binding"
FT                   /function="metalloendopeptidase activity"
FT                   /function="nucleoside-triphosphatase activity"
FT                   /biological_process="protein catabolic process "
FT                   /biological_process="proteolysis"
FT                   /cellular_component="membrane"
FT                   /protein_id="CAG61409.1"
FT                   /db_xref="GO:0004222"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="GO:0017111"
FT                   /db_xref="GO:0030163"
FT                   /db_xref="HOGENOM:HBG460402"
FT                   /db_xref="HOGENOM:HBG724153"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005936"
FT                   /db_xref="UniParc:UPI00003B6C68"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FMU6"
FT                   /transl_table=1
FT                   /translation="MMLAGLPSVARTAMLRSVSVVGVRSVYSGRASLLRMCANRRYSDM
FT                   KKSGDEGATETSGAALGGGKSASANTNTTATTANSSANANANANANADASVSHALLATR
FT                   EQEANKDLTNPEAQATFYKLLLQSNYPQYVVSRFETPGIASSPECMELYMEALQRIGRH
FT                   AEADSVRQNLLTASSAGAVNPSLASSSPGSSGYHTTFPSLYSPLYGSRKEPLHVVVSES
FT                   TFTVVSRWIKWVLFFGIFAYGVSEAFKYIAENTTLLKNSEVADKSVDVAKTNVKFDDVR
FT                   GCDEARAELEEIVDFLKDPAKYESLGGKLPKGVLLTGPPGTGKTLLARATAGEAGVDFF
FT                   FMSGSEFDEVYVGVGAKRIRELFSQARARAPAIIFIDELDAIGGKRNPKDQAYAKQTLN
FT                   QLLVELDGFSQTSGIIIIGATNFPESLDKALTRPGRFDKVVNVDLPDVRGRADILKHHM
FT                   KKITLAPNVDPTIIARGTPGLSGAELANLVNQAAVYACQKNAIAVDMTHFEWAKDKILM
FT                   GAERKTMVLTEASRRATAYHEAGHAIMALYTNGATPLYKATILPRGRALGVTFQLPEMD
FT                   KVDITKRECLARLDVCMGGKIAEEIIYGKENTTSGCGSDLQSATGTARAMVTQYGMCED
FT                   VGPVNLGDNWDSWSNNIKNTADNAVISILKESEERTRKLLEEKNEELHRLAQGLVEYET
FT                   LDASEIEKICKGEPINKSKSSTNTVVEGPDSDERKDIGGGDKSKIPTMLKV"
FT   CDS_pept        complement(498091..499194)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000247914" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17444521"
FT                   /locus_tag="CAGL0K05115g"
FT                   /product="Similar to uniprot|P37366 Saccharomyces
FT                   cerevisiae YPR025c Cyclin"
FT                   /biological_process="cell cycle"
FT                   /protein_id="CAG61410.1"
FT                   /db_xref="GO:0007049"
FT                   /db_xref="HOGENOM:HBG395456"
FT                   /db_xref="HOGENOM:HBG435957"
FT                   /db_xref="InterPro:IPR005258"
FT                   /db_xref="InterPro:IPR006670"
FT                   /db_xref="InterPro:IPR006671"
FT                   /db_xref="InterPro:IPR011028"
FT                   /db_xref="InterPro:IPR013763"
FT                   /db_xref="InterPro:IPR015429"
FT                   /db_xref="InterPro:IPR015432"
FT                   /db_xref="UniParc:UPI00003B6C69"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FMU5"
FT                   /transl_table=1
FT                   /translation="MSESGVSTQSPQNSSTPDAKPVEHPPNYKRLTDDDLYRHSSQFRL
FT                   WSFTPDKLLQKRTETNARAVVVIEEKLRAFKEKHKDELTPDVAKVIDSKATPITTEEEL
FT                   KLVNFYAQKVQVIAQKMSLPTEVVATSISFFRRFFLENSVLEVEPKDIVHTTIFLACKS
FT                   ENYFISVNSFAEKAKATKETILKYEFKLLETLKFTLMNHHPYKPLHGFFLDIQKTLHGK
FT                   IDLKYMGKIYEKCKKRITEALLTDAVYFYTPPQITLATLMIEDEALTTRYLELKFHGQD
FT                   AQTTDNTTDKSHSIHHINFERLLSVVQSCKEILEKPITISVQEAKGIMAKIYYCENPEG
FT                   LLNRLKREPPKDSEDSPAKKQKVLPPQ"
FT   CDS_pept        500434..504072
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000246546" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17444522"
FT                   /locus_tag="CAGL0K05137g"
FT                   /product="Strain CBS138 chromosome K complete sequence "
FT                   /function="carbohydrate binding"
FT                   /function="catalytic activity"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /protein_id="CAG61411.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="GO:0030246"
FT                   /db_xref="HOGENOM:HBG059737"
FT                   /db_xref="HOGENOM:HBG395886"
FT                   /db_xref="InterPro:IPR005194"
FT                   /db_xref="InterPro:IPR005195"
FT                   /db_xref="InterPro:IPR005196"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="UniParc:UPI00003B6C6A"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FMU4"
FT                   /transl_table=1
FT                   /translation="MGFKDKILFWKDEVQYRTLAVADQVANRFFHSFENVYKGDESVED
FT                   ADSRPVGLTNETLSHSSDFFVLPEERISTRVKIRRQNILNTTLILGMLIALVIWTAILS
FT                   TNSYFSSSLASASPLFNKEGRVVRPMRESNLGLHADPQTRKSSKTLYDLLSDFDNAFYD
FT                   DENMILGSLAFGENTYSRQPYVANGYIGSRIPNIGFGYALDTLNLYADAPGALNNGWPL
FT                   RNRRFAGSFVSDFYSLQAKLNSTNFPELDEKGYTTVISSIPEWTDLQFTVDLNGTNWFN
FT                   PQSVLIDDVINYNQNLSMKDGIVSTNMDWLNGMINIKSEVWAHRKIHSLGITRLEISLN
FT                   LDALPDEFTELPVTIYDIIDFNTSHRTTLYEKGQDEDNKAIYMIVNPENVPYSNAVVYS
FT                   TCTIKGTENNFSPYNFTSDDRIARNYMTNLTEENPKVVIYKYTSVVSSEYNNDEPNPNV
FT                   NLKFASNIANTAKGNYKSLLSNHKRAWYDLYNDAFIEIPSDSLLEMTARSSLFHLLANT
FT                   RQYNVSTTRGLPVGVGGLSSDSYGGMVFWDADVWMAPALLPFFPNIAMNMNNYRNATHQ
FT                   QAIENAKQYNYPGAVYPWTSGRYANCTSTGPCIDYEYHINVDIALASFSIYMNGAEGAD
FT                   EDYLRFTTWPMVKDAAVFFKAYVKYNETLGEYETYNLTDPDEFANHVNNGAFTNAGIKT
FT                   LLKWATDIGTHLGEEVDPKWMEIADNIHIPRSDSNITLEYSGMNSSVEIKQADVTLMVY
FT                   PLGYINDESILNNAIKDLYYYSERQSASGPAMTYPVFVAAAASLLNHGSSSQSYLYKSV
FT                   LPYLRSPFAQFSEQSDDNFLTNGLTQPAFPFLTANGGFLQSILFGLTGLRYSYEVTPRT
FT                   KKISRLLKFDPVKLPLLPGGIAIRNFKYMGQVLDIIIDDNNGTIAHKGGDKPIRIKVPN
FT                   RDILHDRNITSALYSKRDDDLSATDDYYGTYFTLYPNEELVIPLYDTKLNIDGNIAESK
FT                   QITNLTAGVPGDVGFSALDGNNYTHWQPFDKSDNAKLLIDLGFNSTHVIKKGIILWGQR
FT                   PAKNISLSVLPHSERIEQLFANITDLLETSSITKGGSLLNQMLGQTQSNVTAEIDDDIL
FT                   ALLNWKGDDLDQLIPYLPDMHLLQEKFIPILKDYPIKPNQRYYKEIIDDDIIKLLPSNT
FT                   TEFTIDYNSIPGGEKRARYVVLTVHGTYDDDDDLKGATIKEIVLQE"
FT   tRNA            join(complement(504378..504415),complement(504318..504354))
FT                   /gene_name="tRNA-Phe (GAA)"
FT   CDS_pept        505243..505776
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000172351" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17444523"
FT                   /gene_name="YOP1"
FT                   /locus_tag="CAGL0K05203g"
FT                   /product="Protein YOP1"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAG61412.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG373586"
FT                   /db_xref="HOGENOM:HBG630822"
FT                   /db_xref="InterPro:IPR004345"
FT                   /db_xref="UniParc:UPI00003B6C6B"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FMU3"
FT                   /transl_table=1
FT                   /translation="MADVISSLQTQLKELDTKFAGNNVLNQLEQRTNLPKSYLVVGSTI
FT                   FYLLLIFINVGGIGEILGNFAGFVIPAYYSILALKTTTTKDDTQLLTYWIVFSFLNVIE
FT                   FWSKALLYIIPFYWFLKTIFLLYIALPQTGGATMIYNRFISPLTDKYILGPKKTDGVQQ
FT                   SVKEASRATGAATH"
FT   CDS_pept        complement(505973..508714)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000210271" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19350621"
FT                   /locus_tag="CAGL0K05225g"
FT                   /product="Similar to uniprot|Q12028 Saccharomyces
FT                   cerevisiae YPR029c gamma-adaptin"
FT                   /function="binding"
FT                   /biological_process="intracellular protein transport "
FT                   /biological_process="vesicle-mediated transport "
FT                   /cellular_component="Golgi apparatus part"
FT                   /cellular_component="clathrin adaptor complex"
FT                   /protein_id="CAG61413.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0006886"
FT                   /db_xref="GO:0016192"
FT                   /db_xref="GO:0030131"
FT                   /db_xref="GO:0044431"
FT                   /db_xref="HOGENOM:HBG028729"
FT                   /db_xref="HOGENOM:HBG604608"
FT                   /db_xref="InterPro:IPR002553"
FT                   /db_xref="InterPro:IPR008152"
FT                   /db_xref="InterPro:IPR008153"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR013041"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI00003B6C6C"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FMU2"
FT                   /transl_table=1
FT                   /translation="MMRRSSSKKGSSGTYNGSSSLRNFIKDVRNAKTLADERAIINKQA
FT                   AKIRTKLRDDHLSSDKKRNNIIKLLYLYILGERTHFGQVECINLIASDQYIDKRLGYLS
FT                   TTLLLDESQDLLTLLTNLINNDLKHPNKYVVSLALTALGFLSSPELARDLYPDVEGLLK
FT                   TYSTDPYILKKALQCCAKLIAKDSQLLEIVPIDLFLTLLKEYRSSLTSLSAAHGVLIGL
FT                   SRLFQAIATAITNLVTPQETSESDPEDMAYRQNLAQQMIKIFSESSFLDDFYQVLASLS
FT                   SRNLDPQFDVQGVSDPFLQCEVITTLRLYFKAYHKLATEINQEQVDGFNDLLTNIATNT
FT                   DSTKSSGQAVLYEITRTIFDLQLPKPLQVLGINILGNFLSPRSVGGKKPTTAVITAQNN
FT                   TKYVALNMLLKVVPSEPEAVRRHRKFISRCLNDQDISIRMRALELTFAIMDKDNLVELI
FT                   NEVLNFLAKSVMNNGSAKGGYSSSYKINSFGEDIDDSKDLIIFAVNHIVDKFGEISEEQ
FT                   GENIDNNWRLSVFVKILKLVGSYIPVDRISDILIAFNNTLEVNYKTDVIIRMLDISLRE
FT                   VMESTDKTTEDEFIEEGNLGWQLVSIWCIGEYGDIVLQALQSDSKLNETYGKTINEKTI
FT                   VNYLKLKDTQYIRTNLKINHYVLTAALKLSVRIQDFALIEKLRQIIVGQTKNTDLLLQA
FT                   KATQYEIIFSQPESIRKQILDAMPQFERAVKTEKPVTSISHLDNGKQSDRKHDPLLDLL
FT                   GDTDVQDTKQQQKNNTNLLADLLLGENNNGIQSQGQTSKNNEDKLTLPESCTLLQTIDC
FT                   LEIYASKITKDDTSAHLEIYYKNNGDVEVSNLQCLVAVTKTLKVVLGQLYPSVNIPANG
FT                   IIKQTLKVSGTGNLKMRVKLSYSVGGSQQTQQFDHKFPELTL"
FT   CDS_pept        509508..513182
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20197406"
FT                   /locus_tag="CAGL0K05247g"
FT                   /product="Strain CBS138 chromosome K complete sequence "
FT                   /protein_id="CAG61414.1"
FT                   /db_xref="HOGENOM:HBG123764"
FT                   /db_xref="InterPro:IPR011022"
FT                   /db_xref="UniParc:UPI00003B6C6D"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FMU1"
FT                   /transl_table=1
FT                   /translation="MLSHNYHSSNTTSARRSTGVPASPGTARSVIKSTLASLMDGPDMQ
FT                   QRNYVLTSDTSAMKRSSSIPYGSQLAPPDGTRTRRHSIAEVTHRKRQPNLFAVNYLNDF
FT                   LMNRGFLPQRSLFHKDDCMTISMATTADPVFLPTTSIKDEEEYLSSISAPQRHEMQAHH
FT                   SSSAAIAQEEDRDDYPPLNLDSADASTLTPAKKLNNPFLADLARGAPHYDTNPFLNPPS
FT                   IMDSLNENNDLSLASMDTLNTTPDQKKKTKRTHVSGSMTPMSIAVIVSIKEKPMKMPRI
FT                   IVNLSSNVSIHWYNGLPTNKSKYEEFYQLNSVNWKLSATNYNIYIPANSYSADDVQQNL
FT                   DIDVIRDYVVFKNKKTSHRKYVENKASLNKELQDMLNATDSDDSKTSNSAESSKSSSSQ
FT                   ENDNSTISQSSETTSKGGNDRSTNNSNGQNELDDDELFMPGDYVFVIPVAFANRAPETL
FT                   TMPSGRVFYRLKILTNAEAVDDNIAERLLNRPPLSTNASSNGAPVTISANDLDCFKSSG
FT                   TMSHFSNVSTPPPLTVPPSSQLQACPPETFDSHLTPGQNYATSQHKARQLSLDYSNMHS
FT                   NNNTLGTKNTRQRAHSSVDTNTMKEMRANRRGDQFESHQLSATNDMKTDRRKRSGTNSW
FT                   FKSIKDQFSTSVDNNTDTPDTKSLTGKISPISMSRKGSVTDQRRPSGELKANVEKNKYS
FT                   IFIDEPINIVRMPPEQSLTTADKPVYVNKVWADSLAYEVSFGKKYVPINSEVPLVIKLS
FT                   PLVKDIEIKRIRVSVVETIKYSNINRKYEYDQLDPILKDPFSPYYRDLIARKKKTRSLP
FT                   LLEIRSREIGNKALCEEVVEGCLNDNLLSYSSVTDECTEFNRRKNTTEKKTKSVPLIEP
FT                   ICVETTLKLPNHMDFDRTTAKNLPPYGIESFVSGNADDDWYSSRQSSVFGFFKSQKSSN
FT                   SVNSSPSKTMHKSRTKIFTEGGITVNTKTRHHESHRGLYLDSSYFRNINSKHKLEIMLR
FT                   IKKTDENDPTVAKNFEIVIDTPIYVVSEHCSNGNTELPTYNMALSDSTKVMLASNNVPP
FT                   PTFEEATSSYSSPFASPSASPRIAAIAGHYGGSYPDYSPLDMSRSGSISVRSDLSVDTD
FT                   LPNVDHLMASLPPVSTNNMIDSVRSTYNNLDGLLSSHSSLANKRETSNRSGVDGFDTTS
FT                   NNGSDMNKPRNFPIITVSAADELFKKDYSIMTTNGSGDYPEPPKYETVVGGCDTQSNH"
FT   CDS_pept        513673..515958
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000246761" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21046266"
FT                   /locus_tag="CAGL0K05269g"
FT                   /product="Similar to uniprot|Q12311 Saccharomyces
FT                   cerevisiae YPR031w"
FT                   /function="zinc ion binding"
FT                   /protein_id="CAG61415.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG058459"
FT                   /db_xref="HOGENOM:HBG396714"
FT                   /db_xref="InterPro:IPR001965"
FT                   /db_xref="InterPro:IPR011011"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR019542"
FT                   /db_xref="InterPro:IPR019786"
FT                   /db_xref="InterPro:IPR019787"
FT                   /db_xref="UniParc:UPI00003B6C6E"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FMU0"
FT                   /transl_table=1
FT                   /translation="MSRASNDVGPKLREEKHFNDFYPDLDANDLIPILVSQETDQSQSV
FT                   DSQDEIIRKQHYKQLIFNGSITVEPITITKQATDVQQIPYPVNDFATFIDAKRYSKKSV
FT                   GNTLISKFYSQDHIQGKTKRRQQRIINAHDSDKIYKDKFMTHSNQIKRDKAIQSHFEAL
FT                   SPNLSGFIPQYDMDEQDALYLEFLNQSLGEKYITAEVFEIIITILELEWYHLDKHIPPK
FT                   ITDTNDSQLNSIQHHANKVRYELYGSDDGTGLTSDQACAVCDGTVSTTTNMIVFCDGCD
FT                   IAVHQECYGIVFIPEGQWLCRRCFISRNKQVNCVTCPSTTGAFKQTHTGSWAHVLCALW
FT                   IPELVFANLHYMEPIEGVENINKSRWKLVCYICKLRVGACIQCSNKNCFAAYHVTCAKR
FT                   AGLCLDTHDTSIAEMASKHYQMHHHVTSYCDKHSPPGWPSCAEGIMKTRRYFANRDAIS
FT                   EVSKEKQLITKGVNSEDKNSAHWKTNKGTPIAPMYFTHIIQKVLVMFDISNEIPLSILL
FT                   CKYWAMKRELRKGAPLVRVHTNLSYNSQNESYLNDRIQFIDSLLGDLQSLGNISRLIKE
FT                   RVNATKSFRATNKKINEVFTSPKEYFFRRNVLSKFLHFNAFTSLLALLDKHTIVDHSVN
FT                   ALRNSTSATFIENVEAFVNFASTKLDETRLTSDYIHRISNYAKELSAQFDKVDYEREIN
FT                   MDFEVNKEHDKLSVSERLWKGPILQQEEGLSDVEELTPSESRIVNNLPIEKEKPTKVKR
FT                   RKKWKKSY"
FT   CDS_pept        516470..519616
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000197426" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17444524"
FT                   /locus_tag="CAGL0K05291g"
FT                   /product="Similar to uniprot|Q12038 Saccharomyces
FT                   cerevisiae YPR032w"
FT                   /protein_id="CAG61416.1"
FT                   /db_xref="HOGENOM:HBG053882"
FT                   /db_xref="HOGENOM:HBG331004"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR013905"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="UniParc:UPI00003B6C6F"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FMT9"
FT                   /transl_table=1
FT                   /translation="MFKKGKLKGVSNPFKSSKSTESNKDDSAKAPKPKNIGPGNPMLAP
FT                   TSTMKKFTSSNPLNRLFTTEVVARYGFNGKVVKVAYDQTQSLMALATDMGEIHVCGRQQ
FT                   VEVVFSPPERITEKISIKEMAFVKGIYLVIIDSKDTLVVISLHNKKILASTYLPVKVSC
FT                   METDPTLDWVVIGLESGGIMIYDVDRDQMSDIRIENLQKGKFFPREKLSRVVSIQWNPR
FT                   DIGTLLISYELVTVIYSFLEDDVKQSFIYELEEYAPGGNLSMDYTKRRRPKVIQSLYHP
FT                   NSLHILTVHEDNSMVFWDANTGKLIQARTLLDVDVNVPQPDLTKARLEQPERIKTVKWI
FT                   CQNNPEYTSLLITQIPLDKQPQHQNLTIIDLGGTPLYTITSYDKMSNYYSNMTSQKLVP
FT                   LPNKTPIVDVVPIARKSPFYAGCHDPAVVLLVLDDGCLETILYPSGSFTYKASLFPQSL
FT                   SWARPETTAMVATSVPQKLWLGLLSSANNKDFILKGGMQAKKPARVHEYRSALATGHAN
FT                   GSVRLWDASFGELDDNSVFEVNLARVLNMGSNLSISDISFATDTLELSVATETGVVALF
FT                   KFEVNQFYDPEHKNKDRDMEMRFRRFSIGSSKEMLIDVRDRSPETVRQGFMPSTVVNAQ
FT                   HGPTSALTNSNIGFVAIAYEDGTFVVVDRRGPAIIYMQNVRGLPGIKGRKFTAIEFAIM
FT                   EYGDDGYSSILILCGTDVGELVTLKILPDSGGRFVVEFVEIKQTNDKSPILKIDTFEKK
FT                   TTESCFATISKMQDLGKGVVINGMVVVTSETDIRFVDPGKSKEGHKSFKHKIATSGISH
FT                   ITFINAVGQKQSLCVLIVLESNGTVKIFTTPDMKELKSMQLPFPIQAQYIRESSVLRNG
FT                   DIMTRTGKFQSYLFSTFDQRAIGLNKAYTQEQVEKQDTLYNPGLKIPWRPQVNSLQLAR
FT                   GTSYCTREQLDLLLGGERRPQSKYEESEIAIGTISLRKETSAPNSPNMQNDEHAYKKPV
FT                   SRRGRNSGYEYFRSMSRAVENQWDAVEDGINEYATAIGQAMNDTVEETSKDMVRGAFGF
FT                   "
FT   CDS_pept        complement(519751..521304)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000018075" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19350622"
FT                   /locus_tag="CAGL0K05313g"
FT                   /product="Similar to uniprot|P07263 Saccharomyces
FT                   cerevisiae YPR033c Histidyl-tRNA synthetase "
FT                   /function="ATP binding"
FT                   /function="histidine-tRNA ligase activity"
FT                   /biological_process="histidyl-tRNA aminoacylation "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAG61417.1"
FT                   /db_xref="GO:0004821"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006427"
FT                   /db_xref="HOGENOM:HBG398889"
FT                   /db_xref="HOGENOM:HBG616575"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004516"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR015807"
FT                   /db_xref="UniParc:UPI00003B6C70"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FMT8"
FT                   /transl_table=1
FT                   /translation="MSAEQAPAHPQQNAKKEKKSKLQVSLKTPKGTKDWADTDMVIREA
FT                   IFSSLSQLFKKHGGVTIDTPVFELREILAGKYGEDSKLIYDLKDQGGELCSLRYDLTVP
FT                   FARFVAMNNIQNIKRYHIAKVYRRDQPAMTKGRMREFYQCDFDIAGSYESMVPDAEILS
FT                   ILVEGLTGLGINDFKVKLNHRKILDGIFQISGVKDEDVRKISSAVDKLDKSPWEVVRKE
FT                   ITVEKGQSEETADKIGEYVKLNGTLKEIHTILSQDSAITGNELAKQGLDEIATLMEYAD
FT                   AFGISKFISFDLSLARGLDYYTGLIYEAVTEASAPPENATELKKKSKSTDDASEYVGVG
FT                   SIAAGGRYDNLVNMFAEASGKKSSSIPCVGVSFGVERIFSLIKQRTHLTNAIKPTATQV
FT                   FVMAFGGGKDWTGLLPERMAITKKLWEAGIEAEYVYKSKANPRKQFDAADKAGCPIAVI
FT                   LGKEEFAEGKVRVKRLGQEFANDDGELVDSGDVIEAVKQKLSEVHKDGINDVTRLLKGL
FT                   "
FT   CDS_pept        521914..523503
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000034072" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17444525"
FT                   /locus_tag="CAGL0K05335g"
FT                   /product="Similar to uniprot|Q12406 Saccharomyces
FT                   cerevisiae YPR034w ARP7 Actin-like protein "
FT                   /protein_id="CAG61418.1"
FT                   /db_xref="HOGENOM:HBG058455"
FT                   /db_xref="HOGENOM:HBG203958"
FT                   /db_xref="InterPro:IPR004000"
FT                   /db_xref="UniParc:UPI00003B6C71"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FMT7"
FT                   /transl_table=1
FT                   /translation="MTVDKKCVVISTGSHRTVAGFNNVDLPQCTIPSSYVRVLRDDDVS
FT                   MDDGEEDESRYEYVFGLFDMMDEAAFDVNGKGGREVFTIVDDHGIPYNWKALERLYRYI
FT                   YEKELKVDPSELPLVITLPSMTNRELETKIVENYMELAFEKLKVPVLQIVVEPLGIMLS
FT                   TGKSSSLVIDVGATGCTVTPIIDGTILRNSIVKSRFAGDFLDFQTHKKLEELKKRVAKD
FT                   DMETDGMEETPQSSLQVWLNANTSIHEFKTSMVSVFDKDLKEVEKYYEEQMRLYRQQQE
FT                   RMAEQQNSQTQQMNQYTIPMNNPNINNPLVQKQNYLLRVKDNKTGAMINRTVQVENKEL
FT                   YEIAEYLFQPKLASEDFSSKDGLGELIGKAIKKSGASVNSNTAGTQVSGSGNSSGGNSG
FT                   PQTNGPLIPLNGYSSIGFGTSATGAGSDGSATNNITPEHVYSLLLTNVIITGGTSLIDG
FT                   MEQRIIRELSIRFPQYKLSTFTNPDQLQRSLQAWNGAVSLSNLPKWGLTQWFTKEDFNN
FT                   HKLKKDNNNVSQ"
FT   CDS_pept        525728..526846
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000061500" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17444526"
FT                   /gene_name="GLN1"
FT                   /locus_tag="CAGL0K05357g"
FT                   /product="Glutamine synthetase "
FT                   /EC_number="6.3.1.2"
FT                   /function="ATP binding"
FT                   /function="glutamate-ammonia ligase activity"
FT                   /biological_process="glutamine biosynthetic process "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAG61419.1"
FT                   /db_xref="GO:0004356"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006542"
FT                   /db_xref="HOGENOM:HBG009018"
FT                   /db_xref="HOGENOM:HBG299709"
FT                   /db_xref="InterPro:IPR008146"
FT                   /db_xref="InterPro:IPR008147"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="UniParc:UPI00003B6C72"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FMT6"
FT                   /transl_table=1
FT                   /translation="MHEHSVEKTQILQKYLELPQNGKVIAEYVWVDGTGNLRSKARTLN
FT                   KVITSIEQLPEWNFDGSSTNQAPGYDSDIYLKPVAFYPDPFRRGDNITVLAECFNSDGT
FT                   PNKFNHRHEANKLFQAHKDEEIWFGIEQEYTLFDMYDNVYAWPKGGYPAPQGPYYCGVG
FT                   AGKVYARDVIEAHYRACLYAGINISGINAEVMPSQWEFQVGPCEGISMGDQLWMARYFL
FT                   HRVAEEFGVKISFHPKPLKGDWNGAGCHTNVSTKDMRVPGGMKYIEQAIEKLSKRHNEH
FT                   IKLYGADNEQRLTGRHETASMTSFSSGVANRGASIRIPRPVAKEGFGYFEDRRPASNID
FT                   PYLVTGIMCETVCGAIENANMSKEYERETNEQ"
FT   CDS_pept        528006..529523
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000066030" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17444527"
FT                   /locus_tag="CAGL0K05379g"
FT                   /product="Similar to uniprot|P41807 Saccharomyces
FT                   cerevisiae YPR036w VMA13"
FT                   /function="binding"
FT                   /function="proton-transporting ATPase activity, rotational
FT                   mechanism"
FT                   /biological_process="ATP synthesis coupled proton transport"
FT                   /cellular_component="vacuolar proton-transporting V-type
FT                   ATPase, V1 domain"
FT                   /protein_id="CAG61420.1"
FT                   /db_xref="GO:0000221"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0015986"
FT                   /db_xref="GO:0046961"
FT                   /db_xref="HOGENOM:HBG020914"
FT                   /db_xref="HOGENOM:HBG203959"
FT                   /db_xref="InterPro:IPR004908"
FT                   /db_xref="InterPro:IPR011987"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI00003B6C73"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FMT5"
FT                   /transl_table=1
FT                   /translation="MIGDTRLLLDSIHFNEMRSVIRSRSVAWEALSRSEEISDEEATYA
FT                   KLVENVLVKKSVDSKELNVNENLIRSLVQLVGNTHNKDCRKSSLNLVAELLSSETHYKQ
FT                   TVEVFQEDKQLMRDLFQNSFQSEQEINDSQFTLIAAFNMVSLLTQESLQDSKLVEELLT
FT                   VSDGLLLKILTNLQELDTSYVCIRLLQELAVHKGYKLIIWKYESQILPTLFTILRRAID
FT                   TKHKNTPLGFSSSTSTSSNSSHSFHRSASSALVPNANNLVIQIQYYSLLLIWVLMFERK
FT                   VQKEYVTKYLTEYLNLLKIMKVTIKEKISRVSISILLQCLVDENGEVKDKKLIKQLLLL
FT                   GNALPVVESLTERKYTDQELKDDLVLLKDILEQEYKELTSFDEYIAEVDSKLLCWSPPH
FT                   IDNGFWVDNIDKFKLNNWELFKKLINILEDIKRDTNVDINESKTKTIIEVALSDIAHVV
FT                   ELLPESIDVLGKTGGKLLIMELLNHSDSRVKYEALKATQAIIGYRFR"
FT   CDS_pept        complement(531444..532067)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000180458" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17444528"
FT                   /locus_tag="CAGL0K05401g"
FT                   /product="Similar to uniprot|Q12284 Saccharomyces
FT                   cerevisiae YPR037c ERV2"
FT                   /function="thiol oxidase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAG61421.1"
FT                   /db_xref="GO:0016972"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG058450"
FT                   /db_xref="HOGENOM:HBG397683"
FT                   /db_xref="InterPro:IPR006863"
FT                   /db_xref="InterPro:IPR017905"
FT                   /db_xref="UniParc:UPI00003B6C74"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FMT4"
FT                   /transl_table=1
FT                   /translation="MAKRIGRFHGSHIVRAIAALTLVGLVWYFFNTDSSMSVSAPMAGR
FT                   LRDTVEPVSNVEKSGSGVSQEDKMKAIDDATIMPLMEDKQAKVELGRASWKYFHTLLAR
FT                   FPDKPTKEERQKLKTFLELYAELYPCGECAYHFVKLMDKYPPQTSSRTAAALWGCHVHN
FT                   IVNEYLKKPEYDCSTILEDYDCGCGDTSVKNNKVTVEKEGRQHG"
FT   CDS_pept        532591..533820
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000213547" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17444529"
FT                   /locus_tag="CAGL0K05423g"
FT                   /product="Similar to uniprot|Q12199 Saccharomyces
FT                   cerevisiae YPR040w"
FT                   /protein_id="CAG61422.1"
FT                   /db_xref="HOGENOM:HBG028127"
FT                   /db_xref="HOGENOM:HBG397437"
FT                   /db_xref="InterPro:IPR007303"
FT                   /db_xref="UniParc:UPI00003B6C75"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FMT3"
FT                   /transl_table=1
FT                   /translation="MSASDPSLPNGAKKPNRPGAERGPGINAIQINAAREMHAMSIRGR
FT                   NPRNANTTSGSSILTRTTIPVEASHTSTFATPSAPDTTINKSPKKKNDIPHHVCNNNPN
FT                   NPNCPHCGTVIIPSPRATLPLKDSPSITVADTWKVTTQKRPILNSQELDDWEANKLQKL
FT                   PLPEMIFGNNFVRIDNVKNGWYIEFNALDALRQVNLEDTGLRVAHSKVWMQSKQKQQQQ
FT                   QQQQQQQQQEKTSSSESSSANPLEIAHPYDWTYTTLYKGTTPTDAKLPKFEEDIGAELP
FT                   IDKLSRPDKILFFDDMILFEDELADNGISVLNVKIRVMHERLLLLSRFFLRVDDVLVRV
FT                   IDTRVYVDFTDNIVIREFKKHECHYNELLAKHQRSNKKTLHDPKAALRDSNWVVEHTPL
FT                   IERKAEIIHF"
FT   CDS_pept        534680..536491
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000154308" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17444530"
FT                   /gene_name="SGO1"
FT                   /locus_tag="CAGL0K05445g"
FT                   /product="Shugoshin"
FT                   /biological_process="cell division"
FT                   /biological_process="meiotic chromosome segregation "
FT                   /cellular_component="chromosome, centromeric region "
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG61423.1"
FT                   /db_xref="GO:0000775"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0045132"
FT                   /db_xref="GO:0051301"
FT                   /db_xref="HOGENOM:HBG123765"
FT                   /db_xref="HOGENOM:HBG202831"
FT                   /db_xref="InterPro:IPR011515"
FT                   /db_xref="InterPro:IPR011516"
FT                   /db_xref="UniParc:UPI00003B6C76"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FMT2"
FT                   /transl_table=1
FT                   /translation="MSNLYSAGTPHIQELQNILDSQQEEWAAIKENYTTQNSLIAKENC
FT                   TLKMKLSELENKVSQLIRENVQLRSQVSLNKLEFQNKLASQINVLENGVIQRLEEVLYM
FT                   FDSIRKKESLPSRPTSTNETVDRIKKRRQSNEEARNRRRSRSVSTGSAHSTSSMKRRSS
FT                   TFGEDLIDASIKRALDNAQSNSLQTSDTLRLSELPGLNEIDTNNVNNDNLLSPIPHKKR
FT                   KSNRRKSIYVPELPKPNNEPLMENTIEQQENICSESLIQEGEQSEKLGENLDADQSHVE
FT                   DQSFSFTNSVLEYSIPEENTLPKQDILDETEKRDTAVNQKKKLEIFHDPPVEELSSSKN
FT                   EKPPENSITNDPAFITVTGNNKVKHSMKSRKPKKNKGSVDESMPCTQSTESVDFDRPRR
FT                   TRGKTVDYRLPSLRAKMRRPTEKLVDATTTVNIQDLQVKYKKSKKVLEKELKTDMKAMK
FT                   SPKKNEKTFESGTIFKKISRDNESRPSSTHSTSSVDAECSHNNSHSENINSSINDTTHS
FT                   SFNNSTKSVLSDITNISKNKQQQKTKKLLKTAIINDIYDDKTKNAQKTVSFRVNEDDLS
FT                   VFDLIQHNDTNKSSPKTYRSRSRKNKA"
FT   CDS_pept        join(complement(537474..537567),complement(536671..537347))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000257899" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18502832"
FT                   /locus_tag="CAGL0K05467g"
FT                   /product="Strain CBS138 chromosome K complete sequence "
FT                   /function="thymidylate synthase activity"
FT                   /biological_process="dTMP biosynthetic process "
FT                   /protein_id="CAG61424.2"
FT                   /db_xref="GO:0004799"
FT                   /db_xref="GO:0006231"
FT                   /db_xref="HOGENOM:HBG064619"
FT                   /db_xref="HOGENOM:HBG588098"
FT                   /db_xref="InterPro:IPR000398"
FT                   /db_xref="InterPro:IPR020940"
FT                   /db_xref="UniParc:UPI00017BD8CE"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FMT1"
FT                   /transl_table=1
FT                   /translation="MTVTNLEEKQYLDLCERIIKEGEFRPDRTGTGCTDAKKLSDQGVK
FT                   IWEGNGSREYLDKMGFVDRREGDLGPVYGFQWRHFGAEYKTCEDDYTGQGVDQLKEVIH
FT                   KLKTNPYDRRIIMSAWNPPDFPKMALPPCHVFSQFYVNFPKDGKPQLSCLLYQRSCDMG
FT                   LGVPFNIASYALLTKMIAHVCDMEPGEFIHTLGDAHVYKDHVDALKEQISRTPRDFPKL
FT                   RINRKVSDIDDFKFEDFVLEEYDPHPRIQMNMSV"
FT   CDS_pept        538801..539823
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248643" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17444531"
FT                   /locus_tag="CAGL0K05489g"
FT                   /product="Similar to uniprot|P41834 Saccharomyces
FT                   cerevisiae YOR075w syntaxin of the ER "
FT                   /protein_id="CAG61425.1"
FT                   /db_xref="HOGENOM:HBG058793"
FT                   /db_xref="HOGENOM:HBG397799"
FT                   /db_xref="InterPro:IPR000727"
FT                   /db_xref="InterPro:IPR019529"
FT                   /db_xref="UniParc:UPI00003B6C78"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FMT0"
FT                   /transl_table=1
FT                   /translation="MSNLTPLFRQYVSIIADESTGLQEAQSETKSSLNEIVTRDSFLKE
FT                   CRSLAKFLFELNTVLKSVCEEYMNDFSMTEAEKDNFDAEARLQLQEYVKKLKHLEQYEK
FT                   GRRKLIDEQIRKISGSLNFFKYNNRNIDKRDFISYQNFNNDFRSGVLRSLNLWLKYVSS
FT                   EFSNMQQERLASQRKFQQSLSFSQPSQEVDLNNHSEVDLTESISLTVSQSQPVEHIQDE
FT                   IKQYEETISQLTQEQLQVLETEHEELINQKNEQLKKVGLINKTIMEIVGVQSELAAHLQ
FT                   VQSQNINSMLDNQDIIETNITKGNKELKKAQRAAGKTAKLTTYIAVIIGILILLLDYIS
FT                   "
FT   CDS_pept        complement(539944..542127)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18502833"
FT                   /locus_tag="CAGL0K05511g"
FT                   /product="Strain CBS138 chromosome K complete sequence "
FT                   /function="GTP binding"
FT                   /function="GTPase activity"
FT                   /protein_id="CAG61426.1"
FT                   /db_xref="GO:0003924"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="HOGENOM:HBG123766"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="UniParc:UPI00003B6C79"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FMS9"
FT                   /transl_table=1
FT                   /translation="MSRLEELARQRRLKKAGSESSESSKNYEGTSKSASLLEKLRNRKK
FT                   TASESPHNSEANTEIANHGSQAALNQTSGKVRSTPIKTSSSSTLGSKLRELRSRKKVEE
FT                   AKQKESVDVTPEIDSLPNGQSNKQSRDQLKQQYLVEMAEFKALQGRLNINIDSSKTIRR
FT                   LSGHSKFLVNSRNKVHKLYKQKRDMLLTVFYPARNKSARKKSIEGFHKPSPDDIVLAAQ
FT                   EQVFQAVTENVAQLSIKPIKIKERVSKRFTDNMTDQTKVQKQQLTVEDFINDRNATSFQ
FT                   VPMFGLPGSGKSTILGQLSFHLGLTTREDIRVIKTDMERMHFRRIDKLDTRLLTTSPFC
FT                   WVVDETTEERQFGHSNNIKPLHIKYNDTDIIINEVPGSFDLCSTIETKRYVGNSVIIVV
FT                   SAELGDYEANFDMKKRLIEKLIYCNGVGVRRILTIINKMDLIDWDMDRYTVMKHELELI
FT                   YQQVGIDILKCDFIGTSAITGEALTNDGDNRKRMFTKGSFSSLLNVLLSYKLQFKKEVL
FT                   ESSLVNSQEQTLLDSEKLIAIQTGNKHEQQLSVPFYIERGLILKGQKLKINRTGLEVVV
FT                   KSIKESLRKKKSVNVAVVGQSVDLLFEPSEAITSSNINNILTSCNSPKLIETSEFNMKM
FT                   WSLKNCSKQLDFNNILIFCVGRFLNICISNVEQTENNEKLNNFQYIFCRACLKSSENML
FT                   AFEPGYESAKSFVLFFENRAIGFGELLLNDRSF"
FT   CDS_pept        542446..543171
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000178663" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20197407"
FT                   /locus_tag="CAGL0K05533g"
FT                   /product="Similar to uniprot|P40962 Saccharomyces
FT                   cerevisiae YOR077w Zinc finger protein "
FT                   /function="zinc ion binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAG61427.1"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG377579"
FT                   /db_xref="HOGENOM:HBG717067"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="InterPro:IPR019447"
FT                   /db_xref="InterPro:IPR022755"
FT                   /db_xref="UniParc:UPI00003B6C7A"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FMS8"
FT                   /transl_table=1
FT                   /translation="MSEDFNSAKFLNKQLKARGLQKLRFYCQVCNKQCRDQNGFKSHVK
FT                   SPSHLKNISTVTQDDILEFTKLFEENFLNTLKTNHGEKKIAVNKLYNEIIKDRDHIHMN
FT                   ATSFKSLTGFIKYLSKEGKIKVYDDNIGDMPEDQVDLTQLNISFIDNSDTNLRRKEKLQ
FT                   EIEAEELTESKLEEYLRTKRQLREQEEEESDVQDTDLGSNTDIQRDNLTNLKIQLKKTK
FT                   IKQNKVKKPLNKNKNNVFG"
FT   CDS_pept        543605..544297
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000142062" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17444532"
FT                   /locus_tag="CAGL0K05555g"
FT                   /product="Similar to uniprot|Q08492 Saccharomyces
FT                   cerevisiae YOR078w"
FT                   /protein_id="CAG61428.1"
FT                   /db_xref="HOGENOM:HBG103422"
FT                   /db_xref="HOGENOM:HBG252414"
FT                   /db_xref="InterPro:IPR013268"
FT                   /db_xref="UniParc:UPI00003B6C7B"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FMS7"
FT                   /transl_table=1
FT                   /translation="MTVSTRSKEHIKFDDNDETAHTETETQESVKSLRSKSVDVSDSDS
FT                   DSDDDAPEEEGLGNAKDEVEDQIKKQEQAAILEKQRIREKRKKENERLKEQQLEKKMRT
FT                   EEMQKQIAELEKLQSQTVESDEEELQELPEDLLAKINNVDPTAGQTIPKHINFNDIDTQ
FT                   DFVPEVKEQIKKRKKNALKQLCKTTMNKGVVKVSVLSSNLSKSAPKKEGNVTNLRNKWL
FT                   KRRSLNRK"
FT   CDS_pept        complement(544460..545455)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000784" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21046267"
FT                   /locus_tag="CAGL0K05577g"
FT                   /product="Similar to uniprot|Q12067 Saccharomyces
FT                   cerevisiae YOR079c Metal homeostasis factor "
FT                   /function="metal ion transmembrane transporter activity "
FT                   /cellular_component="membrane"
FT                   /protein_id="CAG61429.1"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="GO:0046873"
FT                   /db_xref="HOGENOM:HBG123767"
FT                   /db_xref="HOGENOM:HBG202834"
FT                   /db_xref="InterPro:IPR003689"
FT                   /db_xref="UniParc:UPI00003B6C7C"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FMS6"
FT                   /transl_table=1
FT                   /translation="MGINIAAVILLAILLLVATFSIGCLPFYYININSTYSNTQNGFLK
FT                   VFSQFGVGMLLGTAFMLVIPEGIKACTEEGGNVGFDLLAGFIGVYLFDRLGHSIMSNTN
FT                   AFLIQNPEESNDLPTSSAFRSNLNYSIKEILTKPRVVVARVLKNNVILAFVIHGISDGV
FT                   ALGTTSNNQRLLIVVFIAITIHKIPAVLSLSALMLTKQGLPMTECMTNLFAFSLSTPVG
FT                   YILLSLLNLRQSATMDYISSNLLLMSGGSLLYASFTAFSEDDHFIEQTSDPSTFVNDEY
FT                   NAASNDTESISVDVLEQNSKTSYFLKYDESLYILVGAFIPTLISFMVKDD"
FT   CDS_pept        545761..547893
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000142330" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20197408"
FT                   /locus_tag="CAGL0K05599g"
FT                   /product="Similar to uniprot|Q08496 Saccharomyces
FT                   cerevisiae YOR080w"
FT                   /function="binding"
FT                   /protein_id="CAG61430.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG123768"
FT                   /db_xref="HOGENOM:HBG202835"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR022364"
FT                   /db_xref="UniParc:UPI00003B6C7D"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FMS5"
FT                   /transl_table=1
FT                   /translation="MPDEEILNKAIELGTTYFKSEDYRKARSLFEKALKLVDSYSKDEI
FT                   KKLRGEIYHVDELPDELYKRVKCERIITHPKHVKILDNLSACWEKQNILDNALKLSHKM
FT                   VKLEPFNIKTYIRKGRILMKLTKYRDAYHNFKEGLTRIQYASQKYELIPSRKLMKYCEQ
FT                   QKNIVRDMFLNKSKSLDLAGTNEKKRKLIDPILEQVQLKKQKESDAEEYFNIKEIDFIE
FT                   KLPIELTLKILRKIRPRQLAELMLVCRKWREVILQAPALFDEFLFQNITLRQMIKFNAF
FT                   IMKLSKINFYISGSNILHFKTLKISPKSPSEEFKITKILLESSSEIIRCNRLIMAIPNT
FT                   TTSHIAKMIPKSNEFTKSIRELSLMCTLRADKNYELDILESFEYLTRLEIMFHNSLVPL
FT                   SSSNEEVTGVGTQNAHWTRTLKYFSVICDTRKVPTFPFKNILQNKNFPSLKKLCISGVT
FT                   MSLQADQFDWLTNTPALNELWLENNNNAKLSHFFSTIRDIHIWDDLKRLTFRENRNYDK
FT                   VSLEANNRSYCYLSNLRSLETLDLMGGSITGLGLTRLFSYFMDCKITKLNLGDCMNIQF
FT                   TLLPPSHAMETALQPSFLLSSLPNLNNLQLPKMATLDDDAITLFSKFAHLMSSMDILDI
FT                   SFNPSVTGVSVYSFLKNLNTYREKALGLLNIDNCNNISHITVGTILAQGFVNKVSCVYE
FT                   REHWHNFGSNSFRYMG"
FT   CDS_pept        complement(548043..550349)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17444533"
FT                   /locus_tag="CAGL0K05621g"
FT                   /product="Similar to uniprot|P36165 Saccharomyces
FT                   cerevisiae YKR089c"
FT                   /function="hydrolase activity"
FT                   /biological_process="lipid metabolic process"
FT                   /protein_id="CAG61431.1"
FT                   /db_xref="GO:0006629"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG124799"
FT                   /db_xref="HOGENOM:HBG202836"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR006689"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR021771"
FT                   /db_xref="UniParc:UPI00003B6C7E"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FMS4"
FT                   /transl_table=1
FT                   /translation="MVLTRRTLPVTEFLIDKYYEVAQYGRVLHEGEGSDTEGGEEEHTK
FT                   LEFETEEAVPDSRESTPSYSEMVYAQRAALNQRLANSQWLKIPMPLLDKLNSTLRWLTG
FT                   KDLTTWEIEYELKKNRQLARSYDDWKAISLQLDELQGKADWKVDDETDLYDYQAVRALT
FT                   HKMKELRENKNYAELLYYIRTTWTRNFGNMGNVNLYRHTNHGTKKLIEAYLAESKLCVE
FT                   ELVSKSGFENEYLLGILQQTRRNIGKSALVLSGGATFGMFHIGVLAALFEADLIPRVIS
FT                   GTSAGAIVASIFCTHTTEEIPSLLESVLGMRFKIFRDEDDLETTENVFVQMARFFKHGT
FT                   WFDNRHLIKTMKGFLGDLTFREAYNRTGKILNISVSTASIFEQPRLLNNLTAPNVLIWS
FT                   AVCASCSVPGVFPTCPLYEKDPITNQCTVWGGSTSVKFMDGSVDNDLPISRLSEMFNID
FT                   HIIACQVNVHVYPFLKLSVSCVGGELQNETSARVKQHITGFCNYFSDELVHYLEILSEL
FT                   GIAETLCNKLRSVISQKYSGDVTILPKLDMISCVNELLSNPSQEFLLKETTLGARATWP
FT                   NIPIIKSNCTQEFILDKAIAYLKEQIIVSSSSDIPANISYGAMERVMLSNDPKKRQLSN
FT                   QSTDDTFEENNVLDDNLMENEPTNSTLLLRENAFTTIHDPLFPREKYLAPIPKKRRNHR
FT                   KSEASTRVRSRYAVGSCSFSVGSATKTMEILQVKTSKSASPKKYQNMRISPAIKTSDRV
FT                   IFGSNRNVFDYLQRD"
FT   CDS_pept        551022..552314
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000141842" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20197409"
FT                   /locus_tag="CAGL0K05643g"
FT                   /product="Similarities with uniprot|Q12416 Saccharomyces
FT                   cerevisiae YOR083w"
FT                   /protein_id="CAG61432.1"
FT                   /db_xref="HOGENOM:HBG123769"
FT                   /db_xref="InterPro:IPR013734"
FT                   /db_xref="UniParc:UPI00003B6C7F"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FMS3"
FT                   /transl_table=1
FT                   /translation="MATRSREYTGAEGLGVRVGVEGDSDDESMGRDEDVPRGSRVTVFG
FT                   EGRVPETPSPPRNSSHARRSSTSLGFLGTPTHPGRYFDVPNSPSSNKGRKTSISHESGS
FT                   GRTRLLPPTTPKSRQTEVFMSPSPKLRSPQVSKEIEKKPIKEISNELKTRLNYALMKLQ
FT                   NGWVDKSLPELEHTLATDRGDGINEIGQGQNSGEVFSKLDNNDAGKDFLQQRRKSGYVN
FT                   QFAGDDSSSATFKFEGLKGNTQSNDKGGDERAGTKTAIKTESNEMYSEVQSDSDENSND
FT                   EGNSAHSAFLKALSSPKKKQKSSSSTSYPVSPLRWTSTSRPKPLTLDTNLENTKKNTKG
FT                   PPLEVEAIETLMSLASPKKSSGSLDEALASNDSASGRPGSVTGKGATPIFLRNDVLRQK
FT                   NASNEGQLRLGNNEILAEKKSDVETEVDESD"
FT   CDS_pept        complement(552804..553943)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000246415" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17445536"
FT                   /locus_tag="CAGL0K05665g"
FT                   /product="Similar to uniprot|P38716 Saccharomyces
FT                   cerevisiae YHR112c"
FT                   /function="catalytic activity"
FT                   /function="pyridoxal phosphate binding"
FT                   /biological_process="cellular amino acid metabolic process "
FT                   /protein_id="CAG61433.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0006520"
FT                   /db_xref="GO:0030170"
FT                   /db_xref="HOGENOM:HBG380413"
FT                   /db_xref="HOGENOM:HBG754729"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniParc:UPI00003B6C80"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FMS2"
FT                   /transl_table=1
FT                   /translation="MVELATKLIHDDDKHNRVSDVAPPINVSTTYRYAEEDLIPWAQRE
FT                   NFDFMDEAPVYSREGHPNCTRLETIFSDILEGHAVLYASGLAAFFAAMMHYNPKQVFLG
FT                   QCYHGVHCISDMFTRNFNVQQRTLEDIAEFAKKGDVVHLESPVNPFGTVIDVKKLADLA
FT                   HSKGAIVIIDSTFAPPPLQYAWDLGADMIMHSATKYFGGHSDLLGGILVTKDKEISRAL
FT                   KEDRINLGSMIGNLESYLLMRSLRTYEMRIMKQSENVVKIVKYLNDNKEKYPNVLGDIY
FT                   HSSIQSDAFVKDQLVGGYNSVFSFCLKSEEQCKKFPDKLKYFHHATSLGGIESLIEWRA
FT                   LSDDKIDQKLMRVSVGCESAKDLIDDLSQALQELENEYK"
FT   CDS_pept        555370..556536
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000116232" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17445537"
FT                   /locus_tag="CAGL0K05687g"
FT                   /product="Strain CBS138 chromosome K complete sequence "
FT                   /function="FMN binding"
FT                   /function="oxidoreductase activity"
FT                   /protein_id="CAG61434.1"
FT                   /db_xref="GO:0010181"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="HOGENOM:HBG255608"
FT                   /db_xref="HOGENOM:HBG583461"
FT                   /db_xref="InterPro:IPR001155"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniParc:UPI00003B6C81"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FMS1"
FT                   /transl_table=1
FT                   /translation="MGVSVKGAPNLDYFTPEQPILGKFIKYKEDEDGSSERDPPKLFKP
FT                   LKIRALEIPNRIGVSPMCTYSTNNYMPTDFHLMHYGSLATRGPGIIIVECSAVSEGTAV
FT                   TVNDMGIWNKEQASEHFSKIVKFAHSQNVIVGCQLGQFMRKVVQNVDEDNKAHNVEVGK
FT                   EAHDLSTEEIKTIVEQWGTAAKLAVEVAKYDFIEIQAGKGHITNEFFSRLTNKRKDEYG
FT                   GSFENRIRILLEIIDNVRKNIPEDTPLFIRLKACDNLDHPDAWSTDETIKLSFELAKHG
FT                   VDVLDIAGRGLRIGPKSEKENKIIFLQQLKEAHKGKTNLLIASSGVISTADYASELLDK
FT                   EAQDIILVGRPFLKNPNLVSFWADDVNITVTNAVQYSWGFYPTKSHLS"
FT   CDS_pept        complement(556732..560043)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000057100" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17445538"
FT                   /locus_tag="CAGL0K05709g"
FT                   /product="Similar to uniprot|Q12263 Saccharomyces
FT                   cerevisiae YDR507c GIN4"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="CAG61435.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG059703"
FT                   /db_xref="HOGENOM:HBG395633"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="InterPro:IPR020636"
FT                   /db_xref="InterPro:IPR020671"
FT                   /db_xref="UniParc:UPI00003B6C82"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FMS0"
FT                   /transl_table=1
FT                   /translation="MSAISSNTVSVIKNNQIGPWKLGETLGSGSTGKVLLASNETTKQQ
FT                   AAVKVISKAVFEAMNNSESNGDATNALPYNIEQEIIIMKLLNHPNVLRLFDVWETNSDL
FT                   YLVLEYAEKGELFNMLVERGPLPENEAVRAFRQIIIGISYCHSLGVVHRDLKPENLLLD
FT                   NKLNIKIADFGMAALESEDKLLETSCGSPHYAAPEIISGLPYEGFSSDVWSCGVILFAL
FT                   LTGRLPFDEEDGNIRNLLLKVQKGEFEMPDDDEITKEAQDLLARLLTVDPSKRITIREI
FT                   LKHPLLQKYPSIKDSRSIRNLPREDTYLSPLADTNSKIDDAILQNLVILWHGKDAREIA
FT                   AKLREPGANTEKTLYALLYRFKCDTQREANRARRQSKIVQRNSTIRSTAPESPSKKKTY
FT                   TPQKKNKRASIIASSSKRPVSVTKTATNITVNSSITGTPKSAKRMSMNNSARKRMSALY
FT                   GTRDSPTKTSRSRRSSIITKDFLGNRPRDSVISMSHNKRASKSSKRISLVPNLKRQSVT
FT                   TKLMATYAKLSEDDDWEYIERETKRTSSDFATLIDEIFEYEKYEQIRKEKAELERKVRE
FT                   TKEREERERKERQEKELQERLERERIEKQKEDIARQMDEEISNLKKELVGDQDNEDKFR
FT                   SVSEPLESKSKKIEDIEEDIDGILRNRKYSLQTRPVSRLDPGIGFIDKPRQSEQHVPET
FT                   VNLEPELEETEQKILETIRRSKFLGSSFDIKKELENVKRHRQTSQPIEKEMAPPALPET
FT                   LPKAVEKKNVSMDPSLRKISDIKVPQFTRKSRHFSTSNRRLSVLSMYSTKESYSNLADI
FT                   LKNGPGEKEMIQTAPTPKSADDSDQLFDTIDEADTPASVSREERLYEVAEESENELANK
FT                   KIDIADLLNSEGSNLKSVEEQEDSMKLPKLPPLFEDGSTKETKEQSKSMIPENMQSSES
FT                   QKQIEKNNSDEGGSLNPFMTKHRDVSDKGVTKEKPTVTMKTTSEQVSADKKRNMSFLRK
FT                   LSKGSSSSKDNVDVTLSTSVSSKQLFSGLVNLLKGWTKYGLKGIAIDSTSQTITGKLAN
FT                   DNILSFRSTAFSILIFSQEKGSAVTFRKVSGSGKAVRRLSDEVKKVLSKEGVLRD"
FT   CDS_pept        complement(561289..561615)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000207495" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19350886"
FT                   /locus_tag="CAGL0K05731g"
FT                   /product="Strain CBS138 chromosome K complete sequence "
FT                   /protein_id="CAG61436.1"
FT                   /db_xref="HOGENOM:HBG073579"
FT                   /db_xref="HOGENOM:HBG436396"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR019955"
FT                   /db_xref="InterPro:IPR022617"
FT                   /db_xref="UniParc:UPI00003B6C83"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FMR9"
FT                   /transl_table=1
FT                   /translation="MSDTNENNASETPDVKPDLQGQGDAPKSETHINLKVSDGSSEIFF
FT                   KIKKTTPLRRLMEAFAKRQGKEMDSLRFLYDGLRIQADQTPEDLDMEDNDLIEAHREQI
FT                   GGAY"
FT   CDS_pept        565111..567093
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000261848" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17445539"
FT                   /locus_tag="CAGL0K05753g"
FT                   /product="Similar to uniprot|P48813 Saccharomyces
FT                   cerevisiae YDR508c GNP1"
FT                   /function="amino acid transmembrane transporter activity "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAG61437.1"
FT                   /db_xref="GO:0015171"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG492579"
FT                   /db_xref="HOGENOM:HBG522524"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004762"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniParc:UPI00003B6C84"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FMR8"
FT                   /transl_table=1
FT                   /translation="MVFGGRRRNERSQSPDSEEADVSNYELHNIDDSKKGYDNLGSGSR
FT                   GATTSAVEYFDKENVDGVNIDEKLQSTTEFGGDEMPRGNIRRFIDSFKRAEQQPNQQHN
FT                   LAEDLENDLTTAISMNSLDRVQNKPTGNGQMKFEEEALKKSIKPRHVVMISLGTGIGTG
FT                   LLVGNAKALHNAGPAGLVIGYAIMGSCIYCIIQAAGEMAVVYSNLLGGFNTYPSMLVDP
FT                   GFGFAVAWVYCLQWLCVCPLELVTTSLTIKYWTTTVNPDAFVVIFYVVIIFIQIFGARG
FT                   YAEAEFFFNCCKILMIIGFYILGIIINAGGAGNDGYLGAKYWHDPGAFRGTNGIQRFKG
FT                   IMATFVSAAFAFGATEFIALTAAEQSNPRKAIPSAAKKVLYRVICIFVGTIALLGFLVP
FT                   WDSDQLMGAGGSATKASPYVLAISIHGVRVVPHFINAVILISVFSVANSAFYSSSRLLL
FT                   GLAQQGYAPKFFDYVDRQGRPFRAMCCAALFGVIAFCAASPKEDQVFTWLLAISGLSQL
FT                   FTWIAICVSHIRFRRAMTVQGRSLGEIGFKAQLGVYGSYYATIMMVLALIAQFWVAIAP
FT                   IGNNGDLDAEGFFENYLAMPILIAFYFGYKLWKRDWRLFIRAKDIDLDSYRQVFDEELL
FT                   KQEDEEYKEKLKNGPMWKRVVDFWC"
FT   CDS_pept        568119..568532
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000039506" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17445540"
FT                   /gene_name="ACN9"
FT                   /locus_tag="CAGL0K05775g"
FT                   /product="Acetate non-utilizing protein 9, mitochondrial "
FT                   /biological_process="gluconeogenesis"
FT                   /cellular_component="mitochondrial intermembrane space "
FT                   /protein_id="CAG61438.1"
FT                   /db_xref="GO:0005758"
FT                   /db_xref="GO:0006094"
FT                   /db_xref="HOGENOM:HBG355838"
FT                   /db_xref="HOGENOM:HBG716384"
FT                   /db_xref="InterPro:IPR008011"
FT                   /db_xref="InterPro:IPR008381"
FT                   /db_xref="UniParc:UPI00003B6C85"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FMR7"
FT                   /transl_table=1
FT                   /translation="MIGRRQLVTVFRRYASQNGVIGQDHTLLPPLMLYRRILRAHKLLP
FT                   PMQKEMGDKYVKSEFELHRTIDNPLHIVGFLASWQDYLHQITNGKWKEGSLSPAVLEKM
FT                   SPEQVGQLYELMKETEKVTKGDNPEEDKGKNKI"
FT   transit_peptide 568119..568163
FT                   /gene_name="ACN9"
FT                   /locus_tag="CAGL0K05775g"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FMR7 "
FT   mat_peptide     568164..568529
FT                   /gene_name="ACN9"
FT                   /locus_tag="CAGL0K05775g"
FT                   /product="Acetate non-utilizing protein 9, mitochondrial "
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FMR7 "
FT   CDS_pept        complement(568808..569074)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000057097" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20197713"
FT                   /locus_tag="CAGL0K05797g"
FT                   /product="Similar to uniprot|Q04406 Saccharomyces
FT                   cerevisiae YDR512c"
FT                   /protein_id="CAG61439.1"
FT                   /db_xref="HOGENOM:HBG059709"
FT                   /db_xref="HOGENOM:HBG103745"
FT                   /db_xref="InterPro:IPR021475"
FT                   /db_xref="UniParc:UPI00003B6C86"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FMR6"
FT                   /transl_table=1
FT                   /translation="MSQENVKYPTTMSCREAFDQLTTCLSIGGQFRNYYRYGEFSACEK
FT                   QVNKFKFCILNAKDPVKVQEWYHNQVEENKLRRGSSDIVWKER"
FT   CDS_pept        570054..570482
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000095204" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21046537"
FT                   /locus_tag="CAGL0K05813g"
FT                   /product="Similar to uniprot|P17695 Saccharomyces
FT                   cerevisiae YDR513w TTR1"
FT                   /function="electron carrier activity"
FT                   /function="protein disulfide oxidoreductase activity "
FT                   /biological_process="cell redox homeostasis"
FT                   /protein_id="CAR58051.1"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0015035"
FT                   /db_xref="GO:0045454"
FT                   /db_xref="HOGENOM:HBG728471"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR011767"
FT                   /db_xref="InterPro:IPR011899"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR014025"
FT                   /db_xref="UniParc:UPI00017BD8D4"
FT                   /db_xref="UniProtKB/TrEMBL:B4UN35"
FT                   /transl_table=1
FT                   /translation="MISIDFSNLIVIIAVLLLTRYISQKFYSSLGNKMVSQDTVNSVKN
FT                   MIGQKKIFVASKSYCPYCRAAKQTLFEELKVPMDKAVVLELDEIEEGSDIQQALAEING
FT                   QNTVPNIYIDGQHIGGNSDLQKLKQTGKLQPLLQKVLA"
FT   CDS_pept        complement(570750..572231)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000057095" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17445541"
FT                   /locus_tag="CAGL0K05819g"
FT                   /product="Similarities with uniprot|Q04408 Saccharomyces
FT                   cerevisiae YDR514c"
FT                   /function="nucleic acid binding"
FT                   /protein_id="CAG61440.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="HOGENOM:HBG123770"
FT                   /db_xref="HOGENOM:HBG203335"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniParc:UPI00003B6C87"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FMR5"
FT                   /transl_table=1
FT                   /translation="MLSVARMSARRKRGGATKQAVVRLDNDVDMALLRRWMRGRVPMHV
FT                   RQVKEPLVRATNYNQLMKGVALDKGKDPRVSFLNELDHFKRIKSLKYEVPNRQRMKYVD
FT                   GYLQKLSESYHLTNKRANKLLNSELKTLEDNWIARHGKLPKIPNDSNISQTKKQHLKEQ
FT                   LSAYNAEVRQIKDNQPVTVYSVPGGTNFDYLTNCIKLLNSDRAILFSIDIEAFEFDTKI
FT                   ITEIGISIYDPRENLYSTAPITRNYHLIVSEVLQLRNSKFVCDYKDCYLLGESFVMPLK
FT                   ECCAFVQALLNYYMKPSTDNERTWSRAFVGHNIKGDIKWLKDIGVDFRDIGEPAGELRP
FT                   YKEEADKNEPVYLLDTEKLYCANYGRKGSNLGRILQLLEIPHAFLHNAGNDAHYTLELL
FT                   KRMCDVQYRELKRLDDLEHIATKIEKLNKRAKEEPKILPMSYAIAVANKTVKNFNDSNN
FT                   GKKRNNLVQQTEFGGATFYNDPKEAFLSTFSNIKT"
FT   CDS_pept        573144..577262
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000141720" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20197714"
FT                   /locus_tag="CAGL0K05841g"
FT                   /product="Similar to uniprot|P12351 Saccharomyces
FT                   cerevisiae YLR256w HAP1 transcription factor "
FT                   /function="DNA binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG61441.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG059398"
FT                   /db_xref="HOGENOM:HBG202512"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniParc:UPI00003B6C88"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FMR4"
FT                   /transl_table=1
FT                   /translation="MNNTPMPPMNSAGVNMNSAMYALPMPQDNADVAKSSKDAGANMNK
FT                   NTSNIKNKEKEKEKVKRKRNRVPLSCTICRRRKVKCDKSRPNCTQCVKTGVAHLCHYME
FT                   QAWAEEAEKEISKEMELKQLRSKVKQLEETLSRYNSLTDVTSGLHMNTGSPYPHSRDSS
FT                   SNPTTATTTNNNSNYNTGTFNSPAVHDPKIKTEHNDFANNDSMTDAYMNSIFKKFESDE
FT                   LDLTREFDMLHLKKDYGLIHLGPTHWLAIMKGDPYLKLLWKHIFTMREKLVEWTKMKQM
FT                   GKVSKCPIDHSKLKQGQPQINNGQYTNVNGNAINPGKCPVKHDSTLSPGISKCPVKHEN
FT                   GTDMNTINNLPMGPTTAVHPGVGANPPTSGCPVQHGGNSFIPGFIGGHQQANSNVPQMD
FT                   AKGNSAGIGKCPVTHSVKQENEKSASPTLPEVSQPSFTKKEVMEQLQSSLPPRGIVILF
FT                   VNKFFETLYQLAPIIDETNFKNQLNIVFPELNIFEGHKAKDKTSRCPFDHSKLSTINIT
FT                   KSSDYCLLGMLLIIMRLVWLQLPANVNILSFSDNSKITMSTDDKLLSGFEIKTELIESL
FT                   KTRLIEFDEISSVSNANVTISTIQFAIFYRIILLCNTNNAPSGGTLSALKTVNNDNETH
FT                   QGLLSSIVQMAFSCGLHRDPDNFPQLVTVFPNQSADSSDSADNKDQSRNSTKGNSKHHK
FT                   ENTIERYKHTWRKLWYYIISLDIQQSFSLGTPRLLRNLKDFSDTKLPSSSKIDYKNDIK
FT                   ELVIVKNFTLIFKLDLCIMAVLNHILNLSIARSLKKKDLDSLIKLLSDLIFGERNVNEV
FT                   VSELIERNLLSSSELVATNMQENLLFEQSTHPVADDVKDAVLYGLPTLESLYAKNEIPF
FT                   KDIMLSKNSGYGGESKSENLSRSDKVKNTLTYSLLYSRHLTLRLLVYIMNYILFTRYEP
FT                   LGDSDPDTIIITKYYAQEALDFSVDCFKNSMIFFENINNPIFKSASVLLLPQCLDVCHR
FT                   SLQYFICLILRVKCGNITGNGGGQCPFFAVKNESGTESENEKEADLNNPGFLNGKDIMS
FT                   MSTSKIDLDDTDSLLQTLISNISSFYSLTQRLAKSYTLAIRIMKSTGFFMTLLNDQSSK
FT                   NQMNSFLPPKHPKIPSIASLLRNDGAAFLNADVSQLRRCPVYQDTIGFDVTRNSSFPGP
FT                   LRTSIDRIGTQLPPLKSYKPITYTSSDVRGCSSRGASRGSSAISSPGVSNLDGPPIKRQ
FT                   RTMENITSIPRPTEKHMGRLNGFDMINNSNGNILDVNNLPVPALNPLSPNGMLFQDLGA
FT                   TPNHTANGTAVGTPNDLENFLMANTNFNGINPSNIVEAFGINKTDPNLGLTNMDFLPID
FT                   NLGFDYEPDLNNIFNGETGTLKFDTNETI"
FT   CDS_pept        complement(577370..578968)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093643" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17445542"
FT                   /locus_tag="CAGL0K05863g"
FT                   /product="Similar to uniprot|P53109 Saccharomyces
FT                   cerevisiae YGL160w"
FT                   /function="electron carrier activity"
FT                   /function="flavin adenine dinucleotide binding "
FT                   /function="iron ion binding"
FT                   /function="oxidoreductase activity"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAG61442.1"
FT                   /db_xref="GO:0005506"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0050660"
FT                   /db_xref="HOGENOM:HBG059397"
FT                   /db_xref="HOGENOM:HBG396194"
FT                   /db_xref="InterPro:IPR013112"
FT                   /db_xref="InterPro:IPR013121"
FT                   /db_xref="InterPro:IPR013130"
FT                   /db_xref="UniParc:UPI00003B6C89"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FMR3"
FT                   /transl_table=1
FT                   /translation="MGEIRRPAPLESITLQKRHGNTHFANINYGYIVFFVSVAYVVFLI
FT                   LLRRIIKSYPSNKNRTFFGGLCKRLYTIDPALHLLILFIPLIATFYYHYSIFSQTAVYI
FT                   MRLGRLSYVLLSLNLFLNLRPNIFFTDKYVYTDFIPFHKWLSRLIVIFGLLHGVFFVIR
FT                   WAINPKTDLDAKLSNKYNFAGIVIAGISIILIIASMNVARRSAYNLFYIIHNITLFAFV
FT                   FITPYHARPSVKTPYLFVNSVLIAVQVINKIVFTSRASLIEKIEDRKNTNLVVLKFPRK
FT                   ALPDFFNPSSHIRLSAYRKLNPLYWILPSHPYTLATLPSDEIVELIVNEHTVPQFNTSS
FT                   FVVELGYSYTIQNPHNPSVPDVCLQNANRIAIVCGGSGIAFGLPLFRFFKSMKNISYLR
FT                   LVWLTKNSSQLSIITKSDSFRALISEDGKIDNLDIYLTNKTTAPTSSGTEETENDIELE
FT                   DFELNTTEDLTEYKKLCNITEGERMDWTTELSSLVEEDTSKTWLLACGPEGLVTDGKSY
FT                   ANANGIHFASEVYTL"
FT   tRNA            join(579660..579697,579719..579764)
FT                   /gene_name="tRNA-Ser (GCT)"
FT   tRNA            join(580256..580292,580328..580364)
FT                   /gene_name="tRNA-Pro (TGG)"
FT   CDS_pept        complement(580733..582439)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000076290" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17445543"
FT                   /locus_tag="CAGL0K05973g"
FT                   /product="Similar to uniprot|P19882 Saccharomyces
FT                   cerevisiae YLR259c Heat shock protein "
FT                   /function="ATP binding"
FT                   /function="unfolded protein binding"
FT                   /biological_process="protein refolding"
FT                   /biological_process="response to stress"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAG61443.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006950"
FT                   /db_xref="GO:0042026"
FT                   /db_xref="GO:0051082"
FT                   /db_xref="HOGENOM:HBG390776"
FT                   /db_xref="HOGENOM:HBG625289"
FT                   /db_xref="InterPro:IPR001844"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR018370"
FT                   /db_xref="UniParc:UPI00001A4925"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FMR2"
FT                   /transl_table=1
FT                   /translation="MLRAVARSQVRSLRNARLYSSFKELKFGVEGRAALLRGVETLADA
FT                   VSATLGPKGRNVLIEQPFGAPKITKDGVTVARSITLEDKFENMGAKLLQEVASKTNEAA
FT                   GDGTTSATVLGRAIFTESVKNVAAGCNPMDLRRGSQAAVEKVIQFLTENKKEITTSEEI
FT                   AQVATISANGDAHVGKLLASAMEKVGKEGVITIREGRTLEDELEVTEGMRFDRGFISPY
FT                   FITDAKSGKVEFEKPLLLLSEKKISSIQDILPALELSNQSRRPLLIIAEDVDGEALAAC
FT                   ILNKLRGQVKVCAVKAPGFGDNRKNILGDVAILTGSTVFTEELDLKPEQATMEHLGSCD
FT                   SITITKEDTVILNGNGSKDSIQERIEQIKNSIDVTTTNSYEKEKLQERLAKLSGGVAVI
FT                   RVGGASEVEVGEKKDRYDDALNATRAAVEEGILPGGGTALVKASRVLDEVKTENFDQKL
FT                   GVDIIRKAITRPAKQIIENAGEEGSVIVGKLVDEFGEDFAKGYDSAKGEFTDMLAAGII
FT                   DPFKVVRSGLVDASGVASLLATTEVAIVDAPEPAPAAGAPGGGMPGMPGMM"
FT   CDS_pept        583945..586329
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17445544"
FT                   /locus_tag="CAGL0K05995g"
FT                   /product="Strain CBS138 chromosome K complete sequence "
FT                   /function="diacylglycerol kinase activity"
FT                   /biological_process="activation of protein kinase C
FT                   activity by G-protein coupled receptor protein signaling
FT                   pathway"
FT                   /protein_id="CAG61444.1"
FT                   /db_xref="GO:0004143"
FT                   /db_xref="GO:0007205"
FT                   /db_xref="HOGENOM:HBG123904"
FT                   /db_xref="InterPro:IPR001206"
FT                   /db_xref="UniParc:UPI00003B6C8A"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FMR1"
FT                   /transl_table=1
FT                   /translation="MIAKNRVDDDVYVTMKSKKKSKNSGRSQSVPISKNKRMISRGQLV
FT                   EDGVRIVGVTSLNTFQNKAPANMRSTTTNVYRPSTMMFSNDSSYSMGVGGRQYGDESKE
FT                   GPRLSIESRISSTDSFISANSYVRRSNSSVFETASLVSCVTCLSDSSYSTSSGSSSLSL
FT                   ASSATGNSQKMRHRKKNHSGNDDTNNKLDTFLPINTVIPYARIINAKIFTTTPQNQNQE
FT                   PRTSNDFTNQSILSRDDVSSQASKFISVPDDRPRRKSFKRKPSNARITSMTSIDGDTDN
FT                   NPFSTQPSSTSASASRTTTNNDNNDNVDLKNPFNTNDDDNVNNSKVSVKESEILYEGSQ
FT                   DEMENIKSLHLIEITFAKPRRQDVVPKKIVIAIETTELLRGPSEIVDAIMDRSYKGTKQ
FT                   SRSILAIINPFGGKGKAKKLFMTKAKPLLSASRSTVEIKYTKYPQEAIDIAREMDISKY
FT                   DTIVCASGDGIPYEVINGLYRRPDRVEAFNKLAITQLPCGSGNAMSVSCHWTNNPSYAA
FT                   LCLLKSVEARIDLMCCSQPSYADEYPKLSFLSQTYGVIAESDINTEFIRWMGPARFELG
FT                   VAFNVLQRKKYPCDLYVKYAAKSKNDLKVHYLEHKNQGSLTFEGDLNEESPETEDTKQI
FT                   SKSNENEISNEITEDSFKLKYPLKDGVPDDWERLDPSISNNIGIFYTGKMPYIAADTKF
FT                   FPAALPSDGTIDMVVTDARTSVTRMAPILLALDKGSHVLQPEVIHSKILAYKLIPKLNH
FT                   GLFSVDGEKFPLEPLQVEVLPRLCKTLLRNGSYVDTEFDTM"
FT   CDS_pept        complement(586922..587581)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000233968" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17445545"
FT                   /locus_tag="CAGL0K06017g"
FT                   /product="Similar to uniprot|Q99260 Saccharomyces
FT                   cerevisiae YLR262c GTP-binding protein "
FT                   /function="GTP binding"
FT                   /biological_process="protein transport"
FT                   /biological_process="small GTPase mediated signal
FT                   transduction"
FT                   /protein_id="CAG61445.1"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0007264"
FT                   /db_xref="GO:0015031"
FT                   /db_xref="HOGENOM:HBG527536"
FT                   /db_xref="HOGENOM:HBG745225"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR003579"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR013753"
FT                   /db_xref="InterPro:IPR015600"
FT                   /db_xref="InterPro:IPR020851"
FT                   /db_xref="UniParc:UPI00003B6C8B"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FMR0"
FT                   /transl_table=1
FT                   /translation="MSGRQDKLLTKYKIVFLGEQGVGKTSLITRFMYDTFDDNYQATIG
FT                   IDFLSKTMYLDDKTIRLQLWDTAGQERFRSLIPSYIRDSRVAIVVYDITKRKSFEFIDK
FT                   WIEDVKNERGAENVILCVVGNKSDLADERQVTAEEGEKKAQDLGAKIFMQTSTKVGYNV
FT                   KNLFKKIAKSLPEFQDSDANPLENTGGAAGNRNSNKAGVIDISTTDEDQSQSGCQC"
FT   CDS_pept        complement(588340..588534)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21046538"
FT                   /locus_tag="CAGL0K06033g"
FT                   /product="Similar to uniprot|Q3E764 Saccharomyces
FT                   cerevisiae YLR262ca"
FT                   /protein_id="CAR58052.1"
FT                   /db_xref="InterPro:IPR015157"
FT                   /db_xref="UniParc:UPI00017BD8DD"
FT                   /db_xref="UniProtKB/TrEMBL:B4UN36"
FT                   /transl_table=1
FT                   /translation="MSGRQGGKAKPLKQKKKQQQDLDPEDQAFKEKQKADAAAKKAMMA
FT                   NVKSGKPLVGGGIKKSGKK"
FT   CDS_pept        589631..592027
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17445546"
FT                   /locus_tag="CAGL0K06039g"
FT                   /product="Strain CBS138 chromosome K complete sequence "
FT                   /biological_process="chromosome segregation"
FT                   /biological_process="reciprocal meiotic recombination "
FT                   /protein_id="CAG61446.1"
FT                   /db_xref="GO:0007059"
FT                   /db_xref="GO:0007131"
FT                   /db_xref="HOGENOM:HBG123772"
FT                   /db_xref="InterPro:IPR012491"
FT                   /db_xref="UniParc:UPI00003B6C8C"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FMQ9"
FT                   /transl_table=1
FT                   /translation="MDAQSILARYFDVKVVDGFYYIQIQFSDTEFLERTIQNAIANLTH
FT                   KDIEVLFRFMLKEPLRSKKIWLLISIMFIELSHAKLQYKDIWIHLLRIQLTFNLEETEV
FT                   PESNDVIINTLIDRGTKKDITFKNWKYFFILLKTLAYIYTSPSDDIQQLIISKFDYVKD
FT                   FLTSNEIKDLNLLIMLISFLSLANGNAEHQEYPILRWKKQNIDKIFSNYKIMEFILDNF
FT                   KEKLVNFVRIKKLFAVYESQNCQTKKIVGLSNSGSKRFCYSQFIHGNLYLWTGTNTFIH
FT                   LRKKNIFLKKSNNCLIEIGFPRDITPFTQMALNEFEKSHIPMKYLKKLELEFNSEHECR
FT                   IFLEPMDNYFRISEAKDYLLLNFTESDTSSQIDNISHSELEFKEKSVPIQLKESNTDKN
FT                   NNGHFNMQDNSYRNTQLQTPERSDLKRNDKNDNDSIQNNKAHSNGEQYPSSEYGILLKP
FT                   QPALCSSPLSDLNKKRLQRSLSKSSKNLKLVMEQQFNTTLNQSIEVMKENIIIPSSVAY
FT                   QDHLIDKDLGRHRLIEGGRLTSQFVGHKPNNIPKVTSVSKTKPKSVKTADINVLNTIFG
FT                   SASCTVRSYKVGRSKGKNVKPTTRSINKGKKMIANNNSENIHSNKTVKEKSNLVANLVP
FT                   VETSTSQNRSKEIISHINSKVPNQEVSGIEDHTISLNNSGTLCDINTSKDANLSLSKSI
FT                   SKGAFSKSIQDQLANSINAIANQMISRISIINELLNKKIMQELSEKYEVLFSELHKSFK
FT                   GDVERMVEFVGDLNKMSDLTEEEVIAEIRKRNIINSNITVETRRE"
FT   CDS_pept        592414..592617
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000224552" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17445547"
FT                   /gene_name="RPS28A"
FT                   /locus_tag="CAGL0K06061g"
FT                   /product="40S ribosomal protein S28 "
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="CAG61447.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG331261"
FT                   /db_xref="HOGENOM:HBG392125"
FT                   /db_xref="InterPro:IPR000289"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR016027"
FT                   /db_xref="UniParc:UPI00003B6C8D"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FLC3"
FT                   /transl_table=1
FT                   /translation="MDNKTPVTLARVIKVLGRTGSRGGVTQVRVEFLEDTSRTIVRNVK
FT                   GPVRENDILVLMESEREARRLR"
FT   CDS_pept        complement(593405..594349)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20197715"
FT                   /locus_tag="CAGL0K06083g"
FT                   /product="Similarity"
FT                   /protein_id="CAG61448.1"
FT                   /db_xref="HOGENOM:HBG123773"
FT                   /db_xref="InterPro:IPR015381"
FT                   /db_xref="UniParc:UPI00003B6C8E"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FMQ7"
FT                   /transl_table=1
FT                   /translation="MVNAWKVGEIDGRYNLLKQDIDRDGTKLLKITIHMTEALLVPQSS
FT                   TLKKSLKTYAVKLDSARKQLKSQGFDLQSSDNLIKIVIEFLNNLNCYTKNNYKDSKCEM
FT                   SLHKSDMKITIKLDATIKATINLGFVRLTDEQGLLILLELSHFLSETLWYWSRVCSLID
FT                   SESNTKNLNNCLIELNRIAEAKESNQIYGRDLAKLFIIREKLLGRQAKLSGMISTRSSK
FT                   SDELPGEFSEFDSDDMSWRTNSVTPIEILRSEDINELSSQTDKIPAKRVRKEDSIKMES
FT                   RILDSNYEEAAISESPKRKKKKFGKIVVSPTKK"
FT   CDS_pept        complement(594713..596410)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18503105"
FT                   /locus_tag="CAGL0K06105g"
FT                   /product="Similar to uniprot|Q06150 Saccharomyces
FT                   cerevisiae YLR267w"
FT                   /protein_id="CAG61449.1"
FT                   /db_xref="HOGENOM:HBG123774"
FT                   /db_xref="UniParc:UPI00003B6C8F"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FMQ6"
FT                   /transl_table=1
FT                   /translation="MKGFEKSMLETLPLEVLDLILDRLGLDEYGDSLAILDCFSIMDAV
FT                   PRDTTLYSQIRSRFHLLSYVDDPSTRILNLLSGYQDNEKELNHENLIVAVDLDNWDIET
FT                   VKIDLEELLHRCSEEHSMALHLLFPLASTDKAYDVAKFYSVIKSVLSEIASSKLFNFES
FT                   IIFDSISNKLVCDKNMFGILSYEFLETIESAHSDTFDISKVMLPLVTTLQVNYMTLDTF
FT                   FYNILTKYKGYQRSKSKLVKNFLANFKFYMPNVVNLQFFKTNGCEQIETCNFIDVSSLI
FT                   LKKCKENKINVVQMFKIHSLANWKLPNIRKFTGHRFKFDEIATAGSPERLVVSLRENLK
FT                   LLHDCAMSDTQDGVSYFRVNLIPEGVKKTKIINWVPTEISSNVFSKVEQYTTPIMCVRC
FT                   ESLEELELKLLRFEKSSTIEIQGLYFPNLKKLVLSNKPRITSRPVISHRNDSFSLESER
FT                   KPAHGYTANLEVTRRRMLTTSNRYNKAHNTAYSNVTFAENPSQITDMNPIAFTSWNELP
FT                   SCEFLGFVSEDSTNYIFNIQNLKEVLPNLNLKNSFPTFVDEKQKFIVV"
FT   CDS_pept        597610..598566
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17445548"
FT                   /locus_tag="CAGL0K06127g"
FT                   /product="Strain CBS138 chromosome K complete sequence "
FT                   /protein_id="CAG61450.1"
FT                   /db_xref="HOGENOM:HBG123775"
FT                   /db_xref="UniParc:UPI00003B6C90"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FMQ5"
FT                   /transl_table=1
FT                   /translation="MCNCTKIDKTQALENLWSWCVINYISSAACVLVSVSSMFIKSEAG
FT                   AIENNDKKRYKVNKEKHDTHRKKKDKSILESFLLVPGQLDGASDPAKFVPGLGLKTPIK
FT                   DEGNISLPSINLPPSEMRSRWRSSGSLFGPQEVDNNLLPKVNKSPGVKTPTSTKQRPHS
FT                   TQPEETKPADTLVTPTSPLVEERQNNADSLKPAEDPGPFKKQTRLLYEVQNDMTIDDDN
FT                   MTEIFPGLEKEEEKTYCRQSSLWSLDQWIEEGENILRAHQEIFIKIIKKRIELSYNFNS
FT                   LITVLIDRAEALCKHGNVIDSKLEKVKKLGNEILNIL"
FT   CDS_pept        join(complement(599623..599625),complement(598820..599227))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000227166" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18503106"
FT                   /locus_tag="CAGL0K06149g"
FT                   /product="Strain CBS138 chromosome K complete sequence "
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="CAG61451.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG360364"
FT                   /db_xref="HOGENOM:HBG460442"
FT                   /db_xref="InterPro:IPR001210"
FT                   /db_xref="InterPro:IPR018273"
FT                   /db_xref="UniParc:UPI00003B6C91"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FMQ4"
FT                   /transl_table=1
FT                   /translation="MGRVRTKTVKRASKALIERYYPKLTMDFQTNKRLCDEIATIQSKR
FT                   LRNKIAGYTTHLMRRIQKGPVRGISFKLQEEERERKDQYVPDVSALDLSHSKGVLNVDN
FT                   QTADLVKSLGLKLPLSVINISAQRDRRFRKRN"
FT   CDS_pept        601814..603151
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000163455" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19350887"
FT                   /locus_tag="CAGL0K06193g"
FT                   /product="Strain CBS138 chromosome K complete sequence "
FT                   /function="DNA binding"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription "
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG61453.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0045449"
FT                   /db_xref="HOGENOM:HBG351269"
FT                   /db_xref="HOGENOM:HBG714058"
FT                   /db_xref="InterPro:IPR000433"
FT                   /db_xref="InterPro:IPR001005"
FT                   /db_xref="InterPro:IPR007526"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012287"
FT                   /db_xref="InterPro:IPR014778"
FT                   /db_xref="InterPro:IPR016827"
FT                   /db_xref="InterPro:IPR017884"
FT                   /db_xref="UniParc:UPI00003B6C93"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FMQ2"
FT                   /transl_table=1
FT                   /translation="MSNKFHCDVCSSDCTHRVRISCAVCPEYDLCVPCFSQGLYNGNHR
FT                   PFHDYRIIETNSYPILCPDWGADEELALIKGAQSLGLGNWHDIAEHIGSREKDEVRDHY
FT                   IEYYINSPFYPIPDITKDIQVPQEEFLNERKTRIEKFRDRPLEPPKKPMASVPSCHEVQ
FT                   GFMPGRLEFETEFENEAEGPVKDMVFEPDDQPLDLELKFAILDIYSSRLTVRAEKKRLL
FT                   FENKLMEYRKLQNIDKKRSKEAKDLYNKIKAFARVMTAQDFEEFSKDILEELQCRTRIH
FT                   QLQEWRSKGLTTLEAGLKYERDKQSRISTLERLGNYGDASLGNLGSSQAGTPGVAGTRY
FT                   RSTPGHRSNTDYSQNGTDSNGKKKGITISDIQHASDYGLLSPEEQQLCIQLKILPKPYL
FT                   AIKEVMFRELLKTGGSMPKKNCRDLLNIDPVKANRIYDFFQLQHWI"
FT   CDS_pept        complement(603441..604802)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000065928" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17445549"
FT                   /locus_tag="CAGL0K06215g"
FT                   /product="Similar to uniprot|Q02354 Saccharomyces
FT                   cerevisiae YDR449c"
FT                   /function="binding"
FT                   /biological_process="RNA processing"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAG61454.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0006396"
FT                   /db_xref="HOGENOM:HBG059195"
FT                   /db_xref="HOGENOM:HBG395666"
FT                   /db_xref="InterPro:IPR003107"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013949"
FT                   /db_xref="UniParc:UPI00003B6C94"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FMQ1"
FT                   /transl_table=1
FT                   /translation="MSSRTRYYLEQCIPEINDLVEKELFTKNEVAKIMKKRTDFEHRLN
FT                   SRGSSIRDYMRYIDYETQVFKLRAKRCQRILQSKRTNSISDKSIEQRIAFIYQRGTNKF
FT                   PRDLKFWAMYLNFLKKMGTETSYKKVHTVYNQLLRLHPNNVDVWISCAKYEYETHANFK
FT                   SCRVVFQNGLKFNPDSPKLWYEYIKFELNFVTKLINRRRVMKLINEREQELDMLNEQSQ
FT                   STKNAVNSKSMDDDNEENENGIKVPSTGDNMKDKLNELPEADMNMLGNAETNPALRGDI
FT                   ALTIFDIAMAELGKHYINKQKGYYANTDSSIDKELQKETVQYLYEKSLEIIQLFDQFKD
FT                   LQRDYLINHVIQFWKNEHFSVSVSNDMPEIYSDIIVTEVTLLLRYMDIKNLDYDKLQLS
FT                   VRNYMAYKNKTKEEANKKILQKKFKTFLESRFTENASDEEDNKLKILHQIIAKL"
FT   CDS_pept        605408..607399
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000207139" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18503107"
FT                   /gene_name="PPN1"
FT                   /locus_tag="CAGL0K06237g"
FT                   /product="Endopolyphosphatase "
FT                   /EC_number="3.6.1.10"
FT                   /function="endopolyphosphatase activity"
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="vacuolar membrane"
FT                   /protein_id="CAG61455.1"
FT                   /db_xref="GO:0000298"
FT                   /db_xref="GO:0005774"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG059192"
FT                   /db_xref="HOGENOM:HBG397833"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR012358"
FT                   /db_xref="UniParc:UPI00003B6C95"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FMQ0"
FT                   /transl_table=1
FT                   /translation="MAVNEKDVGRKSRVSVVLWVFIALGTLFLCKNAFTFSSESIHGLK
FT                   ISSDDSDSVDIERQISLGLTPRKPVVITDLRTGNKRKLHGRFLHITDMHPDEYYVAGTS
FT                   IDNVCHSGEPTKGKDRAAKFGNAMSGCDSPMLLMDMTLDWIDKNLKDQIDFVVWTGDNI
FT                   RHDNDRTYPRTEDEIFRMNAEVAEKIKKIFRTPNSPDPRDFAVPVVPSIGNNDVFPHNL
FT                   FSLGPTLQTREYYRLWGDFIPEEQQRMFDRDASFFTEVIPGKLAVLSFNTLYLFKANPL
FT                   VDNCDSRKQPGYQLLLWLGYVLDEIRERGMKVWISGHVPPIAKNYDSSCYDKFSLWMHE
FT                   YRDVIIGGLYGHMNMDHFVPVDVQAIRENMEEQQMSLLSEDERLTKTIREHAIAAREAH
FT                   LMGAKPVNKESYLDGVLDTYYKGVLQEIEQAVDSDLDIEKKKKKKGKKKKGKKEKRTLE
FT                   EIYDQHSIVQVSGSVIPTFNPSIRVWEYNISDITDSSSIFGENQLEYQSWDLFFEDLEH
FT                   KMKNEFDDNESSFWAASAEQNKKKKKKNGKPDKSIPRKKPDELPAGPGHIQQLFSPTKF
FT                   VQYFADLDSINSEYEKLIDKGLAEHDAINKAFNYEVEYTSKDEPYPMESLLVKDYLHLA
FT                   ADLARDNGLWKIFKERAFISTGYEDERN"
FT   CDS_pept        complement(607703..608299)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000022343" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19350888"
FT                   /locus_tag="CAGL0K06259g"
FT                   /product="Strain CBS138 chromosome K complete sequence "
FT                   /function="antioxidant activity"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="cell redox homeostasis"
FT                   /protein_id="CAG61456.1"
FT                   /db_xref="GO:0016209"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0045454"
FT                   /db_xref="HOGENOM:HBG491141"
FT                   /db_xref="HOGENOM:HBG493509"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR017936"
FT                   /db_xref="InterPro:IPR019479"
FT                   /db_xref="UniParc:UPI00003B6C96"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FMP9"
FT                   /transl_table=1
FT                   /translation="MVAQVQKPAPTFKKTAVIDGMFEEVSLDKYKGKYVVLAFVPLAFT
FT                   FVCPTEIVAFSEAAKRFEALDAQVLFASTDSEYSLLAWTNVARKDGGLGPVDIPLLADT
FT                   NHKLSRDYGVLIEDEGIALRGLFIIDPKGIVRHITINDLPVGRNVEESLRLVEGFQWTD
FT                   KNGTVLPCNWTPGSATIKPTVEDSKEYFKEANSKN"
FT   CDS_pept        complement(609816..610373)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000037640" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17445550"
FT                   /locus_tag="CAGL0K06281g"
FT                   /product="Similar to uniprot|P15454 Saccharomyces
FT                   cerevisiae YDR454c Guanylate kinase "
FT                   /function="ATP binding"
FT                   /function="guanylate kinase activity"
FT                   /biological_process="purine nucleotide metabolic process "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAG61457.1"
FT                   /db_xref="GO:0004385"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006163"
FT                   /db_xref="HOGENOM:HBG255716"
FT                   /db_xref="HOGENOM:HBG671982"
FT                   /db_xref="InterPro:IPR008144"
FT                   /db_xref="InterPro:IPR008145"
FT                   /db_xref="InterPro:IPR017665"
FT                   /db_xref="InterPro:IPR020590"
FT                   /db_xref="UniParc:UPI00003B6C97"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FMP8"
FT                   /transl_table=1
FT                   /translation="MSRPIVISGPSGTGKSTLLKKLFAEFPDTFGFSVSSTTRSPRPGE
FT                   VHGKDYNFVTVDEFKSMIDGEKFIEWAQFSGNYYGTTVDSVKAVISSGKTCILDIDMQG
FT                   VKAVKTKDLNARFLFVAPPSMDDLKARLQGRGTETDESLQKRLAAADAEMEYANSGAHD
FT                   KIIVNDDLDKAYNELKQFIFEN"
FT   CDS_pept        611434..621177
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093627" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17445551"
FT                   /locus_tag="CAGL0K06303g"
FT                   /product="Similar to uniprot|Q03280 Saccharomyces
FT                   cerevisiae YDR457w ubiqitin ligase "
FT                   /function="acid-amino acid ligase activity"
FT                   /function="binding"
FT                   /biological_process="protein modification process "
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAG61458.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0006464"
FT                   /db_xref="GO:0016881"
FT                   /db_xref="HOGENOM:HBG059186"
FT                   /db_xref="HOGENOM:HBG398391"
FT                   /db_xref="InterPro:IPR000569"
FT                   /db_xref="InterPro:IPR010309"
FT                   /db_xref="InterPro:IPR010314"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="UniParc:UPI00003B6C98"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FMP7"
FT                   /transl_table=1
FT                   /translation="MVKLTRFEKLQKEKNAEYFKPFLDDLEQSSQDEFVKKLRDFDFND
FT                   RPRNDLFVWIPVLNRIDDILSKFVEKYHYSYTKAPEPLKLMNDEDLNVTVELTEFSTKL
FT                   LCNTENRYIYSSMDVMSNLLNCPNFEVKLGAIRVLATMGERYVIARERIDATKNVLGTH
FT                   PLKNKALKLALAIPSSAMDENGEHFALTDLYFEKKKYPSKWSKLRYTYYASPKTNSASS
FT                   NVKSVDCSDSNSHSSAQQGVSMLKFSMNSEELSKLTIQEILDKGMKVIPAEEWFDFSLK
FT                   AIAAKAFSDDSEDNLHLRETIIRTKMNAIALVNTVYLPPQVSSKFFEVDPYAFNSLTDF
FT                   ISLSEVKISKNLRLDALFALECISLKHVWCSDIMRNLGGNMSHGLLFQILRYLSKILRE
FT                   KSSEVDEIYNVRFFYLISNLADVKVLHEALLAAGLIPALLDIVSIKNLDYRRTLASATH
FT                   LLEVFINDSDSTNEFINNDGFTTLIKSIDEEINYAIENKGQFNPPEFIKVYYAISFRQL
FT                   SYIRSHLKLVIKLLKTDSGDRIRNLIDSPILGSLKKIMTNRELFGYTLITYTLDIIQRV
FT                   INSEPTIYPILNEAGLIPYIIENFESLMGPYSELLTLLPDVISAICLNTEGLQKVKDNG
FT                   LIKSLFKTVTNLDYAIVLSWKEESVDFGTSMDELARHYPDLQDEICNAFSDMVKTLPDI
FT                   VKFNQPFLYQSNTGEDIIYRSKTDKVVRDEEGSQELAFWDIQKDSPIVDCFSNVFYGMT
FT                   LENSALHDLPEKLDFKTLFNAIVLNNVPFDFSMSQTMLNYTDVLQLFDEHFKDYAFPGI
FT                   LEIMDDQLKDLEEFINVTEQSTSILQDVGSIDLNQRVDSIISKLSKLLATQYIVTNVYL
FT                   NITTLTPNKFKEILTFFKKFGIGLIHRLRLLFQRCALEESFIRKNLPDEVAKETMPDTI
FT                   GGNTPPIQIHVSKPQKEETKDNGTSAKFKNTYQIRSILNKLQSTSSILFRCFLRLKSTD
FT                   ANVESRQMELQIYDTVVENVLHLLTAVPLQGNLQYALVVLNFNTYIFTFPKTSITANEV
FT                   LQTVPSYLFLQKGGYDIYERLVVELFGEMSKFSNVASVEEIDYVKDTQEVLILSCIINA
FT                   LTFFNKPTNMDTMELVPSIKYYYDGFEDNINLTKALMGPVKISAATMIKQIDNKFNLFN
FT                   PVSRTVPYAVFKQLLTLLKNLFSPGQETASGLFVLDCKYFPTSENIREAIREKDLQNGN
FT                   LKAIKAKLDDKTLTLSDVVKLIPDFGFYNSVPKLVTKHTSVSLIGIKNDSFYKELPDKV
FT                   FNILPYYPKLVNAFARTLLQILADWKISGETFAATVLEKVEKTNIKDEATLSSFIHLFG
FT                   IFLNEKIVYSKSEASVMHFLTYMRENLKPQYVNASWFSKALYAYEIVLAKSEIPQMEKL
FT                   DEDVKARYKLWSPLVAHRIPDETKKAIFDILIRVNDISSFYSALATSRILIFYARDEEY
FT                   AKEITHSGILSRLLKVIGMFQKSEKINFLESSFLLLIRRCFETTSIISTLIRNEIHKSF
FT                   TTRPIGNYKERERELSGLLEEKPHVVMRSPSVFVDILCENARFSEFDKSDYITNYIMRR
FT                   NFDLDKKTTSITQNTNENEIIPSRRTNIVHLLLSQLMAASEKDWISEPANHPPVDIPSK
FT                   PSKVDPSKNPVCAYMICLLKMLLELIGSYKQSKFEFLTYNRRNVYSEKPKPRVTALNFF
FT                   LYKLIDRPAGTEKNVYAQRRREVISTLARSVIVAFISDTQIQITPKQDLTKQDPDMVFI
FT                   RKFTIESVIKVIKNSTSSPKILENNVSRLESWFKIIGSMVYVQAPYLRSILDTNKIEAD
FT                   QYQICKLMIELGVPTAITDCMANLDLNYPFSRTLFNEAVDALNAINFTRNNFSDLFKVE
FT                   SHDDEDDVDEDSEKEENKDMFRNSALGMYDVEDIEEDDDDEEEEGSLIGEEDGIAFVDS
FT                   EDGGFEVVFSDESDENNEHPSSEYGESDSENDGEIQVEIAEESISGDEHDEEMTNSSEG
FT                   ESSSYDSDDISIIDENGYEYDSDIDLELEDYEVEDSDWESGLSDFSSSSNGDEDNHEDS
FT                   EHDSGRRRWHVTHGVDLIEDSISDSERGVFQGIEHVFHTENQPLFRVQNDSVARHHDRS
FT                   FRRNHGISFGSPALTLFNSSRRSQNNLINPLGPTGLEQVENDITDQLATIGSGTRPRTE
FT                   RSNFDEVLFSGELFDERPLDGIILKSSVARWKDIYDMFYDSKGYANCVVTKILNKIYKP
FT                   SLDLFREEEKKYNEKLEEKIRKVKEKQRRNSHLSHRSSFSVSDDSTIDHEPLGDTQGPI
FT                   NSEDTGETQQHRDPVYVNIEGRDVDISGTDIDPEFLRALPEDMRAEVFAEHVRERRAEA
FT                   FQNNIHLREIDSDFLDIIPDEIRNEILDEEAGEEHVSEIIHNARNSGDDRINLDEIESN
FT                   TDEDHSDHEPVPEAATEDKKKNGRIYFSPLVDRAGIAALMKAIFISQPYIQREVYHELF
FT                   YRLCSSKQNRGDIVNILLFILSEAINDQASLEKVYNSISSRALGKSGGATATKQLPPDC
FT                   TPLTVANQTIEILQNLIDADGRLKYFFITEHDNLVVNKIGTKHKKESSTKAFQFPIQYL
FT                   ITLLSKKIITDETVLMDLLTRILQVCSKPIATLAKKDKSNQKESKKLQIPNFKKEELRQ
FT                   LVSIIKLDSCNTRVFQQTITILQNLSTIADNKDIFIKDLVENARNIVADLSEELRSLCK
FT                   EGTVVESGAEINSDLVQKFTVPSSNQAKLLKVLTVVDFLYSDNISEEMIDTNKLSEIYK
FT                   SMALGEIWVELSKCLFEFEKRKHLSTSATVLLPLIESLMIICRHCRPSIAPILKYEEEK
FT                   NLDFKRMDTGELFLHFTDLHKRLLNQMVRSNPKLMSGPFASLVKNPKILDFDNKRYYFI
FT                   AKIKSDKTEAPKLPIPVRRDQVFLDSYRALFFKSNEEIKNSRLEITFKGESGVDAGGVT
FT                   REWYQVLSRQMFNPGYALFTPVASDKTTFRPNRASGVNPEHLSFFKFVGMVIGKAIRDQ
FT                   CFLDCHFSREVYKSILGKPVALKDMESLDLDYYKSLVWILENDITDIIEETFSVETDDY
FT                   GEHKIIDLIDNGRNVSVTESNKQDYVRKIVEYKLHTSVKEQMDNFLSGFYALIPKDVIS
FT                   IFDEQELELLISGLPDIDVDDWKNNTTYVNYTESCKQVSYFWRAVRSFDAEEKAKLLQF
FT                   VTGTSKVPLNGFKELSGVSGVCKFSIHRDYGSTERLPSSHTCFNQLNLPAYASYDTLRG
FT                   SLLIAINEGHEGFGLA"
FT   CDS_pept        complement(621549..623378)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21046539"
FT                   /locus_tag="CAGL0K06325g"
FT                   /product="Similar to uniprot|Q03281 Saccharomyces
FT                   cerevisiae YDR458c"
FT                   /protein_id="CAG61459.1"
FT                   /db_xref="HOGENOM:HBG123777"
FT                   /db_xref="InterPro:IPR018996"
FT                   /db_xref="UniParc:UPI00003B6C99"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FMP6"
FT                   /transl_table=1
FT                   /translation="MSENRQGIDLSKLTAAQLRFVLAENKVSFPSKAKKADLLRLCNKL
FT                   IDESDAEEVSQRIGAAIAKERVDHETKLRLRQKKMKESAKANSEPAESLPAEKVSVQKS
FT                   PNKKSVAGKKHSRTESEDEDSDKNKKKRAKSTDDNIKIKNNQSAAVNSTSALATPVKAA
FT                   ESSSPSRNKLESKPDIPVTRGAMHDEIKKESSAKKGKKKLQEIENLVTSQTPKKLSEQV
FT                   QKISQKAEEVVEEIKEDIKEELCPTKDEFVKHKEEEPSKLFAVLDEIMIYLFKFLVIVL
FT                   PILFFLWYREQKIRVGFCGHELPVAKFAPYANSNKVWASVDKTLERFLPKCKLCPEGAI
FT                   CKTHLQMSCKDGYVLRKSWWNLESLLPLADKCITKRKAANKKTPLLFALDLLRTQNANT
FT                   HCGSTLPDNYQAGMLEKDLFNNVYEEYRDMMTKESFEKEWAVLSNSLKRLPEIYYKTFV
FT                   SKNVAGNIENIQLFRSLSKQNVSYFCGIFKLLKEFPIEKNVLFVALTIFSCTVTLEIIL
FT                   QKLWKCQNRENAFVEKSTEKALEKLREASRDPEVKFLDTVQLREFLLSETTNLKKKNQL
FT                   WDKISSKLLENENVEKRQMELYGEVLGIWEWND"
FT   CDS_pept        complement(624046..625104)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000001066" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17445552"
FT                   /gene_name="PFA5"
FT                   /locus_tag="CAGL0K06347g"
FT                   /product="Palmitoyltransferase PFA5 "
FT                   /EC_number="2.3.1.-"
FT                   /function="acyltransferase activity"
FT                   /function="zinc ion binding"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAG61460.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0008415"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG058267"
FT                   /db_xref="HOGENOM:HBG203305"
FT                   /db_xref="InterPro:IPR001594"
FT                   /db_xref="UniParc:UPI00003B6C9A"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FMP5"
FT                   /transl_table=1
FT                   /translation="MGFAEWRLRNKYWTIYIVPLVVLLLMIYGTWAYCHKLCYERVYRD
FT                   FGHKATAIGLICTCCVLDALIIAIWVLIVSCGPGHQPGVAPHLLVDSADLENTTVAPNC
FT                   YQSDPHGYPVWCSNCQSLKVGRTKHSSHQGHCVPRFDHYCVWLGAVIGFKNYRLFVQFV
FT                   FYFAVLLMIVWITISVYIRDIRQYHARLNANLIVLLIISGIGWLMTSGLFVSYIYYMSQ
FT                   NLTSIEVIDLKKRKRTPELSMQRLYCYYNSDDHYRYVVKLDNDFKGSVYKKHWLKNIKE
FT                   FMGSNPMLWFIPLPQYWHESPLANGERDVNTIVSPYQEEVGPHTIDYIKKRIESGEYIH
FT                   KFKEPGREKTHL"
FT   CDS_pept        625535..626527
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000189680" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17445553"
FT                   /gene_name="TFB3"
FT                   /locus_tag="CAGL0K06369g"
FT                   /product="RNA polymerase II transcription factor B subunit
FT                   3"
FT                   /function="zinc ion binding"
FT                   /biological_process="cell cycle"
FT                   /biological_process="regulation of transcription "
FT                   /biological_process="transcription"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG61461.1"
FT                   /db_xref="EMBL:AAM08093.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006350"
FT                   /db_xref="GO:0007049"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0045449"
FT                   /db_xref="HOGENOM:HBG058266"
FT                   /db_xref="HOGENOM:HBG397495"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR004575"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR015877"
FT                   /db_xref="InterPro:IPR016390"
FT                   /db_xref="InterPro:IPR017907"
FT                   /db_xref="UniParc:UPI00003B6C9B"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FMP4"
FT                   /transl_table=1
FT                   /translation="MSSAVASKGMNQGSEFDDNKDMCPICKTDRYLSPDVRFLVNPECY
FT                   HKICESCVDRIFSLGPAPCPYKSCDKILRKNKFKTQIFDDVGVEKEVDIRKRVFNVFNK
FT                   TLEDFDNDLEAYNKYLEEVEDIVYKLDNKIDVVETEEKLRTYEELNKQLIMNNMERSKK
FT                   DLENFEQRQQFEKEMRMKKRMLERQIESEDKMNKEWAKREIVNRLASSTNADDVIEGVK
FT                   NTVKLKKSSARRKLEEINRVLQNNPYSSLMLSQGLSRKEDNVPFTPFNGDRDLDKRYTI
FT                   DQESYDDPFIKDLENRKDYIASGFRSDFVYDRMLTEAFMGLGCVVAEEV"
FT   CDS_pept        627730..628170
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000001068" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18503108"
FT                   /locus_tag="CAGL0K06391g"
FT                   /product="Similar to uniprot|P36527 Saccharomyces
FT                   cerevisiae YDR462w MRPL28"
FT                   /protein_id="CAG61462.1"
FT                   /db_xref="HOGENOM:HBG059582"
FT                   /db_xref="HOGENOM:HBG395792"
FT                   /db_xref="InterPro:IPR019192"
FT                   /db_xref="UniParc:UPI00003B6C9C"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FMP3"
FT                   /transl_table=1
FT                   /translation="MLRNTVGKSKTSIEQLMAKSQIVRYKRTKSQGGLSPLTQRVVTQL
FT                   SVLSAARKQPKLLKLSKEDLVKHQTIERSWKLYQQQKTTRQLAQLKQQYLAMEEAMETL
FT                   KSVSPELYEEANISEEGKQFPLDIKITTDAPPNKIWHYNFKK"
FT   CDS_pept        628640..629719
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18503109"
FT                   /locus_tag="CAGL0K06413g"
FT                   /product="Similarities with uniprot|Q00947 Saccharomyces
FT                   cerevisiae YDR463w STP1"
FT                   /function="nucleic acid binding"
FT                   /function="zinc ion binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAG61463.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG123778"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="UniParc:UPI00003B6C9D"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FMP2"
FT                   /transl_table=1
FT                   /translation="MLGREPWIVSSTFELDNKDVVGRKLVKEEEVSKTRHEQEEFVCHY
FT                   CDARFKIRGYLTRHIKKHALQKAYYCPYYNEKAPPDLRCHNNGGFSRRDTYKAHMKTRH
FT                   IMYPSGVKSQERFKSSGHCSHCGEYSPNVEFWVEDHVESGQCTALPEEYILKQSKNGKT
FT                   ERKVNRVKMIKTSNGQSRFISTTRSIMDSKVLLNEDAMEALTIVAEHAKRSDILTKYGT
FT                   NKILLDSADFDKDVLESKPKNRYTEEPLEDEEEEEEEMGGHPFFGRQKIPSFKPLDTEN
FT                   TNKQDQCIKKNSADQHVPPLDSEQSSMNLDYLLEFEAGTQSVKNPLPRFNKDVISKQSQ
FT                   RSLEEYTTLYTEYFKDTFN"
FT   CDS_pept        630381..635204
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17445554"
FT                   /locus_tag="CAGL0K06435g"
FT                   /product="Strain CBS138 chromosome K complete sequence "
FT                   /protein_id="CAG61464.1"
FT                   /db_xref="HOGENOM:HBG123779"
FT                   /db_xref="InterPro:IPR021386"
FT                   /db_xref="UniParc:UPI00003B6C9E"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FMP1"
FT                   /transl_table=1
FT                   /translation="MSHNQQDEEDINFQELVGNLLSTHNEQINEDETDNQQNEDPHIDL
FT                   PDLHTAEDDLVAVVANAIQNMDVVEGSHQIEQTPTQTHSSHDDQMEIDKDIELDEEERQ
FT                   HREWARLLRQGILETEKTETDNIDHIQENEENLDDEDENLRRAILESLNELNVPQSTKQ
FT                   TKKASKKKKKEKDKDKNKKPEKGTEKKPDKKSEKKSEKKSEKKSEKKSEKKSEKSTDKK
FT                   SDRKQEKKSDKKSTKKSDKKLIKKSDNLVIPKTPSKIQQKSNNQSEQLKTIDDDISLLN
FT                   FEDVIQGFMKEGEEAGNKYATAGDDNFAADEIVEATLKAFEKELLNVTEKDKKKKKKPI
FT                   RQSSTTKDTAISNLKSKTKKSKKDNKTITPNHISTVAKKHISNETPKANLQTDDDEYAK
FT                   ALADVVEQVVSKSFVSNEKASEMKKKAETPRAVIPPIQKRISGPSSLQKQQQVIPKEKV
FT                   AQKSKSVKETKHKKDVKKQKPEKTHKLEAAEEPFDMNAIMKNAMDMAFQNHESNDLDTS
FT                   VIEEFNRGLGDMTIADILAPKSLKAKKKTISKKKSSAELDDRGSDKSKSKLIATKSKLP
FT                   DKVDNNNHRLPSAAVVTPSVVHETNLEEKKKDLKAKDNKTELTDLRVKTLPSSQQIKVF
FT                   KVNAGGREAVNHDASAPILHKIKFSNRSDERQKTMPVTKTIETTRMKLSKQYLAAVNEA
FT                   VSLVKKKRAALNKQKKEEERRLRQERKEQKKLKKLQEKEKKEKESRELEEIVAKGPPYP
FT                   ADLRLTKSGRPKKPYRRWTKEEMEARVQKSTEEALKPKKVKKVKKKKDKKPKKLSLNAL
FT                   KKIPLFNLSKGLTPLMASLSYLSDGKSSRKDSQNNNIVQKSNNMSSEEMAMNAAKNQKN
FT                   ATNITYYDPSCDAIVRKEIIEYHPPWVIPNNPPLTLPVVTLLRRDAIDKLVPSGKASKR
FT                   KKKTSEYGTVSAREKMMSSILGPIVNTLKAAAKAKTASGASPEEASKYLATIIQYTKNT
FT                   IVKALLNARSSQLQSIKTETSVRLDSPSLTNGSQTIPIFNSRKIVNSGNREGNLISPKK
FT                   GTITIDDKEDTTKKHAVPIKIEEEVTIHDFTPVRTQIPWNNYHILLSNNDAIKEYERLQ
FT                   LWREATVNDICHNNGHINDISNDDINMINSDHGDMTDDGEMAIDPSLYGMDKSASHPIE
FT                   NNIEPVLSHNNKTSQPTSILIEDNELHPPSTKHIEKNFKNTPNSVGNYAHIVDINDESH
FT                   SITIDVGVDESVENPLSEINETHVKFDNPKPTSRDSDAHISTGSNKADNHKSSDENNTS
FT                   EEIGSQRNFNSNDNDKGPLINRLIREQLIDLDHESQKEGSMPDFSDLISNTLSSVLPEI
FT                   EKSATTMKKPRKVNKETPNNVLNLDGLVPPVSKIIKKEESAERLSPTGRVNHTLPKKLV
FT                   IPLNNISNSNNTLPSVKTEEKSVVKKEVVKIVKPRPVTPTFSFNIPNLKNYPGMATLVT
FT                   KLLKKYLTAEEFNQFKRESNKERKRKWREANSQKNWENDLRSRLKRRANEKFGPENNEA
FT                   KQKWIQEEFDSRVSKDKIKLEGSETIDRSGNTVMTDSDSLQILAGSFGKLDLARKIETE
FT                   VNDIIEDFIENSNKKKRKVTKNKDIPAN"
FT   CDS_pept        complement(635324..636562)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000214351" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20197716"
FT                   /gene_name="RMT2"
FT                   /locus_tag="CAGL0K06457g"
FT                   /product="Arginine N-methyltransferase 2 "
FT                   /EC_number="2.1.1.-"
FT                   /function="methyltransferase activity"
FT                   /cellular_component="cytoplasm"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG61465.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0008168"
FT                   /db_xref="HOGENOM:HBG074124"
FT                   /db_xref="HOGENOM:HBG676888"
FT                   /db_xref="InterPro:IPR017408"
FT                   /db_xref="UniParc:UPI00003B6C9F"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FMP0"
FT                   /transl_table=1
FT                   /translation="MSELHSLLTFPVRPISEEHYLGELSRFLKAGIPATYTLEQVAAFE
FT                   RSELREDADEVSDEEEQSNTTPLHILARSLPGNLSDDEEQVVLHMMDMLFEYGAGWNFI
FT                   DFENKTVGDLILERNGGNRESPLYQRVVEAGVSAELLLRKLNGGDVEFIDENEIDICAE
FT                   ASAEVVPKDALDDSTGKVSSVSDDDATAADPDTYLNTKLKYTEDALITENNKDGVMMDW
FT                   ETDIMKLAADTLVSRKPVGESVVLNIGFGMGIIDTFIQERNPKKHYICEAHPDVLKKMK
FT                   NDGWYQKPNVVILEGKWQDSLNKLLDEGNVFFDGIYYDTFSEHYEDMLDLYDIVVGLVN
FT                   PEGVFSFFNGLGADRPLCYDVYKKIVEVDVATYGMNCEYTYVDLKGKLPDWKDVKRSYY
FT                   NCEYYYHPKISFA"
FT   CDS_pept        637125..640100
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000001069" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18503110"
FT                   /locus_tag="CAGL0K06479g"
FT                   /product="Similarities with uniprot|Q03306 Saccharomyces
FT                   cerevisiae YDR466w"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="CAG61466.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG123780"
FT                   /db_xref="HOGENOM:HBG203310"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR015746"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI00003B6CA0"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FMN9"
FT                   /transl_table=1
FT                   /translation="MTSRKRSPHEFIFKEELGHGSYSTVYKALDKKDLKKPYAIKVCSK
FT                   RHIIKEAKVKYVTIEKNTLNLLARGNHPGIVKLYYTFHDEENLYFVLDYASGGELLSLL
FT                   HKMGTFTDSWAKHFAAQLVDTLEFMHARGVIHRDLKPENVLLSKEGILMITDFGAAATQ
FT                   NNFSDKDNTRSNANEGIPKDDVPSSGDKTECSSFVGTAEYVSPELLLYNKCSFGSDIWA
FT                   LGCMVYQFIQGFPPFRGENELKTFEKIVSLDYSWNPERQTNFGTINIQVVNLVRRMLTI
FT                   DTTQRATIDQIKRDPWFANVDWGDKKKLWRGIWQIQNQITPTNAYISPSNMHTNVSHQN
FT                   ILQNRQLHVIDTPLRNIPVTKQKRKKPAKEFNTTSSIVEWRKKLGIASSSTHNSTQSIS
FT                   NIVVDSFKPELPTNKVIITKEIPVGNVSINQVGANLDSQSPIPTSMKLQNQPSNKELNR
FT                   TPQTIHPIPAINSLNSPTLPNPNPNPIPPHQDLKGKINHSNEPAIVSASQSNFVNPAHI
FT                   GHNSAVREIAETKKRDQQRNISNSNMNLNYTNSLEEVPQMNDGGLSNGVQDENRSRQSS
FT                   TSNVEASQSTMRIACDMPNGDSKLKNQSSQVEREETIKKPLKITPGLEILKQDFVYVKT
FT                   ISYDAAGPDMAINSYKTINDDLITSLVAKHKSSLRPINIFPQLLVLYKDGSLAYKEVNT
FT                   ESRKGEKALNPMVNLGDVNLSMYDFEFDESLRRGFLILEKYKYKLWFISLPSYSLLATF
FT                   PRELTTRLLINNNEKWIDSFFRTRKIIENGFDIDKKIEGLDIKEKKETPAGKPKDELIS
FT                   PTTEKNGSLPPKKADSIKSKKSISSSLNSSTPPVLKKKQATDVKEKPLSKESMNSSTTK
FT                   TKKPIKPKLRQPPHINTGHSSLVNTTNSGRKRSVSSTPSTPQSPVPNMKVPPRPGSVSH
FT                   GSPIQYSPSAFSPKPGANSEKIHVSSSRYEVIQSIKNNGNLIDRNQASSGASAAFRSLQ
FT                   KR"
FT   CDS_pept        complement(640440..641117)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248369" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17445555"
FT                   /locus_tag="CAGL0K06501g"
FT                   /product="Similar to uniprot|Q03322 Saccharomyces
FT                   cerevisiae YDR468c t-SNARE activity "
FT                   /function="SNAP receptor activity"
FT                   /biological_process="Golgi vesicle transport"
FT                   /biological_process="intracellular protein transport "
FT                   /cellular_component="membrane"
FT                   /protein_id="CAG61467.1"
FT                   /db_xref="GO:0005484"
FT                   /db_xref="GO:0006886"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="GO:0048193"
FT                   /db_xref="HOGENOM:HBG203311"
FT                   /db_xref="HOGENOM:HBG374117"
FT                   /db_xref="InterPro:IPR000727"
FT                   /db_xref="InterPro:IPR006012"
FT                   /db_xref="InterPro:IPR010989"
FT                   /db_xref="InterPro:IPR015260"
FT                   /db_xref="UniParc:UPI00003B6CA1"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FMN8"
FT                   /transl_table=1
FT                   /translation="MSADPFQEVVDDTREQMKRLAQYLSQHESSSSISPQDEEVAEVQE
FT                   IVDDIAETLVDLNRSVDVIEKNNANGVDIENRRETIAQLKDQYEKLKLRFKVQLDTHNS
FT                   QAEANITVDLEEPDDQNNMTGGQANPFQEQMLREQDTQLDDIHQTMKNLHLQAETMGQE
FT                   LEDQGQLLDDMDQGMDTVAGKLARGRRQLEWVYEKNKERYNDCCIMLLIIALIVLLVLA
FT                   FIA"
FT   CDS_pept        641399..641737
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17445556"
FT                   /locus_tag="CAGL0K06523g"
FT                   /product="Similar to uniprot|Q03323 Saccharomyces
FT                   cerevisiae YDR469w"
FT                   /protein_id="CAG61468.1"
FT                   /db_xref="HOGENOM:HBG123781"
FT                   /db_xref="InterPro:IPR007858"
FT                   /db_xref="InterPro:IPR013790"
FT                   /db_xref="UniParc:UPI00003B6CA2"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FMN7"
FT                   /transl_table=1
FT                   /translation="MEISDVLSKEPEACAPPPSEPVVKPEPEVKQEKQDIKTESPVATP
FT                   AISLTEQKPATGSGINLVETIGGSQTRRYLNDKVTPVLLEGMRKIAVEQPADPLRVLGE
FT                   YLIERSDN"
FT   CDS_pept        complement(641958..643496)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000141868" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17445557"
FT                   /locus_tag="CAGL0K06545g"
FT                   /product="Similar to uniprot|Q03327 Saccharomyces
FT                   cerevisiae YDR470c"
FT                   /function="binding"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="membrane"
FT                   /protein_id="CAG61469.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG059539"
FT                   /db_xref="HOGENOM:HBG203313"
FT                   /db_xref="InterPro:IPR001993"
FT                   /db_xref="UniParc:UPI00003B6CA3"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FMN6"
FT                   /transl_table=1
FT                   /translation="MDTAELRPYYNEDTFDAGYLVKFNPQKGVVDSNGFNIASKLSIVK
FT                   NSNSSAKNLDPATLFTTRSNSKGSLFNFSLNFGSRAKALKGSSGSLDSLVKEFEWVDLL
FT                   NVNKWIAVVSQLMELFVRKYFQLLIQQPFEVSRLLQQVGQFNGESVSHTEEQKKARHSG
FT                   IILSDLDNEDEINYFPSTSTPDLLRDGTDNDERDDGEDQYTGQGQTDSVASIEETHIRC
FT                   LTPERSINPESKHTLDIMNSILDEEGIKGLWKANNTNFIYQILSSTLEAWYTGLISPLL
FT                   HIPDPYFIDLIHFPDTQSAVLLTLSVGVLTALTLIPIDLIRTRFIVTALYGTDTEVSEE
FT                   ASEGAANKKHDSRSLRHWIRSWSWRHDALKLPSDMWLLTMLQSVSNVSFNKLIDLVIYH
FT                   KFHVDKYSQMTTYNTMKVLARIAELFVKLPIECLLRRCQLDFLVYKNSSLRIEDTRQLI
FT                   ISPVKYQGVWKSIRDKSEYSSLWNGWRVGFMSIVCSYGVKLLNKFPEHTEQEKF"
FT   CDS_pept        644415..644825
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000210138" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17445558"
FT                   /locus_tag="CAGL0K06567g"
FT                   /product="Strain CBS138 chromosome K complete sequence "
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="CAG61470.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG020940"
FT                   /db_xref="HOGENOM:HBG378807"
FT                   /db_xref="InterPro:IPR001141"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR018262"
FT                   /db_xref="UniParc:UPI00003B6CA4"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FMN5"
FT                   /transl_table=1
FT                   /translation="MAKFLKAGKVAVVVRGRYAGKKVVIVKPHDEGSKAHPFAHALVAG
FT                   IERYPLKVTKKHGAKKVAKRTKIKPFIKAINYNHLLPTRYTLDVESFKSVVSTETFEEP
FT                   TQREEAKKVIKKAFEERHQAGKNQWFFSKLRF"
FT   CDS_pept        645736..646401
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000176758" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20197717"
FT                   /locus_tag="CAGL0K06589g"
FT                   /product="Strain CBS138 chromosome K complete sequence "
FT                   /function="guanylate cyclase activity"
FT                   /function="heme binding"
FT                   /protein_id="CAG61471.1"
FT                   /db_xref="GO:0004383"
FT                   /db_xref="GO:0020037"
FT                   /db_xref="HOGENOM:HBG269649"
FT                   /db_xref="HOGENOM:HBG317151"
FT                   /db_xref="InterPro:IPR007194"
FT                   /db_xref="InterPro:IPR011644"
FT                   /db_xref="InterPro:IPR016696"
FT                   /db_xref="UniParc:UPI00003B6CA5"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FMN4"
FT                   /transl_table=1
FT                   /translation="MNTIYNESLIFKKKEVSLSAMTFLYQEMISNIHNDCKDINEFETR
FT                   LSKMGYNIGLRLIELLNFRASATFTSKNFLSSGSNTSNGSSDATITASDQESSLTSFIN
FT                   RMRRRDLKILDVLQFIHGSLWSYLFGHVSNDLVKSSERENEYMIVDNKPKLTQFISGKN
FT                   VSCDYFVCGIIHGYLTSAGFPCKVTPHSMPQDGHDNRVVFLIQFDKQVLEREGLRISQ"
FT   tRNA            646893..646964
FT                   /gene_name="tRNA-Glu (TTC)"
FT   CDS_pept        complement(647277..648233)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000033919" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17445559"
FT                   /locus_tag="CAGL0K06633g"
FT                   /product="Similar to uniprot|P38313 Saccharomyces
FT                   cerevisiae YBR211c"
FT                   /protein_id="CAG61472.1"
FT                   /db_xref="HOGENOM:HBG123782"
FT                   /db_xref="HOGENOM:HBG204205"
FT                   /db_xref="UniParc:UPI00003B6CA6"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FMN3"
FT                   /transl_table=1
FT                   /translation="MDRDTKLLARLRGSHSRNVKRSKSISFADVDADLDENANVDVDVD
FT                   VDADENANVDVNADVEPVFDNEYEATPDILDVPVPDTTPHTQGSETGNISTPDVPRYTG
FT                   VDAHIQSSAYDFEDIPVSRLYSSITSVTTIHVLQAIFTNLLQNDLIPQALTAFNGTTNV
FT                   PRLSQLKKMSHKLDMRIFQVLAEQLTADLDDLLDINKANNELCYQLKELTANSQLLNKE
FT                   LIAVRKEHQTIKYGGKKHKLENDRANINSKIQLNAQLVELTEALLNDNEDDQADAPLTI
FT                   NSLNLRHTCELLDPHNGLVKRLQSKINEIKSLQEDST"
FT   CDS_pept        648911..651319
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17445560"
FT                   /locus_tag="CAGL0K06655g"
FT                   /product="Strain CBS138 chromosome K complete sequence "
FT                   /function="nucleic acid binding"
FT                   /function="nucleotide binding"
FT                   /protein_id="CAG61473.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="HOGENOM:HBG123783"
FT                   /db_xref="HOGENOM:HBG204206"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniParc:UPI00003B6CA7"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FMN2"
FT                   /transl_table=1
FT                   /translation="MSATTVTDITGTGTGTGTGTTGSASTATAIPLPPTSTIQTSDEPP
FT                   RTLWMGDLDPSYDEETIQEIWSHLGKHVTVKLIRAKKNLLIPCSSTSDPAPVPAASVPS
FT                   GQNGAQPPQEDTRDSPSNTTGSASNTPASDSGIQTSEGEQSTQQPLKININGVSFIDPA
FT                   TTQLHHAGYCFVEFESQKDAQEGLALNSTPLPNFVSTTTGQDINPTGQRTFRLNWASGA
FT                   TLQSSIPTTPEYSLFVGDLSPTATEADLLSLFQTKFKSVKTVRVMTDPITGASRCFGFV
FT                   RFGNEEERRRALIEMNGVHFQGRTLRVAYATPRSTTVMHTQGNNPHDHHVDVRNTISKA
FT                   ELEKSNLSQYLMNASNNSQRANQLRSANKMHNYPNASGFQQTHYSNDINSGNGLQRGPP
FT                   QRSYNPGQLHYNSYNQPEVNYGTDMSGGYPPNRADLGRKDGMINTSFVNTQVSEAALND
FT                   FFATDPTNTTVFVGGLGPTVQEQQLRKIFQPFGNILSIKIPPGKNCGFVKFEHKIDAEA
FT                   AIQGLQGFVLVENPIRLSWGRNHVAKNMINKLPPQYVSSGNQRQELRPQYQDPSTMLAN
FT                   NNINNQAYTYQHEQFYPSQQQIIYGKTNDFATKPDSLPLLTEVHQQGIQGQPYNQYQQQ
FT                   PLPSQSHQQQSSQQYMQALQRRQQQDLVNQYQYNQMKHMQNTVAQQAGMNVTSTTAWQL
FT                   SNDIPANSMTNNIVSGADINNDVGNRILEMDAQLHSLNLNPQSAGLNQLPNDNILNSSS
FT                   PNSARNQINIYGQGDRTMAYPQQVDENSLGMNNVRRPSLTTNNDNFAFT"
FT   CDS_pept        652186..652965
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000181024" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17445561"
FT                   /locus_tag="CAGL0K06677g"
FT                   /product="Similar to uniprot|P15807 Saccharomyces
FT                   cerevisiae YBR213w MET8 siroheme synthase "
FT                   /function="binding"
FT                   /function="catalytic activity"
FT                   /biological_process="porphyrin biosynthetic process "
FT                   /protein_id="CAG61474.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0006779"
FT                   /db_xref="HOGENOM:HBG204207"
FT                   /db_xref="HOGENOM:HBG434714"
FT                   /db_xref="InterPro:IPR006367"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI00003B6CA8"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FMN1"
FT                   /transl_table=1
FT                   /translation="MANSLQLAHQLKGKHVLLVGGGEVALTRILKLIKTDCKLTIVAPV
FT                   IHEKILRKYGGFDTASDGKVHRNEKWVPGCLKLYQYVEDTFNDDYFALDNKEGWSFIMT
FT                   AIPDQVESERIYKKAKSIYGPQQMVNVADNPPLCDFYFGANVEVEGLQLLISSNGSSPR
FT                   FAALIRDEVKRHLETLDLEKSVETLGTLRSRIRDLSPDMSQSKYRMQWIKQCTDIFGIQ
FT                   NAARIDVDKLVQLYKTMSQEQSLTFPPRTEVLANYTV"
FT   CDS_pept        653389..655035
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000048307" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18503111"
FT                   /gene_name="SDS23"
FT                   /locus_tag="CAGL0K06699g"
FT                   /product="Protein SDS23"
FT                   /cellular_component="cytoplasm"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG61475.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="HOGENOM:HBG058056"
FT                   /db_xref="HOGENOM:HBG395800"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR016711"
FT                   /db_xref="UniParc:UPI00003B6CA9"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FMN0"
FT                   /transl_table=1
FT                   /translation="MTNPKNVVPNSGTSSRHASIVEMLSSPPLLPHQHAQHAHVHRSQG
FT                   RSESIESIPLQRSASGTSSITSMGSNNDSSSANAQSANPSAGSATNVGASGTPHSGSGL
FT                   EAGNTDLSAVPMLQTPSQCLNSAHIHTWKHIQLSQLIEQNKLIFVPGSLSVEETFNTLI
FT                   KYHLTSIPVEAVPGDMNCLTFDYNDLNSYLLLVLNKITINNKQVTQDCQNGKPVAVGDI
FT                   VKLTPKNPFYKLPETENLSTVMGILGSGVHRVAITNPEMTQIRGILSQRRLIKYIWDNA
FT                   RSFGTLEPLLNSSLQDLKIGVLNTNSKPTSRQSRVISIQGEEPLIMALYKMHKERISSI
FT                   AVIDPQGNLIGNISVTDVKHVTRTSQYPLLHKTCRHFISVILNSRGLETGKDSFPIFHV
FT                   YPTSSLARTLAKLVATKSHRLWIVQPQEAPTATSSSSTSSSVNTGTISPNPTPTTTSAS
FT                   PAPGATPNALNNHSPLLSTVDDGHTVINPATQATNTTVIQPNLFEKEYRTGKLIGVVSL
FT                   TDIINLLARKQTANTEVDPQTARRQRGPATQ"
FT   CDS_pept        655617..656933
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20197718"
FT                   /locus_tag="CAGL0K06721g"
FT                   /product="Strain CBS138 chromosome K complete sequence "
FT                   /protein_id="CAG61476.1"
FT                   /db_xref="HOGENOM:HBG123784"
FT                   /db_xref="InterPro:IPR014840"
FT                   /db_xref="UniParc:UPI00003B6CAA"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FMM9"
FT                   /transl_table=1
FT                   /translation="MSNQDSFVSGVGNESHKRSNEVITIDEDTDVKKPKVNTGAKKIPN
FT                   IAEELAMNRQNVRSSSLSPLLNSDSSSNGSDKTSKSELPRPMIPETKPLPVASLLSGPN
FT                   NQKLNSTEPKSNSPQSPGSVSIPSLKRNDSESKLNKLKMRALLKNKSPANVRKSLSSTS
FT                   EKSSTATKLDDTEISNAVKQDNKTSKVDKTPQGKKLEGTFKSSLKSKSFTEIDRIGIVS
FT                   KDKQSKKKDMNAVTPKPRSPKRALPTTKSPNIMSVLEKGKTDIKTLSRPDIIIDVPLSL
FT                   DDSNAYLSEDNQVIFNFQKLIDEKYGISKKAKVPKKNLTMNLLQNLSNNRSGSTLDDEI
FT                   NLSDDEDDFEEEESHIPVKPAVPVNGKKPHPSKGKNLIGKYDIEDPFIDDSELQWEEYR
FT                   AATRDGFFVFFGPLVENEDSSAEAKLAPSNNKKLAGKNR"
FT   CDS_pept        complement(657067..659034)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000141987" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18503112"
FT                   /locus_tag="CAGL0K06743g"
FT                   /product="Similar to uniprot|P38315 Saccharomyces
FT                   cerevisiae YBR216c"
FT                   /protein_id="CAG61477.1"
FT                   /db_xref="HOGENOM:HBG124609"
FT                   /db_xref="HOGENOM:HBG204309"
FT                   /db_xref="InterPro:IPR013877"
FT                   /db_xref="UniParc:UPI00003B6CAB"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FMM8"
FT                   /transl_table=1
FT                   /translation="MSDAFEEVCDALKASFTDDKEDSLTLVTMIDTLSEEVDEGFEVKE
FT                   KEQFLELLLNLLEADTELVSAVGWDLPRTLLRFCNAKNIKNSDRLRKCKVVTICMAIFN
FT                   LLALHAKPQECLVTTLELLSELNFKNIVEECHQLSEDGSDNNTAEEDNDAVEDYMKDRD
FT                   QPEIIFGVKSYALFELAGSLIRRVATLHPSKYLEEAVTAIRKYVTNNTEVVEDVKFILR
FT                   RVFAFCRGYIPPEPPRQLIVDLKMNHEEYDEIMNSEIELQVRLLRNLCTFSVAYCVKFL
FT                   NDKTEVVYFHKLINKDLQLPEFYRSVHDIISRYYQIAFSFDIDLNDEFNDILRETRGIY
FT                   EDVIKRINETNNTDKNAKSDILLKAGYYYEVQKTAREKEINPDTKGIILLSGFNYIENG
FT                   DHLIDIDIADALYLYLRFASESLFSPTCHNVTIEGVARYWIWAALTTTDNNILKEKLAE
FT                   LSPLVLHSVLNLLLVKNCHQVNEEIRMITFTLITRILCLLPENCSYEFLMDELDNCAVV
FT                   FGKSCVLGILRDLVIKVDHSVSSNNTDTEDLSESMAQLKINNEKRAKKTFITLDPKRAG
FT                   EIEDLAIKTLKETKKSMKKDYILLVLNYIKFFSTFAHKWNKSKLNEFTTLVATNFSDSK
FT                   MLPEINAIIDANEKLRSLTE"
FT   CDS_pept        659308..659853
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000234863" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21046540"
FT                   /gene_name="ATG12"
FT                   /locus_tag="CAGL0K06765g"
FT                   /product="Ubiquitin-like protein ATG12 "
FT                   /biological_process="autophagic vacuole assembly "
FT                   /biological_process="protein transport"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAG61478.1"
FT                   /db_xref="GO:0000045"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0015031"
FT                   /db_xref="HOGENOM:HBG204208"
FT                   /db_xref="HOGENOM:HBG247064"
FT                   /db_xref="InterPro:IPR007242"
FT                   /db_xref="UniParc:UPI00003B6CAC"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FMM7"
FT                   /transl_table=1
FT                   /translation="MSRLLESEQESESGSENLVSSGSIALSKHEEQKRELGVENRLEQY
FT                   SRRLSQLALVDTNESSDSSEKEEVFVQGSLRSQQSLKASIQSSSHGHTGAPQKVMIKFQ
FT                   SIGSITSITPSVCQISTNKPFSVIISFLQRKLKMENIHCYINNSFAPVPSQNVGDLWNQ
FT                   FKVNDELIVSYCGSVAFG"
FT   CDS_pept        complement(660119..663646)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000282801" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20197719"
FT                   /locus_tag="CAGL0K06787g"
FT                   /product="Strain CBS138 chromosome K complete sequence "
FT                   /function="ATP binding"
FT                   /function="biotin binding"
FT                   /function="pyruvate carboxylase activity"
FT                   /biological_process="gluconeogenesis"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAG61479.1"
FT                   /db_xref="GO:0004736"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006094"
FT                   /db_xref="GO:0009374"
FT                   /db_xref="HOGENOM:HBG185226"
FT                   /db_xref="HOGENOM:HBG717218"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR003379"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR005930"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR013816"
FT                   /db_xref="InterPro:IPR013817"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniParc:UPI00003B6CAD"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FMM6"
FT                   /transl_table=1
FT                   /translation="MATNKMLTGLRDNFSLLGEKNKILVANRGEIPIRIFRSAHELSMR
FT                   TVAIYSHEDRLSTHRLKADEAYVIGKEGEYTPVGAYLAIDEIIDIAKKHGVDFIHPGYG
FT                   FLSENAEFADKVQKAGITWIGPPPEVIESVGDKVSARNLAAKANVPTVPGTPGPIETVE
FT                   EAQDFVNKYGYPVIIKAAYGGGGRGMRVVREGDDVADAFQRAKSEAITAFGNGTCFVER
FT                   FLDKPKHIEVQLLADNHGNVVHLFERDCSVQRRHQKVVEVAPAKTLPREVRDSILTDAV
FT                   RLAKEAGYRNAGTAEFLVDNQNRHYFIEINPRIQVEHTITEEITGIDLVSAQIQIAAGA
FT                   SLPQLGLLQDRITTRGFAIQCRITTEDPAKNFQPDTGRLEVYRSAGGNGVRLDGGTAYA
FT                   GAVISPHYDSMLVKCSCSGSTYEIVRRKMLRALIEFRIRGVKTNIPFLLTLLTHPVFIS
FT                   GDYWTTFIDDTPQLFHMVSSRNRAQKLLHYLADLAVNGSSIKGQIGEPKLKTHPQIPRL
FT                   HDEDGSPVDVSVPPQKGWRYLLQSEGPEAFAKAVRHNQGTLVMDTTWRDAHQSLLATRV
FT                   RTYDLAAIAQTTAHAFAGAFALECWGGATFDVAMRFLHEDPWERLRILRKLVPNIPFQM
FT                   LLRGANGVAYSSLPDNAIDHFVKQAKDNGVDIFRVFDALNDLEQLKVGVDAVKKAGGVV
FT                   EATVCYSGDMLQPGKKYNLDYYLDVTEKIVAMGTHILGIKDMAGTMKPAAAKLLIGAIR
FT                   AKFPDLPIHVHSHDSAGTAVASMAACALAGADVVDVAINSMSGLTSQASVNAVLASLDG
FT                   QIDTGINVKHVCELDAYWAEMRLLYSCFEADLKGPDPEVYDHEIPGGQLTNLLFQAQQL
FT                   GLGEKWIETKKAYKQANQLLGDIVKVTPTSKVVGDLAQFMVSNQLTPDDIRRLANSLDF
FT                   PDSVMDFFEGLMGQPYGGFPEPLRTDILKNKRRKLNRRPGLELAPFDLAKIREDLEARF
FT                   GDINECDVASYNMYPKVYEDFQKILEEYGDLSVLPTRNFLAKPRVGEEIEVHIEQGKTL
FT                   IIKLQAVGDLNEETGIREVYFELNGETRKIRIADKSQVVQTIAKPKADGHDPLQIGAPM
FT                   AGVIVEVKVHKGSQVKKGQPVAVLSAMKMEMVISSTGEGLVKDVLVKDGENVDASDLLV
FT                   VLEEEVKDE"
FT   CDS_pept        complement(664264..665967)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000194770" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17445562"
FT                   /locus_tag="CAGL0K06809g"
FT                   /product="Similar to uniprot|P38318 Saccharomyces
FT                   cerevisiae YBR220c"
FT                   /protein_id="CAG61480.1"
FT                   /db_xref="HOGENOM:HBG012531"
FT                   /db_xref="HOGENOM:HBG627011"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="UniParc:UPI00003B6CAE"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FMM5"
FT                   /transl_table=1
FT                   /translation="MDTPAKTLAKRDIPQFYLLICLYFLQGIPVGLAFGTVPFLLKSMA
FT                   KETTFTQLGIFSMATYPYSLKILWSPLVDSVYFKKIGRRRSWIIPIQLVSGVMLFFLGT
FT                   CISRGKVFNGVDDAFHGRNSGGLHNVNVPFLTWCFGTLVFLCATQDIAVDGWALTILSR
FT                   DSISYSSTAQTIGLNMGYFLSFTVFIALNSSEFANKYVRNMPLPHGLISLGGYMKTAGA
FT                   LYVLLTLYVIFFTKEVPNSVYDLPITDKVKEKDRELSADKALSPTITNIEYPDHVTIKT
FT                   ENTSSIAYVYRGFLKILKLRSVRTLATIHMVSKFAFQCNEAATNLKLLEKGFKREDLAV
FT                   TVLIDFPFEIIFGYYVVKWSSANEQKRKLNLSRGNHHKTNRIVKFLVGDGGLLTPWLWG
FT                   FLGRLTAAMFGNYIVSMFPKDGQISTGYFLLVIIQHLLGSFMSTVQFVAISAFHSKIAD
FT                   PVLGGTYMTLLNTLSNFGGTWPRLMIMSMINYFTVYSCTLENGSVAILNRGSNIQACTT
FT                   ALRGTAKVVTDGYYIANMFCIIIGTLLYFMFIKKKMLFLQTLPIGSWRCT"
FT   CDS_pept        complement(666501..667577)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000281450" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17445563"
FT                   /locus_tag="CAGL0K06831g"
FT                   /product="Similar to uniprot|P32473 Saccharomyces
FT                   cerevisiae YBR221c Pyruvate dehydrogenase "
FT                   /function="catalytic activity"
FT                   /protein_id="CAG61481.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="HOGENOM:HBG450176"
FT                   /db_xref="HOGENOM:HBG753264"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR005476"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR015941"
FT                   /db_xref="UniParc:UPI00003B6CAF"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FMM4"
FT                   /transl_table=1
FT                   /translation="MLQFRTPLTRLTPMARLATRSAVRMASTKTMTVREALNSALAEEL
FT                   DRDDDVFIIGEEVAQYNGAYKVTKGLLDRFGERRVVDTPITEYGFAGLAVGAALKGLKP
FT                   IVEFMSFNFSMQAIDHVVNSAAKTHYMSGGTQKCQIVFRGPNGSAVGVAAQHSQDYSAW
FT                   YGSIPGLKVLVPYSAEDARGLLKAAIRDPNPVVFLENELLYGEQFEVSEEALSPDFTLP
FT                   YTAKVEKEGKDISIITYTRNTEFSLAAAKILEEKYGVSAEVINLRSIRPLDIDAIVKTV
FT                   KKTNHLITVESTFPSFGVGAEIIAQVMESEAFDYLDAPIQRVTGADVPTPYAKELEDFA
FT                   FPDPETIVRAAKEVLSIE"
FT   CDS_pept        complement(668252..669865)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000229994" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21046541"
FT                   /locus_tag="CAGL0K06853g"
FT                   /product="Strain CBS138 chromosome K complete sequence "
FT                   /function="catalytic activity"
FT                   /protein_id="CAG61482.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="HOGENOM:HBG519036"
FT                   /db_xref="HOGENOM:HBG547964"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="UniParc:UPI00003B6CB0"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FMM3"
FT                   /transl_table=1
FT                   /translation="MTTATASFNDTFRVSDNVAVIVPETGLEVTYRDLSHMVGHFQTIF
FT                   KDPNSPLYGVVHRQSVIAMSMPNGLEFIVSFLATTMDAKVGAPLNSNYKEKEFDFYLGD
FT                   LKTSSICVPKGTVGTNAEVLKSAKNFNCFIIELELNPERFRVEYQVYSPKDNYKKAIYS
FT                   SLNNAKFVNNDNVRFPGYARSSDVALVLHTSGTTSRPKTVPLMHLNIVRSTLNISRTYK
FT                   LNETDRSYVVMPLFHVHGLIGVLLSTFRTQGSVVVPPRFSAKRFWDDFIKYKCNWFSCV
FT                   PTISMIVLKTPKPANGIPHIRFIRSCSSALAPATFHKLEEELKAPVLEAYAMTEASHQM
FT                   TSNNLPPGKRKPGTVGQPQGVEVRILDDKDNILPQGEIGEVCIRGENVTPGYANNPKAN
FT                   EENFTKRENYFRTGDQGYFDAEGFLVLTGRIKELINRGGEKISPIELDGVMLSHPKVDE
FT                   AVCFGVPDEMYGQVVHAAVVLKKGEKMTYDELTAYMQDKVAKFKIPAKVYFVETLPKTA
FT                   TGKIQRRIIAEAFATKKSKL"
FT   CDS_pept        complement(670283..671944)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000142329" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17445564"
FT                   /locus_tag="CAGL0K06875g"
FT                   /product="Similar to uniprot|P38319 Saccharomyces
FT                   cerevisiae YBR223c"
FT                   /function="phosphoric diester hydrolase activity "
FT                   /biological_process="DNA repair"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG61483.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006281"
FT                   /db_xref="GO:0008081"
FT                   /db_xref="HOGENOM:HBG123785"
FT                   /db_xref="HOGENOM:HBG204211"
FT                   /db_xref="InterPro:IPR010347"
FT                   /db_xref="UniParc:UPI00003B6CB1"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FMM2"
FT                   /transl_table=1
FT                   /translation="MKRTLSDAAAKCAERWSRVQYGGSEPVETERAERKTVGSDADTDI
FT                   EGDSDEDLVVVGEKKVEVHVLSDSEPDIEDARPSKRIKGTDGYVPFRLIRSEAYDESTG
FT                   HTPYMADLGDIFGDPELREVYLFSFQYDLSFVLRHFTTSIERITIVAQTGTIVPVSSSE
FT                   LTHSPQFSQIFHRLVVKEIYMPPYSCHHSKMIIGIYRNGRGVRVFLPSNNFTWAETNWP
FT                   QQVLWSSPFMSISDKAVEMNGFQRSLCDYLSFYKLKELNSLVKDTIMRTDFSGLADVEF
FT                   IYSCPKTKGKNIETGLNMFLKSIEKVETELRDVDQISLNLFLCQSSTIGGPIGRRKDNP
FT                   SNLFTHVIVPTARGFSEAAKSDQQALLKAYHENKTYPCIIYPCMKEIRDASVGINSAGW
FT                   FNFNYTRNDTQLQQYDWLRNKIKVFYKYNRDYTTKQRLTTPSHTKFYLRFRMPSQSMAQ
FT                   GMRVPEHIDWCLFTSANLSSNAWGTLGSQPRNYEVGVMYKNSNITTKAQDSNLHCQSLQ
FT                   DIIYRKGQRPQTRSVLFPFPSHLQPYETNDQAFYQM"
FT   CDS_pept        672527..675097
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18503113"
FT                   /locus_tag="CAGL0K06897g"
FT                   /product="Similar to uniprot|P38321 Saccharomyces
FT                   cerevisiae YBR225w"
FT                   /protein_id="CAG61484.1"
FT                   /db_xref="HOGENOM:HBG123786"
FT                   /db_xref="HOGENOM:HBG204212"
FT                   /db_xref="UniParc:UPI00003B6CB2"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FMM1"
FT                   /transl_table=1
FT                   /translation="MDSEQGPYNACRYEHPEELEASQENSDNRIDLKVVTGPSPTSMPS
FT                   SGITTAHSNTSNDKSIQSDVPNTDKILVMDSPQPQLLPMSPSISVRSEQASANNISTSG
FT                   IRPQTLIVDNKRLSSPMPSPSLGPSQSAITNNSDENSLLMASKNDENPITSSEIFGMID
FT                   PLPAVEKSGARQSSSHSHDITTNHNWSYDWNKLPALGTSILKKGPNYNQVLVHKDGKKK
FT                   ELHYDPSYNQHLPEMHIFLNFNSDTSQGDALTYARERLTEYVRFVSDYLKVRKYAFECY
FT                   PFNIQLASTIETELREYVSYNATHIYNEMGMVIQMWYYQAQKLLLQSNSLLFSTEVVQH
FT                   LLKTKTSSRKHQQQINNQLAKDESSSVLSAKPDSFAHHRTGSKKTHHKLCTDIDILVIR
FT                   PQLIVQIGWQLACDEPSLNIGDFPLDLSPWLHDEEDRKIISQTASSVPKESCYKLVSDE
FT                   SELEVLNDENAHSVLVDCMDRSYTLLQEQDKFEVDTNDKDSGLFNVEGEKQHDELPKLK
FT                   KSTTKTNKKSGFVNFFKRKHTHEDSTDNLTSPTIATNKPDHAKAKLKDLSLGEPMVNLP
FT                   SNLASPSLSIAPKSNKDNVNSLLNSTTWLVDYYSNLMNNYKKVTLPTQFIIPDEIQESV
FT                   NTTNSSERPKSLQRKPSNALLYGKEYLQLRLPFKDNSLPAIYCPWVWSELPHSKWKALL
FT                   REMYRTVTPGGYVMAVAADISMSNTFSVNDPELNESTFKTTIERDKTYDAVSLEAINRG
FT                   LHIHTTKHLFKAFKESGFINIKSSILSLKTGDLDTQMGFLNEFLAIVHWDHMMRKVFPD
FT                   ASNPPKDTDPTTLPMRYFEEHLGKVDDNAGCYRMLFLVARKPKK"
FT   CDS_pept        complement(675277..676926)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000010093" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17445565"
FT                   /locus_tag="CAGL0K06919g"
FT                   /product="Strain CBS138 chromosome K complete sequence "
FT                   /function="ATP binding"
FT                   /function="nucleoside-triphosphatase activity"
FT                   /function="unfolded protein binding"
FT                   /biological_process="protein folding"
FT                   /protein_id="CAG61485.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="GO:0017111"
FT                   /db_xref="GO:0051082"
FT                   /db_xref="HOGENOM:HBG001500"
FT                   /db_xref="HOGENOM:HBG745965"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004487"
FT                   /db_xref="InterPro:IPR013093"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="UniParc:UPI00003B6CB3"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FMM0"
FT                   /transl_table=1
FT                   /translation="MLALNSYGCSRAASLVNRIAVNAIICRFMSSSDNASRLLVQQNTN
FT                   ESIPPPRKLKAYLDEYVIGQEIGKKVLSVVVYNHYLRINDKQKKAELQRQREIIEESNN
FT                   IRAAESTKDGNDPDDNSSGKDDTSPISDVIQKPYKPSEKEAGMRNLKMQIDMKLDQEDQ
FT                   DLELSKSNVLVIGPSGSGKTLLAQTLARVLDVPIAISDCTQLTQAGYIGEDVEVCIERL
FT                   LVNANYDVAKAEKGIIVLDEIDKLAKSSSSFGTKDVSGEGVQQSLLKIIEGHNVEITVK
FT                   KPVKVGTDKNNNQTTAKKDETFVINTSNILFMIMGAFVNLDKIVAKRIRKLQNKEEKDG
FT                   EEEDMSKSSAYSNSIETINLENGKQTSALNLATPTDLVSYGMIPELVGRVPIITALEPL
FT                   QSNDLFHILKEPKNALFDQYTYIFKQFGVRLCMTDKALKKVADFALKERTGARGLRGIM
FT                   ERLLLNVNYECPDSGISYVLVNEKTVDSLQQTEYSLATHVEAKYYSRGQADELIADVYA
FT                   EDEALGRVLDKELGRTSTIAKRKEQSKLLQAQ"
FT   CDS_pept        677317..678255
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000248775" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19350889"
FT                   /gene_name="SLX1"
FT                   /locus_tag="CAGL0K06941g"
FT                   /product="Structure-specific endonuclease subunit SLX1 "
FT                   /EC_number="3.6.1.-"
FT                   /function="endonuclease activity"
FT                   /function="metal ion binding"
FT                   /biological_process="DNA recombination"
FT                   /biological_process="DNA repair"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG61486.1"
FT                   /db_xref="GO:0004519"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006281"
FT                   /db_xref="GO:0006310"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="HOGENOM:HBG058065"
FT                   /db_xref="HOGENOM:HBG397296"
FT                   /db_xref="InterPro:IPR000305"
FT                   /db_xref="UniParc:UPI00003B6CB4"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FML9"
FT                   /transl_table=1
FT                   /translation="MEEFQQIPDFYGCYLLQSISKRQSFYIGSTPNPVRRLRQHNGSLS
FT                   RGGAYRTKRDGTRPWEMVAIVYGFPSRIAALQFEHAWQHGYQTRYIKSQDRVVKTRKGG
FT                   RSIHHKLAMITSLLKNEYFRYMDLTLHFFNQKVEEIWKNDKFNVSQTQESIDNNYTVSL
FT                   SQDALTEINNDTIDDIMDVNEKNMELVQNLYSTTLAEKTKTLLLYKEKIDTGINTCQFC
FT                   NKIIKHNLSGNISENLFAFCRDTSCTFVSHLACAYRYFMSNTELPKEDTIIPQSPKCPK
FT                   CYTLLKWCDVIYYSIKLNKDNTTADDKKKTI"
FT   CDS_pept        complement(678336..681161)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000115864" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18503114"
FT                   /locus_tag="CAGL0K06963g"
FT                   /product="Similar to uniprot|P38138 Saccharomyces
FT                   cerevisiae YBR229c"
FT                   /function="carbohydrate binding"
FT                   /function="hydrolase activity, hydrolyzing O-glycosyl
FT                   compounds"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /protein_id="CAG61487.1"
FT                   /db_xref="GO:0004553"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="GO:0030246"
FT                   /db_xref="HOGENOM:HBG020925"
FT                   /db_xref="HOGENOM:HBG315035"
FT                   /db_xref="InterPro:IPR000322"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniParc:UPI00003B6CB5"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FML8"
FT                   /transl_table=1
FT                   /translation="MKLFNVLFFSLLFGYVTAFADYLLKSCNEAGFCVRNREYAANIIN
FT                   SKASYYSIDPKSIDVDDSSGTLSANIIKTIKRPDRHTEITLPLKISFLKSHGASSKSYF
FT                   RFTIDELRQNVPQSNLLNKYRYNETAKWAFDPSKQWDNSHFTIEKKIKNGKKGIDQFLF
FT                   GSTSKDEEYYLILPRDDENMAIELFLDSFQINVLSKGKSVMSINEYNLMNFEHFRSIED
FT                   NFQNLLEEESTFNMFKDNFRYSQDDKIPFGPESVGIDFVFKNAKAVYGIPEHADSLKLK
FT                   DTRETDPYRLFNVDVFEYFVDSPSPMYGAIPFMFGVSKDVTTGLFWVNSADTWIDIHYS
FT                   SVNTDQVNTHWFSENGVIDVVVFVAENPSDILEQYTDLTGRPFLPLQSSIGYHQCRWNY
FT                   NDEYDVLSVQNEMDKAHIPFDIIWLDLEYTDDRKYFTWKDESFPNPRRLLEKLSQFGRQ
FT                   LVVLIDPHLKSRGNKVSDAVVKGKGATKNKKGRLFLGECWPGQSIWIDTMGQIGRKLWK
FT                   GFFNDFLYKGLSNLHIWNDMNEPSVFSGPETTAPKDVIHAGGFEERSIHNVYGLTVHET
FT                   TFNATREFYTDSETRPFVLTRSFFAGSQRTAATWTGDNVANWDYLRISIPMCLSNNVAG
FT                   FPFIGADVAGFSGNPEPELLVRWYQAGLWYPFFRAHAHIDSVRREPYLFDGPVRNMVKD
FT                   TIRLRYRLLPTFYTAFYESSRTGAPIMKPLFFDYFAHEELLAIDDQFFVGNSGIMVKPI
FT                   VQKGVKETTVTFPPKLYYDYETFALVNDDVSAITNKQVSAPLDTIPIFLEGGHILFQKE
FT                   KYRRSSELMSNDPYTIVIIPDENGIAIGNLYVDDGKTFAYSNNEFLNTTLKFTSDGLFN
FT                   RPHSEGNLSATAINTNVTAIKIVTSGLESSFKKQLISKFSSDDNLNTNVESNHIVMKIR
FT                   YDMSKPWDFVF"
FT   CDS_pept        681944..683734
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000247854" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17445566"
FT                   /locus_tag="CAGL0K06985g"
FT                   /product="Similar to uniprot|P38140 Saccharomyces
FT                   cerevisiae YBR239c"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="signal transducer activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG61488.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0004871"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG059324"
FT                   /db_xref="HOGENOM:HBG397916"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="UniParc:UPI00003B6CB6"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FML7"
FT                   /transl_table=1
FT                   /translation="MNNATSYYRTSGEQDGKLTSTLPSGSTSNTNVRYSSNDNSDGTIQ
FT                   SDTSISQTSHTVKKKRKNTNVACVNCSRNHSSCEQKRPCSRCIKKGIANTCVDAPRKKK
FT                   KYLEGIDTLPIRVGSNTPHYGTPLQIGYHSASFIDNQQYGQTPRHSIGDFNDIYPTSYK
FT                   SYPENRYNVRNDQAHRFQSYAANSEYSVLSTIVRQNSLNNNNHQIIHRNRDTITSPGPI
FT                   QSYNSISSELNSPSSSSPKSNGLTRNNSMSPNAKNFDLNSQQHDTYAHKPPQPYPSSKS
FT                   HIYSILLGDYGKEILQSQVNLYANHFPLVPFLSVDGTLDFKRIYPSDPSKTENTDSFFN
FT                   TKINQYYVNNEFLTFPELKYKIDSGKVEKVTDTENYAVSVSVECPPPDGSRLYNNVEWD
FT                   HSLKYGTPVEIYKLINEPFSHTPGFRHLLQYLRKRFSQKDLVSMCQNMAYFRPIFIACS
FT                   ITLTEEDMIFMEQCYQRTLLQYVKFIQEIGTPTVVWRRNGQISYVNDEFEILSGWKREE
FT                   LLDKMSFIVEIIDDESVREYFKTFARIAYNNIKGSEQMDVCRLLTPIRNQVIECKCIWT
FT                   LKRDMSGLPLMILGNFLPVL"
FT   CDS_pept        687697..689907
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000000732" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18503115"
FT                   /locus_tag="CAGL0K07007g"
FT                   /product="Protein RMD9-like, mitochondrial "
FT                   /cellular_component="mitochondrial inner membrane "
FT                   /protein_id="CAG61489.1"
FT                   /db_xref="GO:0005743"
FT                   /db_xref="HOGENOM:HBG059325"
FT                   /db_xref="HOGENOM:HBG204289"
FT                   /db_xref="UniParc:UPI00003B6CB7"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FML6"
FT                   /transl_table=1
FT                   /translation="MFRFAQPANVLKGKAPSQIVPPHPKTNSFVHPSAHPLKFNPNSAM
FT                   TVEVPTHQNGPASNNQYNGNHSRPHFKNQFSSRNSSFTNVMNYGKNHGNNNMSPDSPWY
FT                   NEVVAFEDCVSQTLYMSQTPRRSNMRNNGNNNMNNGRRTEHPNTQANPLFWDSIGRAMG
FT                   LYHDLINTPELNSDRVSKLVHLLHNGLRANRNQLTRMNKKPDYDSQSFHKEMTNYLCKS
FT                   LREISEDVLNGKVELNEYGAMHLITAFKELLLFQEAVNIWKSAINGSNNYTSNIFLNPR
FT                   VVGVILPILYENGVSYPEIQSLYEKSSSMINYFHPNLSVGMIRASLSASENQMALKLFQ
FT                   KLCEESTEMKYGYLIETHLSFIGECKDLNVAQAFFDKALNDEMPYKIDLQVSYVKSFLK
FT                   NIWSQTGDFNHIYQIWYKSSLHYGRHVNHGISSSLNDTFFDIFFENYANDKVQGFPMLQ
FT                   NIIQNYHNMKNIDEPFFNIILAKCTVWHDRTILEYIDNSYDAFNIPKTIVAYRILLKSM
FT                   GSIDDVTTQEILQRWINLICKSDEIGQRFIANADWAALRDATVTWTQRNRGISSSSPMS
FT                   AVNSLAPSTTNTPSPSLSPIPDRDTLSSARNTPNKIWSGTPVPPPSTEMDFYSHPAFQA
FT                   ANASGAFDDMASATVNPTPRKNFTNGIVPNTPQPIDDRMVLYLKIVKRYSPFCRDSRQL
FT                   ARLTTGTAVKYSVLQEVLNQFQSLNVNDIPVPELRNLKPTCV"
FT   transit_peptide 687697..687933
FT                   /locus_tag="CAGL0K07007g"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FML6 "
FT   mat_peptide     687934..689904
FT                   /locus_tag="CAGL0K07007g"
FT                   /product="Protein RMD9-like, mitochondrial "
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FML6 "
FT   CDS_pept        complement(690501..692951)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000007229" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19350890"
FT                   /gene_name="PRP5"
FT                   /locus_tag="CAGL0K07029g"
FT                   /product="Pre-mRNA-processing ATP-dependent RNA helicase
FT                   PRP5"
FT                   /EC_number="3.6.4.13"
FT                   /function="ATP binding"
FT                   /function="ATP-dependent helicase activity"
FT                   /function="nucleic acid binding"
FT                   /biological_process="RNA splicing"
FT                   /biological_process="mRNA processing"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG61490.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006397"
FT                   /db_xref="GO:0008026"
FT                   /db_xref="GO:0008380"
FT                   /db_xref="HOGENOM:HBG517301"
FT                   /db_xref="HOGENOM:HBG737336"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="UniParc:UPI00003B6CB8"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FML5"
FT                   /transl_table=1
FT                   /translation="MTSIDKQKERLEKLARWKQKKSESKAVLNTQNVNTNSQSSNQNNV
FT                   SDIENKLEKVKAWKKRKLEVKSDQQTPPATQSEINHTSSVRLEENIQGIKRKKRQKRVS
FT                   NVFDEVKPINSTPTNDAQLSESDILEKVDLNTEDPLDSFFGNIETTEEFHFEVIDNKVN
FT                   NDELLDEDNSKFDALQKEQKKLAKAKKNKNKKLLTPVNFRNIDLDPISKCLYNEPEEIK
FT                   SYTEDEIADLRLDLDNIKIEGKDCPRPVTKWSQLGIPYDIIRFIKDVFSYKSLTPIQTQ
FT                   TIPAIMSGRDVIGISKTGSGKTISYLLPMIRHVKAQKKLRNGETGPIAVIFAPTRELAV
FT                   QINEEVQKLISDLDISSICCTGGSDLKKQIDKLKTGVEIAIATPGRFIDLLSLNGGNLV
FT                   STLRISFVVMDEADRLFDFGFEPQIASVLRTVRPDRQCVLFSATFPSKVSNFASRFLDS
FT                   PLQITVNAEGMVNERINQKFTICSDESDKFKELLSLLKVFNSETVDEKTIIFVSSQQIC
FT                   DIIEKRLTDYSEKLYSIHAGRPYNERRQNLELFKKTSNSILLCTEVMSRGLNVPEVSRV
FT                   ILYNSAKTFAQYVHSTGRTARGTREGTSISLLLPNELSSAYILNKAMRDKDFSECPVKE
FT                   VKNLKQMAQKFEDGLKSGKYKLSTGLGGKGLENMDNSKETSNNDLDEQLKHQDNISISQ
FT                   EADLPDDFKFDTSVETVTNADGTIATVCKFVVNDLPQLVRWEMTKNTSISNMIRETGCS
FT                   ITLRGRYYPPSNVTNDNNTEPKLYLLIEATDDKAVRHCVDLLKDNARVGFMKATSESLR
FT                   NTKY"
FT   CDS_pept        693243..694496
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000242614" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18503116"
FT                   /gene_name="ABD1"
FT                   /locus_tag="CAGL0K07051g"
FT                   /product="mRNA cap guanine-N7 methyltransferase "
FT                   /EC_number="2.1.1.56"
FT                   /function="RNA binding"
FT                   /function="mRNA (guanine-N7-)-methyltransferase activity "
FT                   /biological_process="mRNA capping"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG61491.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0004482"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006370"
FT                   /db_xref="HOGENOM:HBG059327"
FT                   /db_xref="HOGENOM:HBG377892"
FT                   /db_xref="HSSP:1RI5"
FT                   /db_xref="InterPro:IPR004971"
FT                   /db_xref="InterPro:IPR016899"
FT                   /db_xref="UniParc:UPI00003B6CB9"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FML4"
FT                   /transl_table=1
FT                   /translation="MSVKPEKPVWMSQEDYDRQYGTVGDGENKTAIVEKTTITTQSSSN
FT                   VVVGEASKTSSDIGANKIQKRKRHDDFALEEKKRRERERRLREEQLKEHEIKLTAEKIT
FT                   NVNNLVREHYNERTYIANRTKRNQSPIIKLRNFNNAIKFMLIDKFTHTGDVVLELGCGK
FT                   GGDLRKYGAAGISQFIGIDISNASIQEAHKRYQSMKNLDFQAILITGDCFGESLGVAVE
FT                   PFPECRFPCDVVSTQFCLHYAFETEEKARRALLNVSKSLKVGGRFFGTIPDSEFLRYKL
FT                   NKIGKDVQEPKWGNQIYSIKFSNNDYHENGNEFPSPYGQMYTFWLEDAIDNVPEYVVPF
FT                   ETLRSLADEYGMELILQMPFNQFFVQEIPKWVNRFSPKMREGLTRSDGKYGVEGIEKEP
FT                   AAYLYTVFAFKKVREHVE"
FT   CDS_pept        complement(694653..698015)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000188913" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21046542"
FT                   /locus_tag="CAGL0K07073g"
FT                   /product="Similar to uniprot|P38329 Saccharomyces
FT                   cerevisiae YBR235w"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="membrane"
FT                   /protein_id="CAG61492.1"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG059328"
FT                   /db_xref="HOGENOM:HBG396827"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniParc:UPI00003B6CBA"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FML3"
FT                   /transl_table=1
FT                   /translation="MRASKFYDLPGAHRPSPRDSVNESSSLIGEFQRRTSTSSYNYYST
FT                   PSGKAHKVSSRYDPDNPNKDKLGTFDGVFIPTALNVLSILMFLRFGFILGQLGILSTLG
FT                   LLVLSYSINLLTTLSISAISTNGTVRGGGAYYMISRSLGPEFGGSIGLVFFLGQVFNSG
FT                   MNAVGLVEPLLYNFGANKNLSDNLSAGVIWPLLPQGEVYSFIYATTILFICLMVALVGS
FT                   QTVSRAGNILFFILFASIISIPISLLFKLPFTEGFVKYTGPSWKTFKNNLFPHFTKGAA
FT                   GSLLKGKENFSDIFGVFFPATAGIFAGAGMSSELRKPSKSIPKGTLWGLLFTIICYSVV
FT                   VMSMGCSIPRNTLYKELQVIQSVSVVQWLIFSGELATSLFSIIVGMVGAAYILVAIAKD
FT                   SIFPGLKVFNKHPLSALLFTWFSTQLCLFLDVNKIANFITMTFLMTFAVMNLACFLLSI
FT                   SSAPNFRPSFKYFNRYTALFGTISSVIAMLIVDGLSASELISAMTILFLLIHYFCPPKS
FT                   WGDVSQNLIYHQVRKYLLRLKQDNIKYWRPQILLFVDDPRSSWNLILFCNHLKKGGLYI
FT                   LGHVTVVNNFQKQLDNIKKQQKAWMKIRDITKIKAFVQIGTGPSLNWGVRNVFLGSGLG
FT                   GMKPNITVLGAYYLKNYKNKGPESGSASLSQSRISMNSLKAIKSQKMIDAKMNLPTALP
FT                   TDAYENKVKVTPTQWVQMIEDLSLMQSNIAIAHGFRDLDIPQRDGIKQASKRVIDLYPI
FT                   QMCGKLESDGNRPSLVSTNLDTYTLILQLGAILVTVPDWKETHVLRVILFAENVNTVKN
FT                   DIENMQKLLDVLRIQAEVIAVTLDQFRVYNTIVHGEPSAFEYVNRVLEDDDWWNDLVDA
FT                   RRTLNPKRRFSTADGGITGNKTIKTEKYKVAGLQKLGVNLKLSSSVPNQQIISPYESEI
FT                   SDTESTTTSKPTSTSTLTLNGLFRNQNGIYHKNDRRVMSHNLDSSSGKKTLPVFSTGKL
FT                   PKTKVLEDGIGDKPTLIPVIDTNDPNERQSRKQDLPELSPLNSNESLVKLMENIKFDDL
FT                   PSRAQHLILNDVMINLSKHSSLLFSTLPLPQLGTHKDETASMEYIENLDIWLDGLPPTM
FT                   LINAQMMTVTTAL"
FT   CDS_pept        698857..699972
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000181752" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17445567"
FT                   /locus_tag="CAGL0K07095g"
FT                   /product="Similar to uniprot|P38328 Saccharomyces
FT                   cerevisiae YBR234c AR41"
FT                   /function="actin binding"
FT                   /biological_process="regulation of actin filament
FT                   polymerization"
FT                   /cellular_component="cytoskeleton"
FT                   /protein_id="CAG61493.1"
FT                   /db_xref="GO:0003779"
FT                   /db_xref="GO:0005856"
FT                   /db_xref="GO:0030833"
FT                   /db_xref="HOGENOM:HBG026058"
FT                   /db_xref="HOGENOM:HBG716994"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017383"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="UniParc:UPI00003B6CBB"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FML2"
FT                   /transl_table=1
FT                   /translation="MSDNSVLKVFKLVKAPIYSHCFSADRSVLAISCEANCLIYRVGGP
FT                   TPQLVATLANHDKLVTAVDISPHGRIVTCSQDRNAYVWEPLSDGSYKPTLVLLRINRAA
FT                   TSVSWAPSGYKFAVGSSARIIAVCYYEHENNWWVSKHIKKPIKSTINCLSWHTNGVLLA
FT                   AGGTDGYMRVFSGFIKGLDSKESVAGSPWGDKFPFGSLVKEWYQGSYIHDVKWRSSQEQ
FT                   IAFVTHDAKLNIVDSQNGYEFTDSPDGLPFKALVWINDNEILCGGYSCHPVLFSKSSQG
FT                   WKFSKNIDKIGAKTPTPQVGGEDEDENPTFGMSALKKFKELDLKGKVSVEVQESAHENT
FT                   ITELAPFAESNGQVTEVSSCGLDGKIVIYRI"
FT   CDS_pept        complement(700195..700476)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000731" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18503117"
FT                   /locus_tag="CAGL0K07111g"
FT                   /product="Similar to uniprot|P69850 Saccharomyces
FT                   cerevisiae YBR233wa DAD3"
FT                   /protein_id="CAR58053.1"
FT                   /db_xref="HOGENOM:HBG398749"
FT                   /db_xref="InterPro:IPR013965"
FT                   /db_xref="UniParc:UPI00017BD8EA"
FT                   /db_xref="UniProtKB/TrEMBL:B4UN37"
FT                   /transl_table=1
FT                   /translation="MDNTLTPLQQKVLARYKELVSCLRDLDSSIKDLNQQQLDTKGNKD
FT                   SSNSSPDEILKEMREIEVKIGLVGTLLKGSVYSLILQKQQTQKFNSES"
FT   CDS_pept        complement(700931..702313)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000730" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17445568"
FT                   /locus_tag="CAGL0K07117g"
FT                   /product="Similar to uniprot|P38151 Saccharomyces
FT                   cerevisiae YBR233w PAB1-binding protein 2 "
FT                   /function="RNA binding"
FT                   /protein_id="CAG61494.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="HOGENOM:HBG059333"
FT                   /db_xref="HOGENOM:HBG397626"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR004088"
FT                   /db_xref="InterPro:IPR018111"
FT                   /db_xref="UniParc:UPI00003B6CBC"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FML1"
FT                   /transl_table=1
FT                   /translation="MMTIDKETMGSSSSNGLSPNVLKRKNEDCVDLEAEIKRVALDDEE
FT                   ADNEGNSKSELSSDDRNSSYTSTKLDPKTNIQSQDISLRMLCLVKQASIIVGPKGESIN
FT                   KLKEQTSTKINVSPNIRGVPERVIHVKGSCENVGKAFGKIARIIIEKDSKNNANQSSSS
FT                   LDSEASQNSSDAEDTTLILNLLISHALMGSVIGKGGSQLREIEERSAAKLYASPNQLMM
FT                   SNDRILSITGVPDAIHIATYYVAQSLLNCREELKQRKSIFYQPSQMGSALPNSYGAQMY
FT                   NKFPHQMHHQYHPMDKYNTPRNKKSHRLPRPQSMLANNVPPSINGHAFHDEYMNRPESG
FT                   QIHYTSANVASAPSFTPTRNIPNVRIVDNPENNMAYSNPIAPVKQDIYIDENFVGNIIG
FT                   KEGKHINSVKESTGCAIFIDNRIEGVSERKLTIKGTYMALQAAIMLISNKIEIDRANFE
FT                   KS"
FT   CDS_pept        703023..703922
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000000729" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18503118"
FT                   /gene_name="SWC5"
FT                   /locus_tag="CAGL0K07139g"
FT                   /product="SWR1-complex protein 5 "
FT                   /biological_process="chromatin modification"
FT                   /biological_process="regulation of transcription "
FT                   /biological_process="transcription"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG61495.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006350"
FT                   /db_xref="GO:0016568"
FT                   /db_xref="GO:0045449"
FT                   /db_xref="HOGENOM:HBG042679"
FT                   /db_xref="HOGENOM:HBG329484"
FT                   /db_xref="InterPro:IPR011421"
FT                   /db_xref="UniParc:UPI00003B6CBD"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FML0"
FT                   /transl_table=1
FT                   /translation="MEETDIAKLSEEEYNEEEDEDFDPTKGTAVAGAEVSDGEDDDEDD
FT                   EDDSRVKDSYSHIVSESGGLVKTRRARQQEEEFKRKNKYEGIVEAAISEKVGSIWEDLK
FT                   KESLSRLHNKENDSVISESSKLKKDNHVAGEEMVTIERVYKFAGETIREKKTVPISSAE
FT                   AVEYLNNLKFRKSTDQAGSTKRKLEEIDVKENNNTNEDTSESGIDRKKLRRPLKRPPFL
FT                   EQIISGALKPKLSTLEKSKLDWATYVDKEGINDELSAHNKDGYLAKQDFLNKVDSVKEN
FT                   EYKELRRKEMMIRLQETK"
FT   CDS_pept        complement(704184..705146)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000176880" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17445569"
FT                   /locus_tag="CAGL0K07161g"
FT                   /product="Similar to uniprot|P12904 Saccharomyces
FT                   cerevisiae YGL115w SNF4"
FT                   /function="catalytic activity"
FT                   /protein_id="CAG61496.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="HOGENOM:HBG183531"
FT                   /db_xref="HOGENOM:HBG446629"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniParc:UPI00003B6CBE"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FMK9"
FT                   /transl_table=1
FT                   /translation="MPGVQNTEGVIEEQRAALESCRHFLRGKSSYDILPVSYRMIVLES
FT                   GLPVKRALNVLIQNKVLSAPIWDSKRSRFAGILTLMDFIGLVQYFFSNPDQFDTMDKLR
FT                   LKDLKEIEYSIGMHAPLENCTIHPERSLFEACELMLQSQTRKIALLDKEDFTERELVVG
FT                   MLTQYRILKFLVLNYKDVHFMHRSINSLQLGTRKNIKSCKMETPLIDTIQLMTTHEVSS
FT                   VPILDENGVLLNAYEASDILGLVKGGIYNDLSLCVGEALMRRGDDYEGIYTCTGEDKLA
FT                   TIFDIIRKSRVHTFYLVDENGRLIGILTLGDLLRYIIEG"
FT   ncRNA           705518..705691
FT                   /ncRNA_class="snRNA"
FT                   /gene_name="SNR20"
FT                   /locus_tag="CAGL0K07175r"
FT                   /product="U2 RNA"
FT   CDS_pept        705897..706220
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17445570"
FT                   /locus_tag="CAGL0K07183g"
FT                   /product="Similarity"
FT                   /protein_id="CAG61497.1"
FT                   /db_xref="HOGENOM:HBG123788"
FT                   /db_xref="UniParc:UPI00003B6CBF"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FMK8"
FT                   /transl_table=1
FT                   /translation="MGFSWLGFPKPARFHFYQFRFATNCPFIAFFMKQSRDGGAYIEDK
FT                   KRLYMGNGSKFTLKKEVRFSLWNGPWLTRYGRVQGLYGTVPFSCHLSLSIGMILLSLGV
FT                   LYL"
FT   CDS_pept        complement(707503..708222)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17445571"
FT                   /locus_tag="CAGL0K07205g"
FT                   /product="Similar to KLLA0B00495g Kluyveromyces lactis "
FT                   /protein_id="CAG61498.1"
FT                   /db_xref="HOGENOM:HBG123789"
FT                   /db_xref="UniParc:UPI00003B6CC0"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FMK7"
FT                   /transl_table=1
FT                   /translation="MLSETISKENQKILSSIVFKLFKSISEPLLEFLKDAMESLILLHT
FT                   NESQYPIFTLRSHVILKLISLHEKINKITKNFSNCENYEKLMRLISQTHKNLISIVSLL
FT                   SDQLSQYHIREEFSNSISVIFQQISSIFKSFNMFDDIVNQLYYHATATGGSDGSLFYVT
FT                   DPLLMDITQFNQFNDTLKNEIIMASSGFKEYLLIELNVFQLSKEKLLNHSMDTAITGDP
FT                   KFKDFLAKRRQRLNIPN"
FT   tRNA            join(710349..710385,710420..710456)
FT                   /gene_name="tRNA-Trp (CCA)"
FT   CDS_pept        complement(712294..714624)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17445572"
FT                   /locus_tag="CAGL0K07271g"
FT                   /product="Similar to uniprot|Q04233 Saccharomyces
FT                   cerevisiae YML006c"
FT                   /protein_id="CAG61499.1"
FT                   /db_xref="HOGENOM:HBG123790"
FT                   /db_xref="UniParc:UPI00003B6CC1"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FMK6"
FT                   /transl_table=1
FT                   /translation="MSKSVRVGDYYGNDENGVWSWYLSNLRSGDFEEIIENKLKYTLLK
FT                   RFLNSNLLGNFSPESPTRFINKKLIFVSIPEDVHQDISILELFLRDYFHLKVLDNNQIH
FT                   KLTQDKVYHHENHYFLMDELNNFEDPTFLEFGKSNWKMEGTAGTVYDPQNKENTTDALV
FT                   TEATAKIDHKISSSNTDDSRFDTLVNDTKDDSSSHEYNAMNLNEQDSITSSNNNDSLLS
FT                   SLSTGGEDSLNQELRRQSDHDESSSIIDQTNDNRKSYSNADTIRSKMIPSEGNISIDFD
FT                   QGTDRESTNVDNSNKRTGLDDDGASSIVLNFSHNRNAHKRKTKIDSLLGERYPSDFYTP
FT                   PQSELVSINSCGSAEDYTGQSLRLMVTKNGTDSKDEQPGDNPNRSKTSVNGHIASPLSD
FT                   IQNVSINEANMGGQNDQASFSDNESESMYSSDLESEDGEMDHYNASGSDITLLSILPSI
FT                   SIFDTLGYFRLVLQSILIQDPQTKEVFTAVRQSNNKPTIADITDDWLLYDAEFSMHNLQ
FT                   ILTLQDIMTIKKDYPKILFYTMVVINDRSEIACEFPYNGAQFTKAPSPITNKSHEVEKE
FT                   ELDQPTEVQAYFPGNGQAIKDSIKPNNRDSLTFDLCQAERTKSNMTTTHRSIRTVNSIG
FT                   DWSISRDTTGIATRAATNTSGQYDDHYQALKFDESSKERLIQGRKDGSGGKYSKHQISR
FT                   VNTNGSSMPLDSVERTKSLPLPTLLKTASGIETSHIETPSKWGFRSIKRHKNKHKSKGS
FT                   LTNGDKNRHRRTKKNENSACVLM"
FT   CDS_pept        complement(718797..720887)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000159459" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19350891"
FT                   /locus_tag="CAGL0K07293g"
FT                   /product="Strain CBS138 chromosome K complete sequence "
FT                   /function="catalytic activity"
FT                   /protein_id="CAG61500.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="HOGENOM:HBG266050"
FT                   /db_xref="HOGENOM:HBG721674"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="UniParc:UPI00003B6CC2"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FMK5"
FT                   /transl_table=1
FT                   /translation="MVQVSAIYGKAANEHETAPRVNALRARDGPLTRPLDSNASTVYEL
FT                   ALESFQKGGNRRGMGWREITEIHEEVKIIVKKIDGKNVPQEKTWLYYEMTPYRHNTYRE
FT                   LISIMHNLGRGMVKAGIKPNGENKLHIFASTSHKWMKMFLGAQSQNIPVVTAYDTLGER
FT                   GLIHSMLQTESNAVFTDNDLLTKLINPLKEAKDLKFLIHSETINPKDTRQNGKLYKNAK
FT                   EALAKIKEVRPDLTIISFDELLRLGKKSKHEIEPHPPKPEDLSCIMYTSGSTGDPKGVV
FT                   LTHANIVAGVGGVCHNVYGDVGQNDRIIAFLPLAHIFELAFELAAFYWNGILGYANVKT
FT                   LTNLSVRRCQGDMVEFKPTIMVGVAAVWETVRKGILAKLGELPAYTQKIFWTAYKSKVK
FT                   LDEAGLPGGGLISKLVFKKVKEATGGCLRIIMNGGSPISEDAQRFLTNVLCPMLIGYGL
FT                   TETVANATVLSLKAFKYGIAGDLSGAIQVKLVDAAELGYLAKDNQGEIWIKGAPVMSEY
FT                   FKNEEETKKALTEDGWFRTGDIGEWNEDGQLIIIDRKKNLVKTLNGEYIALEKLESLYR
FT                   SNKYVQNICVYADQTKVKPVGIVVGNMKPLEALANSLGLLTGEETIDSVLHDKKLAAAV
FT                   LKDMLATGKSQGLNGIELLQGIVFFDDEWTPQNGYVTSAQKLKRKEILEAVKDQVEAVY
FT                   KN"
FT   CDS_pept        722554..722829
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000196422" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17445573"
FT                   /locus_tag="CAGL0K07315g"
FT                   /product="Similar to uniprot|Q3E846 Saccharomyces
FT                   cerevisiae YMR244ca"
FT                   /function="cytochrome-c oxidase activity"
FT                   /cellular_component="mitochondrion"
FT                   /protein_id="CAG61501.1"
FT                   /db_xref="GO:0004129"
FT                   /db_xref="GO:0005739"
FT                   /db_xref="HOGENOM:HBG059027"
FT                   /db_xref="HOGENOM:HBG324232"
FT                   /db_xref="InterPro:IPR003213"
FT                   /db_xref="UniParc:UPI00003B6CC3"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FMK4"
FT                   /transl_table=1
FT                   /translation="MGLFSKEPKIENNRANRKKCWESRDKFFSCLDKNDILKPSDGVSK
FT                   CKAENQQYETDCVSSWVKYFNEKRIVDFKREQMLKQVEEQNAKLSK"
FT   CDS_pept        724973..725914
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248243" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17445574"
FT                   /locus_tag="CAGL0K07337g"
FT                   /product="Similar to uniprot|P25619 Saccharomyces
FT                   cerevisiae YCR021c HSP30"
FT                   /protein_id="CAG61502.1"
FT                   /db_xref="HOGENOM:HBG123791"
FT                   /db_xref="HOGENOM:HBG395442"
FT                   /db_xref="UniParc:UPI00003B6CC4"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FMK3"
FT                   /transl_table=1
FT                   /translation="MVDIFTDVIQNKGGNRAISVNPPHDLDFHITKRGSDWLWAVFACF
FT                   GLLMVVYIFLFFIAELKGSRITRYAIAPAFLIAMFEFFGYFTYASNLGWTGVQAEFNHV
FT                   TVDTPVTGLVPGVRQIFYSKFCAWFLSWPCLLFLIELAGIGTTLNPGEEISALDLIHSL
FT                   LVQMTGTLYWVVALLVGALIHSTYKWGYFTFGAAAMLVVQGIQVRRQFFVLKTRGFTAC
FT                   LLILSMLIVWAYFICWGVSEGGNKIQPDSEAIFYGILDLCIFGILPAYLVFITNHYGLW
FT                   PSFKLTKSGEQEMYPEKVEDPESVRASGETAI"
FT   CDS_pept        731078..732421
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000166089" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17445575"
FT                   /locus_tag="CAGL0K07392g"
FT                   /product="Strain CBS138 chromosome K complete sequence "
FT                   /function="cation transmembrane transporter activity "
FT                   /cellular_component="membrane"
FT                   /protein_id="CAG61505.1"
FT                   /db_xref="GO:0008324"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG317426"
FT                   /db_xref="HOGENOM:HBG410552"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="UniParc:UPI00003B6CC5"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FMK2"
FT                   /transl_table=1
FT                   /translation="MLSGKEIRIGALLTLDTVFFVIEITIGYMSHSLALIADSFHMLND
FT                   IFSLLVALWAVSVAKNRGPDAKYTYGWKRAEILGALVNAVFLIALCFSIFIEALQRLIE
FT                   VQEIQNPKLVLIVGCAGLASNIVGLFLFHDDGHGHGHSHGGLGSDIEAGESHGHDHGHS
FT                   HGHDHSHQEEINAGLDPNCPAHRSDEELEEEDTESDGNGFYNNNIGDILTQTAMTRLAT
FT                   ENTSLLADSDEAAKKKAEAKKKSQKSLNMHGVFLHVLGDALGNVGVIVAALFIWKTDYS
FT                   WRHYSDPVVSLLITAIIFSSALPLSRRASRILLQATPSTISADEVQREILAVPGVKAVH
FT                   DFHIWNLTESIYIASIHVEIDCAADKFESSARKIRRIFRQHGINSATVQPEFIRDDVSP
FT                   DERRRFSMIAGGSEELPPEPLNPDHLKSSRYGTLSASNISEDAIADDN"
FT   CDS_pept        734423..734950
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000211377" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17445576"
FT                   /locus_tag="CAGL0K07414g"
FT                   /product="Strain CBS138 chromosome K complete sequence "
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="CAG61506.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG319315"
FT                   /db_xref="HOGENOM:HBG387981"
FT                   /db_xref="InterPro:IPR002670"
FT                   /db_xref="InterPro:IPR021138"
FT                   /db_xref="UniParc:UPI00003B6CC6"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FMK1"
FT                   /transl_table=1
FT                   /translation="MKIVAHLREYQVIGRRLPTESVPEPKLFRMRIFAPNEVVAKSRYW
FT                   YFLQKLHKVKKASGEVVSINQIHEAHPTKVKNFGVWVRYDSRSGTHNMYKEIRDVSRVA
FT                   AVETLYQDMAARHRARFRSIHILKVAEIEKTADVKRQYVKQFLSKDLKFPLPHRVQKST
FT                   KTFAYKRPSTFY"
FT   CDS_pept        complement(735325..736248)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000159483" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17445577"
FT                   /locus_tag="CAGL0K07436g"
FT                   /product="Similar to uniprot|Q04013 Saccharomyces
FT                   cerevisiae YMR241w"
FT                   /function="binding"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAG61507.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG055469"
FT                   /db_xref="HOGENOM:HBG330351"
FT                   /db_xref="InterPro:IPR001993"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="UniParc:UPI00003B6CC7"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FMK0"
FT                   /transl_table=1
FT                   /translation="MAQTIEKKPVSFSNILLGAGLNLSEVTTLGQPLEVVKTTMAAHRE
FT                   FNFLQATKHVWSRGGIFGFYQGLIPWAWIEASTKGAVLLFVSAEAEYRFKVLGLNNFGA
FT                   GIMGGITGGVTQAYLTMGFCTCMKTVEITRQKAANVPGVIPQSSWQVFKSIYKKEGIRG
FT                   INKGVNAVAIRQMTNWGSRFGLSRLVEDGIRKLTGKTGKDDKLTALEKIMASAIGGGLS
FT                   AWNQPIEVIRVEMQSKKEDPNRPKNLTVGKTFKYIYQSNGLKGLYRGVTPRVGLGIWQT
FT                   VFMVGFGDMAREFVAKLTGEKPAAKH"
FT   CDS_pept        complement(737165..739279)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000233033" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17445578"
FT                   /locus_tag="CAGL0K07458g"
FT                   /product="Strain CBS138 chromosome K complete sequence "
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="CAG61508.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG330930"
FT                   /db_xref="HOGENOM:HBG537393"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR000961"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="InterPro:IPR017892"
FT                   /db_xref="UniParc:UPI00003B6CC8"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FMJ9"
FT                   /transl_table=1
FT                   /translation="MYGWKLHRFKFGRGKDDDSRKKKMIISSSQSSLNSADTAAGDSIF
FT                   SRPSVERRDTVTAANGSIAPVRVSQDSYMSYFKESNENMSKFDLPSWLRSHKDSFSPFN
FT                   SSSNSSSNLGSNRDSSMTDVTELLNDTAFKSTPFDRIDENMHSGLLTVKVYSGSNFTMP
FT                   VPITSDQGILHNLLNSSISSLEGDNNTYAEMEQLITQLSQVHLANQTSEEQLISNAFSS
FT                   TFIPAVIKVPGHDDYPLIYMTVEYDNTMATIYPEGGTISKPVFNKISTFDVTRKLPFLK
FT                   CSVFIKIPSALLPSMRWQQEAALADPNMRSILETIHAGKEIFLDSFTLPVVLDMNSASN
FT                   FRLFNHQWINLKQGLGTINLTVDFKPSYSKPVGIDDFELLTVLGKGSYGKVMQVRKKDT
FT                   QKIYALKAIRKSYIVAKSEVIHTLAERTILARVECPFIVPLKFTFQTPEKLYLVLACIN
FT                   GGELFHHLQREGIFDISRARFYASELLLALDSLHKMDVVYRDLKPENILLDSQGHIALC
FT                   DFGLCKLNMKDNEKTSTFCGTPEYLAPEVLLGKGYTKVVDWWTLGVLLYEMLTGLPPYY
FT                   DENVSEMYKKILKSPLIFPDGMDPDAKDLLKRLLNRDPNRRLGANGADEIKNHKFFNDL
FT                   IWDSIWNKEYLPPFRPDVQNANDTSNFDNEFTKQKPVDSVIDEYLSESVQNQFKGWSYL
FT                   GSEQLGSSMA"
FT   CDS_pept        complement(740462..742165)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000009550" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17445579"
FT                   /locus_tag="CAGL0K07480g"
FT                   /product="Similar to uniprot|P37012 Saccharomyces
FT                   cerevisiae YMR105c PGM2 phosphoglucomutase "
FT                   /function="intramolecular transferase activity,
FT                   phosphotransferases"
FT                   /function="magnesium ion binding"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /protein_id="CAG61509.1"
FT                   /db_xref="GO:0000287"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="GO:0016868"
FT                   /db_xref="HOGENOM:HBG009334"
FT                   /db_xref="HOGENOM:HBG286308"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="UniParc:UPI00003B6CC9"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FMJ8"
FT                   /transl_table=1
FT                   /translation="MQVETVPTKPYQDQKPGTSGLRKKTKVFMEEPNYTENFIQAIMDA
FT                   IPEGAKDAVLVVGGDGRFYNDVIMQKIAAIGAANGVRKLIIGQNGLLSTPAASHVIRSY
FT                   AEKCTGGIILTASHNPGGPENDLGIKYNLANGGPAPEPVTNKMWEVSKQLTHYKIIKDF
FT                   PQVDFSKIGKDQQYGPLLVDIIDTTEDYVKFMKEIFDFKLIKEFIHKQREAKNWKLLFD
FT                   SLNGITGPYGKAIFVDEFDLPADEVLQNWHPQPDFGGLHPDPNLTYAHTLVERVDREKI
FT                   EFGAASDGDGDRNMIYGAGPAFVSPGDSVAIIAEYAKEIPYFQKQGIYGLARSFPTSGA
FT                   IDRVAKAQGLNCYEVPTGWKFFCALFDAKKLSICGEESFGTGSNHIREKDGVWAICAWL
FT                   NILALYNKHNPEKEASIKTIQEEFWAKYGRTFFTRYDYEGITTEKANKVVDLLDKFVND
FT                   PKSKNAPFPGDESLTVSDCGDFSYTDLDGSVSDHQGLFVKLSNGARFVLRLSGTGSAGA
FT                   TIRLYIEEYSDDKSTYTQSADQYLQKMIKSVTSFLNFKELIGTDEPTVRT"
FT   CDS_pept        742349..742990
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17445580"
FT                   /locus_tag="CAGL0K07502g"
FT                   /product="Similarity possibly noncoding "
FT                   /protein_id="CAG61510.1"
FT                   /db_xref="HOGENOM:HBG123794"
FT                   /db_xref="UniParc:UPI00003B6CCA"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FMJ7"
FT                   /transl_table=1
FT                   /translation="MEVIHSVIAPALYSLLVSLPPLFVQSLPSTPQPHSLRHPFVAPLP
FT                   SPSRFTANSWSFSPFLLFSFSFSFSPPCPCPSNYRLPRKNSPYKLEGSPPPLTLCLWSL
FT                   YTVTVAPRTYYVNLDLSRLLALQSLRVLLIQRCGPPTNFTKHSVLHYTLHHIISTCIAI
FT                   SMSSRVLGYNTWLLFPFVLATSNKHVGSELQRMCLPSSLRNYRTMEGEVG"
FT   CDS_pept        743156..744133
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000185073" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20197720"
FT                   /locus_tag="CAGL0K07524g"
FT                   /product="Similar to uniprot|P36069 Saccharomyces
FT                   cerevisiae YKL128c suppressor of TPS2 mutant "
FT                   /protein_id="CAG61511.1"
FT                   /db_xref="HOGENOM:HBG059067"
FT                   /db_xref="HOGENOM:HBG202415"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="UniParc:UPI00003B6CCB"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FMJ6"
FT                   /transl_table=1
FT                   /translation="MILHRLLLLLNLDWNREVEMTVQDLDVRALPGYFKGYSARDTPET
FT                   RHNATELDFLAFDDQFTTWKQLYQAIPKDTDTHSYKLLVLARHGEGYHNAAEARYGEKA
FT                   WNEYWSKLEGDQYGSWLDAELTPLGKKQALEAGQTYLTNLTDGLQLLPHKFFVSPMRRC
FT                   LDTYIREWEPVFSTHRPSNATVNVKVIEYLRETLGVHTCDERVSHSQALSEYQDHRYNN
FT                   SDVTVHFDYPGNYSEKDQLWYPDHRETKAEMDRRTRIGLREMFSSVNTTDKVISLTCHS
FT                   GVIASVLRNIKHPAIDHLQTGKLVYAVVELSKAPTDDQPMLVVS"
FT   CDS_pept        745201..746172
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000185073" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21046543"
FT                   /locus_tag="CAGL0K07546g"
FT                   /product="Similar to uniprot|P36069 Saccharomyces
FT                   cerevisiae YKL128c suppressor of TPS2 mutant "
FT                   /protein_id="CAG61512.1"
FT                   /db_xref="HOGENOM:HBG059067"
FT                   /db_xref="HOGENOM:HBG202415"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="UniParc:UPI00003B6CCC"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FMJ5"
FT                   /transl_table=1
FT                   /translation="MILHKLLLLLNLDWNPDNTAKDLEFTAMPGYFKGYTVQDTPDSKI
FT                   NATAIDFLQFDDRFSNWQQLYQSIPNDTETHSYKLVILARHGQGYHNVAYDKYGEKAWY
FT                   DYWSRLNGDQDGNWFDAELTPLGKKQALETGNTYLTNMTDGLQRLPDKFFVSPLRRCLD
FT                   TCIREWEPIFAKHKPANSTVHVKVLEYMRETLGIDTSNERVVHSQALAEYQNHRYNTSD
FT                   VTVHFDYPEDYSERDQLWQPNHLETNDEIDRRTKIGLREMFSSVNTTDKVISLTAHHDV
FT                   IESILRNIKHPTIDDLETGKLVYTVIDVSKVPADDQSVIVVS"
FT   CDS_pept        747658..748629
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000185073" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17445581"
FT                   /locus_tag="CAGL0K07568g"
FT                   /product="Similar to uniprot|P36069 Saccharomyces
FT                   cerevisiae YKL128c suppressor of TPS2 mutant "
FT                   /protein_id="CAG61513.1"
FT                   /db_xref="HOGENOM:HBG059067"
FT                   /db_xref="HOGENOM:HBG202415"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="UniParc:UPI00003B6CCD"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FMJ4"
FT                   /transl_table=1
FT                   /translation="MILHKLLLLLNLDWNPDNTAQDLDFRALPGYFKGYTVQDTPDTKI
FT                   NATIFDFLALDDRFSNWQQMYQAIPNDTETHSYKLVILARHGQGYHNIGYDRYGEKAWY
FT                   DYWARLDGDQYGNWFDSELTPLGKKQALEAGQTYLTNLTDGLQRLPDKFFVSPLRRCLD
FT                   TCIREWEPIFAKHKPANSTVHVKVIEYLRETLGIDKSNERVDHSQALAEYQDHKYNTSD
FT                   VTVHFDYPDDYAEKDQLWQPEHLETYPELDRRIKVGLREVFSSVNATDRVLSLTVHSDV
FT                   IESILRNIKHPALVGLQTGKVIYTVVETTKKPADDQSILVVS"
FT   CDS_pept        749181..752939
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000260265" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17445582"
FT                   /gene_name="MYO3"
FT                   /locus_tag="CAGL0K07590g"
FT                   /product="Myosin-3"
FT                   /function="ATP binding"
FT                   /function="actin binding"
FT                   /function="motor activity"
FT                   /cellular_component="actin cortical patch"
FT                   /cellular_component="myosin complex"
FT                   /protein_id="CAG61514.1"
FT                   /db_xref="GO:0003774"
FT                   /db_xref="GO:0003779"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0016459"
FT                   /db_xref="GO:0030479"
FT                   /db_xref="HOGENOM:HBG501769"
FT                   /db_xref="HOGENOM:HBG717149"
FT                   /db_xref="HSSP:1MND"
FT                   /db_xref="InterPro:IPR001452"
FT                   /db_xref="InterPro:IPR001609"
FT                   /db_xref="InterPro:IPR010926"
FT                   /db_xref="UniParc:UPI00003B6CCE"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FMJ3"
FT                   /transl_table=1
FT                   /translation="MAIIKRVVRSKAGQAPVKKGAKIKKASYDSSRKKEVGVSDLTLLS
FT                   KISDESINDNLKKRFEHGIIYTYIGYVLISVNPFRDLGIYTDDTMKSYQGKNRLEAPPH
FT                   VFAIAENMYYNLKSYNENQCVIISGESGAGKTEAAKRIMQYIAATSSTHSESISKIKDM
FT                   VLATNPLLESFGCAKTLRNNNSSRHGKYLEIKFDAHFQPCAGHITNYLLEKQRVVGQIK
FT                   NERNFHIFYQFTKGAPEEYRQLFGVQQPEQYIYTSASQCTAVENMDDVEEFNETLNAMR
FT                   TIGLTKSEQDQIFRALAAILWIGNISFVENEAGNAEIRDKSVTTFVAYLLEVQEELLIK
FT                   ALIERIIETTHGAKRGSTYHSPLNIIQATAVRDALAKAIYNNLFEWIVERVNNSLQAFP
FT                   GADKSIGILDIYGFEIFEHNSFEQICINYVNEKLQQIFIQLTLKSEQDTYKKEQIHWTP
FT                   IEYFDNKIVCDLIEAKRPPGIFAAMNDAIATAHADSDAADQAFAQRLNLFTTNPHFELR
FT                   QNKFVVKHYAGDVTYDIFGITDKNKDQLQKDLVELLSTTSNSFVREIFPDQPQTDSRRR
FT                   PPTSGDKIIKSANELVETLSKAQPSYIRTIKPNDTKSSTIYDDQRVLHQIKYLGLKENV
FT                   RIRRAGFAHRQVFEKFVERFYLLSPQCSYAGDYVWDGETLDAVKLILQDASIPTTEYEI
FT                   GVTQIFIKHPETLFALENMRDKYWYNMAARIQRAWRRYLQKRIDAAIRIQNAIRGKSGV
FT                   STFRNDELRNAGDKVYGGKKERRNMSLLGLRGFYGDYLSCNESKTRGSYIKRQANITER
FT                   VLFSSHGNSLHAMYGGASQRLRKTFILTPTSLWIVGHTKARNAMKYITDYRIDLGKIRS
FT                   ISVTNLQDDWMAVNLMDSPKPDPLINLPFKTELITRLTQLNPRIHVKVSSTIEYLRGPK
FT                   KLFVVKSQYSDSAPKYHDLYRNGTILVRHGNPPDSTAENRPAFNNEDMYGNLMEAKHKT
FT                   MKKKVGTKRTPQALPTSSLAASAAQAAYHPKGIRSPTSTEQKSPSKSKPITKTRKPPVS
FT                   SPVRNTSKTISNSKVYSAPKASVTKRTQDTVSVSKTSVKDDVTQEKNAIIQTEEKQNYS
FT                   LPENIPQSSQTDSYQAAYDFPGSGNPSELPLQKGDIIYVSKSDPSGWSLASTLDNSKEG
FT                   WVPTSYIVKYNGNVTDPSAQHQDMNTMKIQEDNTTSINEPETHTNQGPSNTDLGANLAS
FT                   VLAARANKLRSESEEDISREEDDDDDW"
FT   CDS_pept        753402..754136
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000066092" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17445583"
FT                   /locus_tag="CAGL0K07612g"
FT                   /product="Strain CBS138 chromosome K complete sequence "
FT                   /protein_id="CAG61515.1"
FT                   /db_xref="HOGENOM:HBG059052"
FT                   /db_xref="HOGENOM:HBG202414"
FT                   /db_xref="UniParc:UPI00003B6CCF"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FMJ2"
FT                   /transl_table=1
FT                   /translation="MSREEQPYIVATDGIVDALTKISSVFSAYLSANIHILNKYINYLR
FT                   RVTSLKNERSIMIKIVKKLRFFNDTLLSTDLAQLQTTYEGEEPELALNIQTFASYLVKC
FT                   LETIDLLNYFLLKPLQKELIAKTLNFDLVFPEDITDTVEDTYNHFVKFTQWSIESLSID
FT                   DPLLDIEVVQFSLRCAEEDQSYAEETDNIFLQEVLPVKDSQEYETLTLQWLDVLNGKLA
FT                   ILGERFEKVADDWYKKFGKNRS"
FT   CDS_pept        complement(754675..756054)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17445584"
FT                   /locus_tag="CAGL0K07634g"
FT                   /product="Strain CBS138 chromosome K complete sequence "
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="sequence-specific DNA binding"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /protein_id="CAG61516.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0043565"
FT                   /db_xref="HOGENOM:HBG123796"
FT                   /db_xref="InterPro:IPR000679"
FT                   /db_xref="InterPro:IPR013088"
FT                   /db_xref="UniParc:UPI00003B6CD0"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FMJ1"
FT                   /transl_table=1
FT                   /translation="MMYDISATSQFKQSALYKHNKQMSDQIKFDFNNFQFKNNQQLQNR
FT                   DLMNDHYDNTFANKTSMQTSFVGHAFNPSFQFDTIDFDDKGTFFDINKAQNPKNRILAM
FT                   LENESRSNTATIDSNFQAGVSNSLNIDLLDDPFKVDEQITRSDDIFPNLPFPFSTEDSN
FT                   IITPSFESRSTSNDSNFEIVDVTTPVVSRSSNFSNADNIPMPKEFDIKHLHPTIPPKTK
FT                   EPTSKRQIKVKKEKTPVCVETAKPSDADNNKEDLICTNCGTTNTPLWRKDIDRKPLCNA
FT                   CGLFFKLHGVMRPLSLKTDVIKKRKRTAKIKTNRHVTGKINLRDRKRKSNPSKKDNKKS
FT                   ITKRQQPSNSKSSIGSKSTALFKSDKCSSSGCNETADLTTPGSESTSVSSTETIFDNSQ
FT                   SISLSSSSTDLKDSNHGFLPSNWSDFQSSDGDLPNFSVDFEFGVVDDHNSIYPLPVFQY
FT                   E"
FT   CDS_pept        762217..763710
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000230294" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21046544"
FT                   /locus_tag="CAGL0K07656g"
FT                   /product="Strain CBS138 chromosome K complete sequence "
FT                   /function="ATP binding"
FT                   /function="phenylalanine-tRNA ligase activity"
FT                   /function="tRNA binding"
FT                   /biological_process="phenylalanyl-tRNA aminoacylation "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAG61517.1"
FT                   /db_xref="GO:0000049"
FT                   /db_xref="GO:0004826"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006432"
FT                   /db_xref="HOGENOM:HBG236716"
FT                   /db_xref="HOGENOM:HBG497668"
FT                   /db_xref="InterPro:IPR002319"
FT                   /db_xref="InterPro:IPR004529"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="UniParc:UPI00003B6CD1"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FMJ0"
FT                   /transl_table=1
FT                   /translation="MSDFQLDILKKLNELGEIKSTLQVFADKDSQDVLSALNSLKAHSK
FT                   LNYTKHDTILYDLSTEGQDILNNGSHEMKLLKLIKEVGNLKISDVNAKLGKDGKLGQAR
FT                   AFKNGWIKKNENNELEVNEKGKNDVEDTTQVELKAIVEGKADSLDKNVVNDLKKRKLIT
FT                   PKKLTDFEVVKGAEFSLEIKKLETDITSDMVVTGSYKDLEFKPYNFNSQGLEVQSGALH
FT                   PLSKVREEFRQIFFSMGFTEMPTNQYVETGFWNFDALYVPQQHPARDLQDTFYIKDPLT
FT                   SDLPDDKEYLNNIKAVHEGGKFDTIGYRYPWKQEESQKLVLRTHTTAISAAMLHKLAKD
FT                   PKPTRLFSIDRVFRNEAVDATHLAEFHQVEGVLADYNITLGDLIKFMEDFFAKMGVTGL
FT                   KFKPTYNPYTEPSMEIFSWHEGLGKWVEIGNSGMFRPEMLEPMGLPRDLRVLGWGLSLE
FT                   RPTMIKYKVQNIRELLGHKVSLDFIENNPAARLDEDLYD"
FT   CDS_pept        complement(764196..764843)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17445585"
FT                   /locus_tag="CAGL0K07678g"
FT                   /product="Similarity"
FT                   /protein_id="CAG61518.1"
FT                   /db_xref="HOGENOM:HBG123797"
FT                   /db_xref="UniParc:UPI00003B6CD2"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FMI9"
FT                   /transl_table=1
FT                   /translation="MEHIPSYDMGRDAWRSTLEELRTDNHYEDYTEMNQFNDNYFQFVN
FT                   TSEIEQEFKFDWNELELENGKKKIRFTDDDINHYTVTHRSGKDDSSLNNHQRGVENDQN
FT                   VERNINRSGNNAGSSEYVPLAEEQQPDSPVSFETAAIERNLQFEFDNNYVNDIVLALRR
FT                   LKEVRARLQNLVRNVDNAISIDKSPNFDGLPDDVEINAVKSSLLSFLADGNN"
FT   CDS_pept        complement(766120..768867)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17445586"
FT                   /locus_tag="CAGL0K07700g"
FT                   /product="Similar to uniprot|P43573 Saccharomyces
FT                   cerevisiae YFL023w"
FT                   /function="unfolded protein binding"
FT                   /biological_process="protein folding"
FT                   /cellular_component="prefoldin complex"
FT                   /protein_id="CAG61519.1"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="GO:0016272"
FT                   /db_xref="GO:0051082"
FT                   /db_xref="HOGENOM:HBG123798"
FT                   /db_xref="InterPro:IPR004127"
FT                   /db_xref="InterPro:IPR009053"
FT                   /db_xref="UniParc:UPI00003B6CD3"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FMI8"
FT                   /transl_table=1
FT                   /translation="MESLLESVQETNAGLKSKRDFLEEQREQYVNIRQHLIELPSRQTT
FT                   EAEISSNKGQVTGLVLGDVIISKMTNEMEGIESYRLFVNIGCEYYVEKDKIYTTRYIEE
FT                   KISLIEDAISKFNEKIQEANTTEKHLKEAIAFEKKENDQKFIHSKQETSSIGYNEDTDD
FT                   IYEPMEIREELDEEGNVISGTVTPAATDKQASEIRDKLLDVGNAQNIKKLPNNRIEEIS
FT                   EDNSDNQTDKDSDFYNNLKGKLVHTGSLNSSKQEKVINEKSSDEVPNKQHTQRISTDEI
FT                   YSFADLVEQLDKDDIEEGDNSLNELDFDEKAMDSWEINGDSPENYEDDEDEGYYYDEDE
FT                   EEDEEEDGDMSYSGFGVAASVLPTNARSSFMDQIMKLRGLKDDTAADTDKSSSIKKSAI
FT                   QSNDDTNSNRQLSGTKHHQTAVTKSILKKGGKQKAKKNVGFSKDLQIHEVESFKMENKK
FT                   QRHVFNPANLFDPESYGAETEEKLDDPSSTADFDSDLFAELIGAKEADVLHEKYEEEIN
FT                   ENNRKQQEEKKANRVSRFKATRQSKSKTSFKTAETGDTTNVNKPTEYTKKDLLESYHAE
FT                   SISPSTKKHSSITASNYNKHDSGYVPKKASPDKAVIQEVEDEVVERAVEDEVVERAVED
FT                   EVVERAVEDEIVERVVEDEVVERVVEDEVVERVVEDEVVERAVEDEVFERTVEDEVVER
FT                   AVDEQIVNESISLDDDNAPANSQNTKERKVPVIPKELSRYIEKGEGGDKFPKAKIDYQS
FT                   LNENLDDMAMAYSMGLYDDDVDDPGVVLEHLNDFKQYNEQVKELESEIAEFKINNPMLS
FT                   EDNEEDDDGPIMTDIQEKDIPESYGQDDNGDDYSLSQDQLAQSVAIEYRNMKEKLVNKM
FT                   RSDVSAIDPQTEEMKQIEPIDEHGNPVKQSRFRSQRKAIDKLIR"
FT   tRNA            769505..769586
FT                   /gene_name="tRNA-Ser (TGA)"
FT   CDS_pept        complement(769801..770490)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000174302" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20197721"
FT                   /locus_tag="CAGL0K07744g"
FT                   /product="Strain CBS138 chromosome K complete sequence "
FT                   /function="hydrolase activity"
FT                   /protein_id="CAG61520.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG344655"
FT                   /db_xref="HOGENOM:HBG446368"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="UniParc:UPI00003B6CD4"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FMI7"
FT                   /transl_table=1
FT                   /translation="MFGRRVAISGHRFLSRMISAKGKPEAAKIVQKSQVKDTSECKWIG
FT                   LEKITYKDPNGNERVWDSAVRMTRSTGEIDGIGILAILKFPDGKPDEIVLQKQFRPPVE
FT                   GVCIEMPAGLIDANEDIDTAALRELREETGYIGKIVNKSPVIFNDPGFTNTNLCLVTAE
FT                   IDMSLPENQNPVTELEENEFIECFSVPLKEFPEKMIELDSQGYKLDARVQNVAQGIILA
FT                   NQFNISQ"
FT   CDS_pept        join(770866..771088,771233..771312)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000093977" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21046545"
FT                   /gene_name="SUS1"
FT                   /locus_tag="CAGL0K07755g"
FT                   /product="Protein SUS1"
FT                   /biological_process="chromatin modification"
FT                   /biological_process="mRNA transport"
FT                   /biological_process="protein transport"
FT                   /biological_process="regulation of transcription "
FT                   /biological_process="transcription"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="nuclear pore"
FT                   /cellular_component="nucleoplasm"
FT                   /protein_id="CAR58054.1"
FT                   /db_xref="GO:0005643"
FT                   /db_xref="GO:0005654"
FT                   /db_xref="GO:0006350"
FT                   /db_xref="GO:0015031"
FT                   /db_xref="GO:0016568"
FT                   /db_xref="GO:0045449"
FT                   /db_xref="GO:0051028"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG396842"
FT                   /db_xref="InterPro:IPR018783"
FT                   /db_xref="UniParc:UPI00017BD8F2"
FT                   /db_xref="UniProtKB/Swiss-Prot:B4UN38"
FT                   /transl_table=1
FT                   /translation="MTISSNENSASLRAQIQQCLVESGNYEAISNELTERLLKDGWLDE
FT                   VKKLAREEISQEDSPNFSKALSQIEPQALDLVQQSTKDAIMRKITAFLEEIVETE"
FT   CDS_pept        771764..774256
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000179829" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21046546"
FT                   /locus_tag="CAGL0K07766g"
FT                   /product="Similar to uniprot|P31244 Saccharomyces
FT                   cerevisiae YBR114w RAD16 DNA repair protein "
FT                   /function="ATP binding"
FT                   /function="DNA binding"
FT                   /function="helicase activity"
FT                   /function="zinc ion binding"
FT                   /protein_id="CAG61521.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0004386"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG060995"
FT                   /db_xref="HOGENOM:HBG522881"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="InterPro:IPR017907"
FT                   /db_xref="InterPro:IPR018957"
FT                   /db_xref="UniParc:UPI00003B6CD5"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FMI6"
FT                   /transl_table=1
FT                   /translation="MEEGGFIRRTRSRVGRAKQKKVSYVEVSSSEDEQSTLTSVSGGRK
FT                   DSSESTVVGSSADDPIDLDYEEEEDEEFVDAEEEVANHDAEDDTAAEMRTAKVKRGKRS
FT                   RRLKPTLMVDLSKVEFDEDGHARMKKEEPDNALPDVPDEPNIPEIKEDDEDDQPLSKKR
FT                   KTTAKKSRKKKEPKIKLTPYQRTTLRLFEHHPELANVFPDLQNAPKYEPHRAPQPADMG
FT                   VKLLPFQLEGLHWMLSQEDSIYNGGVLADEMGMGKTIQTIALLMNDRSKKPSLVVAPTV
FT                   ALMQWKNEIEQHTNGALSTYIYHGASRTINIHDLKDIDVILTTYSVLESVFRKQNYGFR
FT                   RKNGLVKEKSLLHNIDFYRAILDEAHNIKDRTSNTSRAVNALKTQKRWCLSGTPLQNRI
FT                   GEMYSLIRFLDINPFAKYFCTKCECASKEWKFSDNMHCDSCGHVLMQHTNFFNHFMLKN
FT                   IQKFGVEGPGLESFNNIQTLLKNVMLRRTKVERADDLGLPPRVVTVRKDYFSEEEKDLY
FT                   RSLYTDSQRKYNSFVEKGVVLNNYANIFSLITRMRQLADHPDLVLKRFHDDNAAGVIVC
FT                   QLCNDEAEEPIESKCHHKFCRLCIREYVESYIESSGSNLTCPVCHIGLSIDLSQPSLEV
FT                   DLESFKKQSIVSRLNMKGTWRSSTKIEALVEELYKLRSPVKTVKSIVFSQFTSMLDLVE
FT                   WRLKRAGFQTVKLQGSMSPTQRDQTIKYFMDNIECEVFLVSLKAGGVALNLCEASQVFI
FT                   LDPWWNPSVEWQSGDRVHRIGQYRPVKITRFCIEDSIEARIIELQEKKANMIHATINQD
FT                   EAAINRLTPADLQFLFNN"
FT   CDS_pept        complement(774352..778476)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000191209" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17445587"
FT                   /gene_name="LYS2"
FT                   /locus_tag="CAGL0K07788g"
FT                   /product="L-aminoadipate-semialdehyde dehydrogenase large
FT                   subunit"
FT                   /EC_number="1.2.1.31"
FT                   /function="L-aminoadipate-semialdehyde dehydrogenase
FT                   activity"
FT                   /function="acyl carrier activity"
FT                   /function="cofactor binding"
FT                   /function="ligase activity"
FT                   /function="phosphopantetheine binding"
FT                   /biological_process="lysine biosynthetic process "
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAG61522.1"
FT                   /db_xref="GO:0000036"
FT                   /db_xref="GO:0004043"
FT                   /db_xref="GO:0009085"
FT                   /db_xref="GO:0016874"
FT                   /db_xref="GO:0031177"
FT                   /db_xref="GO:0048037"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG058757"
FT                   /db_xref="HOGENOM:HBG324699"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR006163"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR010071"
FT                   /db_xref="InterPro:IPR010080"
FT                   /db_xref="InterPro:IPR013120"
FT                   /db_xref="InterPro:IPR014397"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="UniParc:UPI00003B6CD6"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FMI5"
FT                   /transl_table=1
FT                   /translation="MSWKERLDNPTLSVWPHDYLRPHAEPFVEQGTYSISIPQLSGDYA
FT                   TLLAAWTALLYRVTGDDDIVLYVRDNKVLRFTITPELTFTQLQNKINEQLAELANVEGT
FT                   NFDALSESLQKESGLERPPQLFRIACVTEDLQLDRYTHSPLDIGLQLHESSSDVSIVFN
FT                   KLLFSQDRITILADQLTLFLTSVLQNAKQVFTKVSLITDSSTSILPDPKANLDWCGFVG
FT                   CIHDIFQDNAEKFPERTCVVETPPINSTKTRTFTYKDINEASNIVAHYLINTGIKRGDV
FT                   VMIYSSRGVDLMVCVMGVLKAGATFSVIDPAYPPARQTIYLGVAKPKGLIVIRAAGQLD
FT                   QLVEDYITKELDLVSRIPSIAIQDNGTVEGGSLPSESGDVLASYTELKSTRTGVVVGPD
FT                   SNPTLSFTSGSEGIPKGVLGRHFSLAYYFSWMAKQFNLSENDKFTMLSGIAHDPIQRDM
FT                   FTPLFLGAQLYVPTQDDIGTPGRLAEWMGKYGCTVTHLTPAMGQLLTAQAVTPFPKLHH
FT                   AFFVGDILTKRDCLRLQTLAENCCIVNMYGTTETQRAVSYFEVTSRSQDPHFLKKLKDV
FT                   MPAGRGMKNVQLLVVNRNDRTQVCGVGEIGEIYVRAGGLAEGYRGLPDLNKEKFVNNWF
FT                   VEEGHWNYLDKDLEAPWKEFWQGPRDRLYRTGDLGRYLPNGDCECCGRADDQVKIRGFR
FT                   IELGEIDTNISQHPLVRENITLVRNNLEGEKCLVTYMVPRFDKPELENFKIEVPSNISD
FT                   DPVVCGLIGYSPFTKDLKAFLKKRLASYAIPSLIIVLPKLPLNPNGKVDKPKLQFPTVK
FT                   QLELVAKNSSIDINDSEFNQQEREIRDLWLECLPTKPTSISPEDSFFDLGGHSILATKM
FT                   IFTVKKQLNVELPLGTIFKYPTIKAFAAEVSRLKSTDKIEEETTALTADYASDAASLID
FT                   TLPKSYPAARALGSPSEMAGPTTVNIFVTGVTGFLGSFILSDILNRTVTGVNFKIFAHV
FT                   RAADETSGLDRIRKAGTVYGTWKEEYANSLQVVIGDLSKKNFGLTDDKWSHLSETIDII
FT                   IHNGALVHWVYPYSKLRNANVVSTINIMNLASEGKPKLFNFVSSTSVLDTNHYFELSDK
FT                   LQQSGKEGIPESDDLMGSSLGLTSGYGQSKWAAEHIIRAAGKRGLRGSIIRPGYVTGAS
FT                   YNGSSNTDDFLLRFLKSAVQLGKIPDINNTVNMVPVDQVARVVVAASINPPCGDDLCVV
FT                   HVNAHPRIIFKDYLYELKNYGYDVEIENYEQWKKTLEEAVIERSEDNALFPLLHMVLGD
FT                   LEDSTKAPELDDKNAITSLRADIEWTNEDRTKGMGATPEQIGIYISFLESVGFLPHPKH
FT                   FGDKALPNIKISEQQKELVASGAGARSSSAA"
FT   CDS_pept        780678..782054
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000229291" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17445588"
FT                   /locus_tag="CAGL0K07832g"
FT                   /product="Strain CBS138 chromosome D complete sequence "
FT                   /function="GTP binding"
FT                   /function="GTPase activity"
FT                   /function="translation elongation factor activity "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAG61524.1"
FT                   /db_xref="GO:0003746"
FT                   /db_xref="GO:0003924"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="HOGENOM:HBG307581"
FT                   /db_xref="HOGENOM:HBG491630"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004539"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="UniParc:UPI00003B60E0"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FMI3"
FT                   /transl_table=1
FT                   /translation="MGKDKQHVNVVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEKE
FT                   AAELGKGSFKYAWVLDKLKAERERGITIDIALWKFETPKYHVTVIDAPGHRDFIKNMIT
FT                   GTSQADCAILIIAGGVGEFEAGISKDGQTREHALLAFTLGVRQLIVAVNKMDSVKWDES
FT                   RFAEIVKETSNFIKKVGYNPKTVPFVPISGWNGDNMIEATTNASWYKGWEKETKAGVVK
FT                   GKTLLEAIDAIEPPTRPTDKPLRLPLQDVYKIGGIGTVPVGRVETGVIKPGMVVTFAPA
FT                   GVTTEVKSVEMHHEQLTEGLPGDNVGFNVKNVSVKEIRRGNVCGDSKNDPPKAAASFNA
FT                   TVIVLNHPGQISAGYSPVLDCHTAHIACKFEELLEKNDRRSGKKLEDSPKFLKSGDAAL
FT                   VKFVPSKPMCVEAFSDYPPLGRFAVRDMRQTVAVGVIKSVDKTDKAGKVTKAAQKAAKK
FT                   "
FT   CDS_pept        complement(782350..782778)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000198385" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17445589"
FT                   /gene_name="DIB1"
FT                   /locus_tag="CAGL0K07854g"
FT                   /product="Spliceosomal protein DIB1 "
FT                   /biological_process="RNA splicing"
FT                   /biological_process="cell division"
FT                   /biological_process="mRNA processing"
FT                   /biological_process="mitosis"
FT                   /cellular_component="spliceosomal complex"
FT                   /protein_id="CAG61525.1"
FT                   /db_xref="GO:0005681"
FT                   /db_xref="GO:0006397"
FT                   /db_xref="GO:0007067"
FT                   /db_xref="GO:0008380"
FT                   /db_xref="GO:0051301"
FT                   /db_xref="HOGENOM:HBG020872"
FT                   /db_xref="HOGENOM:HBG522501"
FT                   /db_xref="InterPro:IPR004123"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="UniParc:UPI00003B6CD8"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FMI2"
FT                   /transl_table=1
FT                   /translation="MEFLYNLHSGWHVDQAIVTEEERLVVVRFGRTADRECMLMDEMLA
FT                   SVAEKVRNFVAIYLCDIDEVPDFNDMYELNDNMCLMFFYKNKHMMCDFGTGNNNKMNFL
FT                   PDDKQELIDIMETIFRGARKNKGIVVSPYDYNHKRPSD"
FT   CDS_pept        783120..784844
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18503119"
FT                   /locus_tag="CAGL0K07876g"
FT                   /product="Similar to uniprot|Q06820 Saccharomyces
FT                   cerevisiae YPR083w"
FT                   /protein_id="CAG61526.1"
FT                   /db_xref="HOGENOM:HBG123800"
FT                   /db_xref="UniParc:UPI00003B6CD9"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FMI1"
FT                   /transl_table=1
FT                   /translation="MDPIISRFKELDFAVDTSERLKFLDRGDTNNESDEEHDVRESSAG
FT                   VAMIEEMILNERNNGSVYSHVLNQCESALQTYTDLLKLEMITTKSWYISALYDSVLIRF
FT                   NLKDNNNLEQTDEFFKDLALKSIKKCDKSAVGLESLYTSISSFRDFIASSTSGLSDMSP
FT                   LLSNSMTLLFEIWVVTNREIRHFQKVIAGIFMRSKLLLIDYELVKIWNLVRSKDKNDST
FT                   NIDKENVKKLETTITSYRAFLKIFIAQLQDAECSNQDNSNQDAFEECLRVFFDIESMYQ
FT                   ALNFNWLLKENKHLQDKNKMLDDKMSRSLPTINESKEVHNITAFVDDFLQQPPVLQIPM
FT                   DSKHTKTASASSSISSTSSYPFSPTSKSYHSLSTTSDDEKSPYPFYFDGNSSDRFSMKN
FT                   KNYTINDSSSTLHESTMSKVADRESETDTDSDMYLMMEKTNLSKELPKLLNAFSNAKKL
FT                   EQEIKTAKSTSAPSSSQESIRESQDNSSEKQHSPSPNNLSRSQLLSNSIINKTLLDKKK
FT                   EDLMHNMDNWVNHNNIKFSTLPTGLGNPLYTQLNNTHTKPHGFKSNFLNNLYGLGHN"
FT   CDS_pept        785395..786837
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094453" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17445590"
FT                   /locus_tag="CAGL0K07898g"
FT                   /product="Similar to uniprot|Q06821 Saccharomyces
FT                   cerevisiae YPR084w"
FT                   /protein_id="CAG61527.1"
FT                   /db_xref="HOGENOM:HBG058580"
FT                   /db_xref="HOGENOM:HBG398062"
FT                   /db_xref="UniParc:UPI00003B6CDA"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FMI0"
FT                   /transl_table=1
FT                   /translation="MSEQRPIRVAVLGGDSTGKTSFVSRLTLNIVHEVHYPTRDQTNWL
FT                   FDFIPHSPVSRAILDAEAHERLAFRTPGSQVLEPIFSSPSVTDHVLLSPLVFQAFTDEF
FT                   TQVRNQNKGRTLSYIRPMESSKKKKPHLYKYSYNNGKAAEANDKGIYLRGPTFMEKSPN
FT                   NELPVNYVPPVYSPILIDIIDTPGFKPDMVVPFLEVSLFANLDKNILRGLADEPRQPVS
FT                   TTSLLVASGASELNGKIDGYVFVYSAIPELSHLISPPSYDFSNTNKDVANLSIDKTKTN
FT                   ESIPWSSYTKKKDGGFSLLDVIRDCILDAWAEFRDYQRRWEMGQEDDVYSLFYTLKHMW
FT                   KAEKDRSTKIQELRSYKTTLNSIETDPSSPDSPPPCLIVCTHTKDNMASPLLIEKGRQL
FT                   ATQWKCGFVALDNLEDYNVDVALSLLIREIAEKEKLQIGRGNKMHQSIGKDHSLHPSKS
FT                   NPNNTESSSSGAVSMFKKFLRN"
FT   CDS_pept        complement(786915..788342)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21046547"
FT                   /gene_name="ASA1"
FT                   /locus_tag="CAGL0K07920g"
FT                   /product="ASTRA-associated protein 1 "
FT                   /biological_process="chromatin modification"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG61528.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0016568"
FT                   /db_xref="HOGENOM:HBG123801"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="UniParc:UPI00003B6CDB"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FMH9"
FT                   /transl_table=1
FT                   /translation="MERAATHFLRLHKSGISALCSGVIDPDYGITSPVLFSGDIDGEVT
FT                   IWNLITRRPIFTSKICNEQVVDIQFLEGKYLSLLCKDHKLRLYELLKLGAIVKQSDFGG
FT                   GDKVDLKQIFEVPVNTLNFANYVLTYLGNNKFELVTCHTQDAHFIDIYEFETPELNSLK
FT                   RFSKAIDFLPMLRDRFGDNLLPKMDGLGIIMKFYKVNEVVYCGFESGYVIAFRRYRNKP
FT                   LYRKRVSGFIGKPINECASGISKLLQHENVETSSSVNDLELDNVIEIVLVDRAHYPDPV
FT                   LDMAPNPKKNGIICSSTTNKLVLTSVDEQYLAGPNSAYIFKSDEYLLDKKNCLLMSTNL
FT                   KIDGSAVKDMMCKNIGFVLSLGDYIITGNWSGKTYIGRIESDKAVLAAAKSRSLIEVNE
FT                   SPVGNIQQDKSIQKSSKHTKIGAMTGFEVKDKEPDKLMCKNKELTPGKLRRLNAFVQSK
FT                   WYFIGYTDGTIGLYRAE"
FT   CDS_pept        complement(788767..789843)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21046548"
FT                   /locus_tag="CAGL0K07942g"
FT                   /product="Strain CBS138 chromosome K complete sequence "
FT                   /protein_id="CAG61529.1"
FT                   /db_xref="HOGENOM:HBG123802"
FT                   /db_xref="UniParc:UPI00003B6CDC"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FMH8"
FT                   /transl_table=1
FT                   /translation="MSLENAVRVVSTDEKGNQASSTKLIELLHSRVDALTTTNIELTTK
FT                   LQELLGNLDTVQQRERKLKESAASLRHEGDNVTLMLNRKERKLTEVKEAIVELTTKLGE
FT                   AKEVNHSLKQKFEDEGLTSEESLRESISEVKTEYDTLVKSHEIYESSNDIQCKSLEDRF
FT                   SQALLIHGENMKALDGTAEQILANNSELVSQLRATENKAESARTSIRNASIDTAAKVDL
FT                   EKWLFLYKEAQRICEEFASKTDTKLPDELQAIIDDPVLKELDARFALDEIQYGKTRNKR
FT                   IPSNPLLSNSQAAARRVASPSANYSPRVSSAQGSLPGITRTPSMKVNNKFSDSNAQEVP
FT                   TRLHSHGSRSKRSSMVFK"
FT   CDS_pept        790905..791996
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000108634" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19350892"
FT                   /locus_tag="CAGL0K07964g"
FT                   /product="Strain CBS138 chromosome K complete sequence "
FT                   /function="transcription regulator activity"
FT                   /function="translation initiation factor activity "
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /biological_process="transcription initiation, DNA-
FT                   dependent"
FT                   /protein_id="CAG61530.1"
FT                   /db_xref="GO:0003743"
FT                   /db_xref="GO:0006352"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0030528"
FT                   /db_xref="HOGENOM:HBG236599"
FT                   /db_xref="HOGENOM:HBG646536"
FT                   /db_xref="InterPro:IPR000812"
FT                   /db_xref="InterPro:IPR006670"
FT                   /db_xref="InterPro:IPR011028"
FT                   /db_xref="InterPro:IPR013137"
FT                   /db_xref="InterPro:IPR013150"
FT                   /db_xref="InterPro:IPR013763"
FT                   /db_xref="UniParc:UPI00003B6CDD"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FMH7"
FT                   /transl_table=1
FT                   /translation="MSAPVTSLRRSVGRKGPNLNIVLTCPECKVYPPKIVERFSEGDVV
FT                   CALCGLVLSDKLVDTRSEWRTFSNDDQNGDDPSRVGEASNPLLDGNNLSTKIGQGETTD
FT                   MRFTKELNRAQGKNVLDKKDNEIQAAFAKITMLCDASELPKIVKDCAKEAYKLCHDEKA
FT                   LKGKSSESIMAASILLGCRRAEVARTFKEIQSIIHVKTKEFGKTLGIMKNILREKSADG
FT                   FIKIDTDNMSGAQNLTYIPRFCSHLGLPMQVTTSAEYTAKKCKEIEEIAGKSPITIAVV
FT                   SIYLNILLFKIPVSAARVGQILQVTEGTIKSGYKILFDHKEKVVDPQLIASGVVSLSDL
FT                   PRVEKDRIAKSDKKRDTPTPGPA"
FT   CDS_pept        complement(792641..794239)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000036165" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20197722"
FT                   /locus_tag="CAGL0K07986g"
FT                   /product="Similar to uniprot|P20424 Saccharomyces
FT                   cerevisiae YPR088c"
FT                   /function="7S RNA binding"
FT                   /function="GTP binding"
FT                   /function="nucleoside-triphosphatase activity"
FT                   /biological_process="SRP-dependent cotranslational protein
FT                   targeting to membrane"
FT                   /cellular_component="signal recognition particle "
FT                   /protein_id="CAG61531.1"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0006614"
FT                   /db_xref="GO:0008312"
FT                   /db_xref="GO:0017111"
FT                   /db_xref="GO:0048500"
FT                   /db_xref="HOGENOM:HBG235775"
FT                   /db_xref="HOGENOM:HBG562580"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004125"
FT                   /db_xref="InterPro:IPR006325"
FT                   /db_xref="InterPro:IPR013822"
FT                   /db_xref="UniParc:UPI00003B6CDE"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FMH6"
FT                   /transl_table=1
FT                   /translation="MVLADLGKRINNAVNSALSNTEDDYVNSIDGMLKGISTALLEADV
FT                   NIMLVSKVRNNIRSVLLDNKTTNRSMNNVQTKKLVQKTVFDELCGLVDCTDHKVFQPKK
FT                   KATNIIMFVGLQGSGKTTSCTKLAVYYSKRGFKVGLVCADTFRAGAFDQLKQNAVKARI
FT                   PFYGSYTETDPVKVAGDGIAKFKKEKFDVIIVDTSGRHHQEEELFHEMVQISNVIKPNQ
FT                   TIMVLDASIGQAAEQQSKAFKESSDFGAIILTKMDGHAKGGGAISAVAATNTPIAFIGT
FT                   GEHIHDLEKFSPKSFISKLLGIGDIEGLFEQLKTVSNKEDTKATMENIQQGKFTLLDFK
FT                   KQMQTIMKMGPLSNIAQMIPGMGNMMSQVGEEETSQKMKKMVYVLDSMTKEELESDGRI
FT                   FIDQPSRLVRVARGSGTSVFDVEMILMQQQMMARMAQNAKMGKQGGGMPGMPNMTGMPN
FT                   MPGMPKMTPQLMQQAQQKLRQNPGLMKNMMNMFGGAGGMGGMGGPGGMPDMNEMMKMMQ
FT                   DPQMQDMARQFGMGM"
FT   CDS_pept        794594..797266
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000998" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19350893"
FT                   /locus_tag="CAGL0K08008g"
FT                   /product="Similar to uniprot|O13585 Saccharomyces
FT                   cerevisiae YPR089W"
FT                   /protein_id="CAG61532.1"
FT                   /db_xref="HOGENOM:HBG058223"
FT                   /db_xref="HOGENOM:HBG203979"
FT                   /db_xref="InterPro:IPR002710"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniParc:UPI00003B6CDF"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FMH5"
FT                   /transl_table=1
FT                   /translation="MEWGSGRVSKEEKLNAARNAVISYLAGTKDNDEDPWTELVRLISD
FT                   SSQGEVFTEFKSLLDSVRDVNDKKKLGIPLLHLTIIYDRASYIEFLYQGARSKLDFNLC
FT                   DDVAGYTPLMWCFLLERTDCCTELLTWSTEIDFHKVSKEEKLSAWDMVAKYSDFYMFLE
FT                   QNNMLQYQDIPTFQEKLTTENDNSSSALDQNALRNIDLHVAGLSLASTQNNEDIFASNA
FT                   TESRNDYLFGTEQIDSGINEQFDFTKLLPNQYVEFEDYDIKQLLDLLESLPKKEPHMTT
FT                   YAAALIFQMVRFAEHKKKQPQLVHTIMSLSLARILAAITTETDMTQESADTAFSSGDIV
FT                   SQSYWLGVLTFLYYYLTREEGFFKKYPEILQELINTIHSVIIELTLSIYSRLTSIIQPT
FT                   ILSYTTISDVKETLYKRDWNFFKKRKHHKMMQKQKKQEEELRKQEEETLQNNEDKLQIS
FT                   EALDESNDIDDEAEDKKKHSKLKLFKKKRHSGQLSTSMSNDSKLENSSINENTDLYYDT
FT                   EVIKHLYPPSMEEQMKPSPMKVVQIFGALMYVLNLHQIHPLFQQQCLSLAIQWFSNNLF
FT                   NQILKDKKKKSLSRAHAIQIRLNLSTFEAWAKNNDSKVPKPKMIDDFMWERFPYTLVED
FT                   VANIDLSNPILNNVATVNKVDNSSGLNDDLPLIRDTDNSLFYYQSLHRILQIHMEPVFQ
FT                   LLQWLQVATTIDSEDALDSTLDLLSRLTPTQLLKAADKYSYEIDESKFNSKLKKKLSAM
FT                   AKASNNKESPYLPERTVSLLVLPTIPEMTDIYARGVDHESYQPLLPVSIQDMIYEIHSE
FT                   NAKLRMNASEFYDYQNEEQHEQEVDNEEAHEDSYKENSSANEDNDLDNNNDRFEYQTVD
FT                   TPAVASHWAPKEDFEENPW"
FT   CDS_pept        complement(797486..799762)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000111187" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18503120"
FT                   /locus_tag="CAGL0K08030g"
FT                   /product="Similar to uniprot|Q06833 Saccharomyces
FT                   cerevisiae YPR091c"
FT                   /cellular_component="membrane"
FT                   /protein_id="CAG61533.1"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG058220"
FT                   /db_xref="HOGENOM:HBG203980"
FT                   /db_xref="InterPro:IPR001849"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="InterPro:IPR019411"
FT                   /db_xref="UniParc:UPI00003B6CE0"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FMH4"
FT                   /transl_table=1
FT                   /translation="MSWKLFFIVYLLGGLTFLPGLCALLVYIHLQLEKLKELAEKNARN
FT                   ELLCKDVDPNLKAGEVLDPIGVNVSKRGWITVTKEYYYHHTELQTPPIASETAKQDSNN
FT                   TPPKDLNESQIPQRSQLRKRHKFYGVLKHGNLFLYKDDSPHSDLVHAISLQKSFVTMWP
FT                   RDPKKEMSDSSLFTKRTCISILKTGLVSIDEEGKLVFNPSINAIQSGEEDGKQSSQQSS
FT                   SNLSSNTYFLYFDNNSEKEDWYFKLIDSSKSNDEKNNNEDPLSPNTSAKTAHLNTRDML
FT                   YLIQSLNSTEGQLTTKWFNALIGRLFLALQQTNKLNEVLYAKIYKKLTNINKPGFLDDL
FT                   VVKKVDVGTSAPMITHPELRELTPEGEMKIAMNLRYTGNISVIITTNIGINLGSHFKQR
FT                   EVSVQLSITLKELSGPLLIIMKPPPSNRIWYGFETDPYMNLDIEPMVSSSKISYNMVTN
FT                   MIKGKFAEAIKESLVMPFMDDIVFYDTDHDVFRGGVWDRSEFSKPLLDMLRKQSSAEEK
FT                   SIHSNDDIKEHETENNNKDDEREYEITKTSDTGILNKMGNVKNTLLNKANKQGSEESLE
FT                   KGDDFNDTDSLTDSSIKPKKYIKNSIKKIGKWYKDNINSNDEEFDGNINETEPEQRRVS
FT                   LDSGKSVQSPTMISNRRMRGKRPEPPFIGAEPGSPTTVTTEKQTSQKSPIINATAMFAN
FT                   RNTELSVRGRSSISEGVNDEQGQPHGFIKMPTTNEFGGQLFEENIRTFNGSQVTSPQST
FT                   QGEFS"
FT   CDS_pept        complement(800991..801908)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000034109" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18503121"
FT                   /locus_tag="CAGL0K08052g"
FT                   /product="Similar to uniprot|Q06834 Saccharomyces
FT                   cerevisiae YPR093c"
FT                   /function="zinc ion binding"
FT                   /protein_id="CAG61534.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG123803"
FT                   /db_xref="HOGENOM:HBG203981"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR011011"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR018957"
FT                   /db_xref="UniParc:UPI00003B6CE1"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FMH3"
FT                   /transl_table=1
FT                   /translation="MVSKVCAICLEDICGKSSTSYLKPCGHEYHSDCIRKWHGHAEDLK
FT                   CPMCRIDAEELVVKLYGCAEKIIDLQKGFAVNQVVNHVINTEPDLIDELAEALDNNLHI
FT                   SELRTDTQVEPEAPPSRPRLLQCGICGDQDDLVLEHYCEECQTLYHGSCLRVLAIETGE
FT                   RTDWCVCVDCRKELISRNDRLVIQNSQLASRDDGSLMYDTNNTMVFEGQLREKNSVRAE
FT                   QIYRDCYLESLKKTKTNIQKHVRKCLDTYYHSGKIDHMEYTRINKTVSRKLYTLSNYTY
FT                   SQELNYDHLAKQHIETELGTPLSI"
FT   CDS_pept        802167..802490
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000168285" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17445591"
FT                   /locus_tag="CAGL0K08074g"
FT                   /product="Similar to uniprot|Q06835 Saccharomyces
FT                   cerevisiae YPR094w"
FT                   /protein_id="CAG61535.1"
FT                   /db_xref="HOGENOM:HBG015725"
FT                   /db_xref="HOGENOM:HBG332020"
FT                   /db_xref="InterPro:IPR005345"
FT                   /db_xref="UniParc:UPI00003B6CE2"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FMH2"
FT                   /transl_table=1
FT                   /translation="MSRHQSDLMMCMNPAGINTGILCEKCDGRCPSCDSYVRPRSRVTV
FT                   CDQCSFGKQATQCILCGSTNGKVPAYYCWECCKLGKNRKGCPRIINIGSNKMDRYFGTK
FT                   KDT"
FT   CDS_pept        complement(802510..805929)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17445592"
FT                   /locus_tag="CAGL0K08096g"
FT                   /product="Strain CBS138 chromosome K complete sequence "
FT                   /function="ARF guanyl-nucleotide exchange factor activity "
FT                   /biological_process="regulation of ARF protein signal
FT                   transduction"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAG61536.1"
FT                   /db_xref="GO:0005086"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0032012"
FT                   /db_xref="HOGENOM:HBG123804"
FT                   /db_xref="InterPro:IPR000904"
FT                   /db_xref="UniParc:UPI00003B6CE3"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FMH1"
FT                   /transl_table=1
FT                   /translation="MSQQFSSFIKLKIFQSNHAGHDSKNGSRSETSSAPSNENKSESSL
FT                   SGSPRKNKMVEALDNELNKLTIKTDDIRFEPPQLVRPATFSPESPQFNFDISNTDKDNY
FT                   SPSTDHTIHEDGEYDINNTKQDETTGALSEGHRNIKNVFHRRHTSDSLTDSDLSTNQKK
FT                   THGKFRRIRHKMSLLDINFKLSPKGSSTDVTKLRDDDSNQQISRRGESKLKSMSQVNSN
FT                   ERLLAPKKQVAVQSFNPSKKSMDSTLSRSSGNPTMSSMTKVRSASSNGSSNLLVKHYSN
FT                   EKTNPLKLRSMKTASTISLDPIQTESIDENLENSKISQVSTNKLKTINRRRSRTLDLSD
FT                   YVKNRKGRTSKSVEINSNELSDIRSHSLSFSGRSPLILSRTNSQNQLTTSSERNSRDRP
FT                   RSPYGNLPAPSSSSSATTASIGGGISSRRSSSIVNALSSLVNLKTSSVTSFKQVPFSSN
FT                   SGQPQVTLDDLPKPPPPEGSESHVDYLIRISPYGKFLGIILVKKDDPFNRRALYHFLDK
FT                   YFNLKTDPIDVALRKVLMFLELPKEAQEIDRLLTELGKVIFDQQSESYDPCAWVDADQV
FT                   YFLLYSLLVLHTDQFNTKNKFKMTKQDFVKLIREDTYSNGNKIPAEILSYYFDNITVRE
FT                   SPIFDLLPPVEVFPLEHVQYGVDRAEIAYSPMRILQDRTLNYEGDYQHVSTPPKLTSRP
FT                   TSSSISSYFSQNSTTLSGSTIMPVTSDIDIYEKIFTNELREVSLEHQVSKIWDYTEKDW
FT                   HTVTASYTSNHVGFQNRYKKFYSILMDFKGGYIRIHKNILMKLNLPKYELTKGEGIRED
FT                   DYCYLKIIQMGEIQTFHQNRKIPLVGSKTSIWKSEYGVLTYIGLLVFEKSDWINPQAEK
FT                   DEHTGVTNYIIDFKPGFSFVSSNVECFHGMFAVREKNAVGRSHFIKLLSPNSAGASSSR
FT                   YNGSVGNDYLDSAMYGVDIAQSEKDQSDPNDPLADLCKEEMEGTLVFLHSAKRNLIFKC
FT                   PSVSARDNWVDAINLISAYDGCDYDPACLDNTLVCKKKYSVQERLVRLHSMDVEKSFKL
FT                   HELETILMFFRQAIPITMKSRSTLISNIKQIATKMDWLLFEIKRSQTFVNIISEVDGSY
FT                   DNIFGITTNDYHNDDDISGMIPNINGSFLFTD"
FT   CDS_pept        806504..809671
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000141960" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17445593"
FT                   /locus_tag="CAGL0K08118g"
FT                   /product="Similar to uniprot|Q06839 Saccharomyces
FT                   cerevisiae YPR097w"
FT                   /function="phosphatidylinositol binding"
FT                   /biological_process="cell communication"
FT                   /protein_id="CAG61537.1"
FT                   /db_xref="GO:0007154"
FT                   /db_xref="GO:0035091"
FT                   /db_xref="HOGENOM:HBG191596"
FT                   /db_xref="HOGENOM:HBG203983"
FT                   /db_xref="InterPro:IPR001683"
FT                   /db_xref="UniParc:UPI00003B6CE4"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FMH0"
FT                   /transl_table=1
FT                   /translation="MSLDAVQEHYLKRELLKFQLDKEFELLNNKDGLRHFGYPFTSEDP
FT                   RLQIKKGESYGTAISNALWSSATYFTGSGSGEETKVEEEAAVSILPRLEGTQYPLLSYM
FT                   LQEFIFSFPLLSKNLSVDERFWQGKVQVFFEHFMSMGFSDSYDREETTKRRKMGQKMKK
FT                   VIMLLFNSGIGTTLESSYYEHDKLTAQQENTRKRSNIEELTMPTKENLKFLVTHEPVYF
FT                   NTWDISIISVYDSSKASDELSNTLTKNNSSNSSSSSSIHSSSSYLFKSKDLKKTSAYTS
FT                   KMFKSAFGAASSTTSNMFSKLSGSTVYSSTPESKSYLSVNSNEKNGVRSKKSKYYFVIR
FT                   TRRLNEPDAISYNFKTYNSFKKFSHRLKKEFPSKKLPDLPSKKQDKKALRNIKKEQLNN
FT                   KTDQPNISSLMLDDSNSKDIDEPSPIDDNSMKDDLASNISSDDQDLDLDTQSIDSAEEE
FT                   TKFLPYETLRYTLRLYLRTLSKDSDVVQSSIWKEFFKEDVVDPETFDESLMEDIKLREI
FT                   TDIKNLENQISFQKMALEKTVKLQASMKDFKTNLLEDEKYLLELVGEIKAKKRFEDLSP
FT                   SLQNFVEWCKIYLSSILYQMFLGNDNSYEFYRQIRRLHKLLPYTVMCQIMRFTNPVAIM
FT                   KGMIDLFMAQPFGGQSLLQTMFSTILTEDIKHQKNAVKELERKVLSKHSDSKQMLAFLR
FT                   SCIFQDDSSNPLKFNDIQEESELMQMPVCLLLIMKGSEAGKIKKDVVAELINSYSSWKS
FT                   EQGNELQPSGEGNFYVNVHDLMKLYIKEHDKRLMRQLWQDPELQQLLKAIISLIYEPML
FT                   RIFKVARMDLAIKNFEKFMDDLVQLMDDVIAKQLHISSKFNIVESILDLVNKHQNSFLE
FT                   FLHDVYNRDSEGIFEGFITWISKIIRFLQKSKFGSPEERVDLNDFLNTTTDHLDKDLLL
FT                   KQINEVIKKKIDARKVYWQILEEKISKKENTRRSMSPEVMENNWKTINSMIIPTHSDSF
FT                   GVQDNDMIDLDIEMTEHTVQEETKETELDKEYRNILSRTIDESEIEKLCGPGFDDLLRL
FT                   KLSTYKV"
FT   CDS_pept        809979..810572
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000186184" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20197723"
FT                   /locus_tag="CAGL0K08140g"
FT                   /product="Strain CBS138 chromosome K complete sequence "
FT                   /function="guanylate cyclase activity"
FT                   /function="heme binding"
FT                   /protein_id="CAG61538.1"
FT                   /db_xref="GO:0004383"
FT                   /db_xref="GO:0020037"
FT                   /db_xref="HOGENOM:HBG028497"
FT                   /db_xref="HOGENOM:HBG381378"
FT                   /db_xref="InterPro:IPR007194"
FT                   /db_xref="InterPro:IPR011644"
FT                   /db_xref="InterPro:IPR016721"
FT                   /db_xref="UniParc:UPI00003B6CE5"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FMG9"
FT                   /transl_table=1
FT                   /translation="MSRSQSISSQSKSLKITGEEIWKNKVEKVNSELFNLTYGSIVSQL
FT                   CIDYKRDFKKVNEQLFSMGYNIGIRLIEDFLARTALPRCDTMLRTSEVISKCAFKVFLN
FT                   ITPTVTNWSQSQDTFSLLIDENPLSDFVELPMDAVNQLWYSNILCGVLKGALEMVQLDC
FT                   DVWFISDILRGDPQTELRIKLNKVLKDEIPIGED"
FT   CDS_pept        complement(810899..813049)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000191288" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17445594"
FT                   /locus_tag="CAGL0K08162g"
FT                   /product="Strain CBS138 chromosome K complete sequence "
FT                   /function="acyltransferase activity"
FT                   /protein_id="CAG61539.1"
FT                   /db_xref="GO:0008415"
FT                   /db_xref="HOGENOM:HBG175971"
FT                   /db_xref="HOGENOM:HBG324690"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniParc:UPI00003B6CE6"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FMG8"
FT                   /transl_table=1
FT                   /translation="MPAHVPEVGHKYINDYNGYTYNIHTFLYDLIVFLFNAVITTFFRE
FT                   IKVRGGYNVPPRGVPTILVCAPHANQFIDPTLVMITTRQLGYIRGKLRSRQACFVTAAS
FT                   SLKMKFVGLFGNAMGSIPVPRIQDNLKDMDSNLIIYAPDFENNPTMLKGKCLDGSNPGF
FT                   TTKFTVKSLIGLPNYLSNANIAEIPDDSTIVLSAPFKNDKNGKVAELLTQGTTFKYAEK
FT                   IDNTETFQSVFDHLHTKGCVGIFPEGGSHDRPSLLPIKAGVAIMALGAAAADPKMEVAV
FT                   VPVGLHYFHRNKFRSRAVIEYGEPIMVNGDMGKEYKQQPRETVSRLLKKVSDALFTLTE
FT                   NAPDYETLMTIQAARRLFQTNNSRIPLPAVVEIQRRLLVGYKKFQSDPRIMHLQNSVKE
FT                   YNNKLYSMGLKDHQVMSLKTKPYETLRCAVTLLQRIFRVTLFFFLSLPGSIMFLPIFVG
FT                   SHFYSKKKQREGLKKSSVKIEGKDLIATWKLIVALLMAPSLYITYTIILMVLHQRRSKY
FT                   VWWVWVPTENKVIQFIYFYMLLVLVAYSSLKTGEIGFDLFKSLRPLMISLVYPQDYIHE
FT                   LQTRRKELSNEVTEICNELGPQVFPDYEKFASSYLIKKDKKDESKPEKDYLSQNSTGLS
FT                   GRSRSSSIYSMISNVSNSLSRVNSRGSLTDVPIFSDSRQGEWTNITSDDEQSNSKEETP
FT                   TNKLSSKITDLMRSKREKEKVD"
FT   CDS_pept        813815..814888
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000189824" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17445595"
FT                   /locus_tag="CAGL0K08184g"
FT                   /product="Cytochrome c peroxidase, mitochondrial "
FT                   /EC_number="1.11.1.5"
FT                   /function="cytochrome-c peroxidase activity"
FT                   /function="heme binding"
FT                   /biological_process="oxidation-reduction process "
FT                   /biological_process="response to oxidative stress "
FT                   /cellular_component="mitochondrial matrix"
FT                   /protein_id="CAG61540.1"
FT                   /db_xref="GO:0004130"
FT                   /db_xref="GO:0005759"
FT                   /db_xref="GO:0006979"
FT                   /db_xref="GO:0020037"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG138843"
FT                   /db_xref="HOGENOM:HBG597790"
FT                   /db_xref="InterPro:IPR002016"
FT                   /db_xref="InterPro:IPR002207"
FT                   /db_xref="InterPro:IPR010255"
FT                   /db_xref="InterPro:IPR019793"
FT                   /db_xref="InterPro:IPR019794"
FT                   /db_xref="UniParc:UPI00003B6CE7"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FMG7"
FT                   /transl_table=1
FT                   /translation="MSATALRIAPIASRTFQRRLGYLLAGVATGAAATVAYKAQKNNNY
FT                   YKYNNNNNNNSGFKAGALAAAAGVVHLAHEEDKKTADYQKVYNLIAERLRDDDEYDNYI
FT                   GYGPVLVRLAWHSSGTWDKNDNTGGSYGGTYRYKKESQDPSNAGLENAAKFLEPVKKQF
FT                   PWISYGDLYTLGGVVGIQELQGPKIPWRSGRTDLPEDMTPDNGRLPDGDKDANYVRNFY
FT                   KRLDFNDREVVALLGAHALGKTHLKNSGFEGPWGAANNIFTNEFYLNLLNEDWKLEKND
FT                   AGNLQYNSPKGYMMLPTDYALIQDSNYLKIVKEYAADQDAFFRDFSKAFAALLERGIDF
FT                   PKNQPVHIFKTLDEQGL"
FT   transit_peptide 813815..813883
FT                   /locus_tag="CAGL0K08184g"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FMG7 "
FT   mat_peptide     813884..814885
FT                   /locus_tag="CAGL0K08184g"
FT                   /product="Cytochrome c peroxidase, mitochondrial "
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FMG7 "
FT   CDS_pept        815404..818913
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000057110" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17445596"
FT                   /locus_tag="CAGL0K08206g"
FT                   /product="Similar to uniprot|P53120 Saccharomyces
FT                   cerevisiae YGL140c"
FT                   /protein_id="CAG61541.1"
FT                   /db_xref="HOGENOM:HBG059682"
FT                   /db_xref="HOGENOM:HBG204274"
FT                   /db_xref="InterPro:IPR018823"
FT                   /db_xref="UniParc:UPI00003B6CE8"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FMG6"
FT                   /transl_table=1
FT                   /translation="MKIKQHAVHAYRLYQHYFPTDRILAQRIFKATVNTTVAFIFTLIP
FT                   KVRDHIGTEPAMLPLISVIVHPGRRVGGTIKGAMYCTTGLIFGLAYSLLGRFLAAQCLG
FT                   STWNTLTEHEQLVLHFNRYRSALAILAMFETIMLFVHGWFRSVNHFYFGIVFPLFLVVH
FT                   FTFMAPLSETPGVIANSFSTPFYLGIAMSIFFNLILFPEFGSTYLGNAAVDTFKEVRKS
FT                   VKDSVEFFVNAPLPDSAAIEPVSLNKLLKYKTLVRSKISNCEVVLEECMYEISYSYLSP
FT                   VKLHPLIPSLKDMSIYITGLVNACQLEFMLLKELNLENIDKLKELVDIMKKRIDDCLVA
FT                   DMILLAYGFDVDINRLEVPELKGKKLSQVAEEVDHSKHIELLEESLNAFKSKVEEEILT
FT                   VDIDLLKPDEELFLFSTFLINLKQAVESIIVLTTQVHSVYESRKRREVKRGYFGRSLWI
FT                   PFFQNYKNFPIFGTSKMTENDGLRGTLNGAGEKTEFVARRPSYEEDELLNQQANTNRRN
FT                   ESDLVLPLIKTPTMSRTRKVLEDLPVKAHKFIIRSKEHFRFGFQVVVALMLASFPMFIP
FT                   NIRSWYISYRGTWIGFVCILCLEPSVGGTFWVFFLRGVGVITGAAWGYLSYAAGIHNTN
FT                   PYLETVITVFGAVPGFYFLLGSPYVKAAIIQIISIYIVILAAMLPTDNPSGILLSFAKR
FT                   CLAVGYGGGIALIVQLFFFPVKARDQLNEEISFICGCISEIELLYSVGLDGEEHETTLT
FT                   QQRFEKIKKLSASAKAALTRATAYKGLTRQEPRLKGEYTGLENIFTEVIFVLQQIVERM
FT                   DNAAILRRHYGSSIAKGVNPIVYAYRRQLVGSTIALFRAAQEAFNNKTPLPQFLPSARL
FT                   AHRRLLVKISKVLPQIANIPSITTESSNKMQDSTSSSDSEEELTFTAKQSKLTRKVTFD
FT                   RETYLTWNATSASTEEIIDYIEELIDLTKILVGVNEFKYGFLSRPIYEDWATEAATGFD
FT                   EFINSEKVSMLKNVPTFNEEDEYESVTNVETSKSSNFRHNTNNTTSTEANASRHNNFDL
FT                   YGMESASDLSSDMDSASAMSPRNPVALEDENHHGTANIHSGTALNLARIASHKAGSKVD
FT                   ALPKNFRDRSFSIGSIAGQLPGLSRRRTLGEANDDYYDENASSDEELPLTLKKILSKGK
FT                   KKN"
FT   CDS_pept        819369..820670
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000166838" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17445597"
FT                   /locus_tag="CAGL0K08228g"
FT                   /product="Similar to uniprot|P36142 Saccharomyces
FT                   cerevisiae YKR051w"
FT                   /protein_id="CAG61542.1"
FT                   /db_xref="HOGENOM:HBG058488"
FT                   /db_xref="HOGENOM:HBG202379"
FT                   /db_xref="InterPro:IPR005178"
FT                   /db_xref="UniParc:UPI00003B6CE9"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FMG5"
FT                   /transl_table=1
FT                   /translation="MGVATLFAELLNGCLAKYSALFSMLAMFMALYTILRHLMNYRKPY
FT                   EQRLSIRILIVVPIFCITCLLSVLFPFYARRFVDPIREVYEAVVIYTFFSLLITYLGGE
FT                   YEIISRRGLKHQPVNHFVPLVGQLLKKVDISNPNDFLWIKRGILQYVWFKPIYSISMIC
FT                   IDIWGLKQFEIALVVLFNISVSLSLYELALFWKCLYQDLLPFHPWPKFLCVKLIIFVSY
FT                   WQGLIIQVLGYYRLLGKSIEYKHSELGYIYRNALLCFEMIGFAYLHQKAFPWEDYSIKS
FT                   IPMGARMKLRYAIRDCFGIQDLIWDSKQALNGNTYYNYRNFDPSVETSLLGGVNRDTRI
FT                   DRINEGLRFTNNGESRYWIDYGAIESGAQVSESIRNTDSAKDISADWDDSIDTSRYVQA
FT                   DPNYPVVWNIAGARYTNSTAQLRNEIIGRSSSTN"
FT   CDS_pept        complement(821014..821907)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000038810" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19350894"
FT                   /locus_tag="CAGL0K08250g"
FT                   /product="Strain CBS138 chromosome K complete sequence "
FT                   /function="binding"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAG61543.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG541806"
FT                   /db_xref="HOGENOM:HBG735918"
FT                   /db_xref="InterPro:IPR001993"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="UniParc:UPI00003B6CEA"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FMG4"
FT                   /transl_table=1
FT                   /translation="MDEEIDYEALPPCAPLHHQLLAGAFAGIMEHSVLFPVDAIKTRIQ
FT                   SSSSGAATQGLIKQISKITTAEGSLALWKGVQSVILGAGPAHAVYFATYEFSKSKLIDP
FT                   QDMHTHQPIKTAISGMAATTVADALMNPFDVIKQRMQLNTRESVWHVTKNIYHKEGFAA
FT                   FYYSYPTTLVMNIPFAAFNFAIYESATKFMNPSNEYNPFIHCISGGLSGATCAAITTPL
FT                   DCIKTVLQVRGSETVSNEIMKQANTFQRAASAIYKIHGWKGFLRGLKPRVIANMPATAI
FT                   SWTSYECAKHFLVNSS"
FT   CDS_pept        complement(822618..823832)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000066080" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20197724"
FT                   /locus_tag="CAGL0K08272g"
FT                   /product="Strain CBS138 chromosome K complete sequence "
FT                   /function="catalytic activity"
FT                   /cellular_component="membrane"
FT                   /protein_id="CAG61544.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG058487"
FT                   /db_xref="HOGENOM:HBG202380"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR016118"
FT                   /db_xref="UniParc:UPI00003B6CEB"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FMG3"
FT                   /transl_table=1
FT                   /translation="MSVAATLIEKADLSIEDSNGCNAAKHHLSDPGNHPAEHFKKKMSP
FT                   LRFKMRQFLTRYTDHQSETLANIQHTLRNPVLDVYFKYSALMGAHTFYIIALPIPIWFG
FT                   HWELTRDLVYIFGYSIYLSGFLKDYWCLPRPRSPPVERITLSKYTTREYGAPSSHTANA
FT                   TGVSAYFLWRIWVESNFTLTSKALLSIGVMFYYLTLVVGRVYCGMHGLLDLYSGALVGL
FT                   ACFMGRIGFDYLFPTFKASEYNWVPVLSVIVSLFLLYKHIKPVDECPCFEDSVAFIGVV
FT                   SGLDCSNWLIAKFNLNLVCSFIDFEPKNCLHILARLLVGVLTVIVWKYVISKPLVYFTL
FT                   VKLVRLKDERKDYHERHEITKLAAECAEHIGVPNIELLGRFIIYAGVPSTVILVCPVIF
FT                   KALQL"
FT   CDS_pept        complement(825448..837573)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17446702"
FT                   /locus_tag="CAGL0K08294g"
FT                   /product="Strain CBS138 chromosome K complete sequence "
FT                   /function="ATP binding"
FT                   /function="ATPase activity"
FT                   /protein_id="CAG61545.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0016887"
FT                   /db_xref="HOGENOM:HBG123805"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011704"
FT                   /db_xref="InterPro:IPR013594"
FT                   /db_xref="InterPro:IPR013602"
FT                   /db_xref="UniParc:UPI00003B7EBE"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FMG2"
FT                   /transl_table=1
FT                   /translation="MVQRNIELARYITTLLIGVCPKLLDDSELRGGVVDKLSNDVHVIE
FT                   FSNNDNEGGKIDNQILRVTIAKSNNGSDIDDIWINDSIPTKVYEDNEWCSGLSFSSVIV
FT                   VKQSKLWLDDVPINTQLTAVTSPTLFDIKEFTNFIELQIKKLFQEITRMDTIEYSLDSI
FT                   KDTEQKLAETSASLYRLNDTIKSPDLLQLAHHIVRKAIQEGATVDNYKQYIPKNILNDK
FT                   KFVNALNHISIQWIKSMKSLISLLDFPSKTDLSNEINMWQRLRYILVDIIGQTEKSEFQ
FT                   ITLKLLRDTNISNTGLDALVDTELQKTLNTVEGYIQFLTSFPSYISGQNFDELQVTLFN
FT                   FFGNAQKFSQYGYPVNRTIELIVLFNNNLMQTINSRYQNSIALSLNEFNADYTHITMFL
FT                   NSLKAQLEDFKLVLREYLRKNNNLNYKEIIEQLPENTTTIDQLKEVKNLKEYQDILIRC
FT                   IHALKYDGYISDINEIDHCFSSNYNNQITSNSLRNLQVTFHKISFDVENRIILLFQDRD
FT                   LKSDSRHILDAKHLFLCLKDLSRFSHIIRKKMQSYRDEYLNKLEKSILLIIDNYYVQLV
FT                   HLTNYYPTGNLSSFRQIYSIFSVKKQIQLKLRECDILFDKSWMSTPKGHTIMSKIESID
FT                   IDKKIQQYLSDWVTAIKQKHNNLLDQTLFTIINNGYNKNELSIILPQFLLECYRDLRNI
FT                   TYLGIQTDMEFSHFLRGSNKWISNVEILKEDIKLFFVMIQDLDKTIFTKIIICAEIYDI
FT                   WTIVKKQLHITWQRIQTHNNFIEVFDTRLQPLLIKYDLSLGQETIIGKSLKNLKTGKLS
FT                   IDFINKELNLIERSLNFLKANKIERTNLTTHLVLQNLENSFMDMIFHHMNDFNFSQITI
FT                   RLSKYNDSIVFKPSLQEINSMRIMEVQSVLKSFTNIQENLSESISNHSFSQVILQNITC
FT                   RYYIKESSNLIKEEMEAIKVRLKETTMKIMILEIDVQQYQQVLHENIDAFLELCEDVVN
FT                   LKLFTESNSHITITKSIKLDYSSLISDLKAKLKECFRILGNSLQNHLMTLQTWLDEKYK
FT                   EFNGGLEFNENAEYEPPHLLKFFQLYFCFIDSRTAINTNIAKFKELIQLKKIVEETNHE
FT                   KGQQIQKYINVYDRLENSFYKTICYIQENCQNEIKSLKQYCTTCYNSKLKEIETLWIQK
FT                   STFLKSKNLEFILPLIRQFQVLRSETANFKKMSIQVTNHFKLSNDVESINSQPPMEKEI
FT                   DKWIVCLEELVQVEDALKSFEMTRLKDLSKQLNTTAIDKEKTKIEMLSTTLHETQAYKS
FT                   IKQKILFYMNQTDILLGISSEQINERHMKELFDEIGCPPNPHLNFSELKICDLPIEQLL
FT                   LNRFKVDEIISKAKREAAIKDSLDEIEMYWSYFTLLMDDSTAHIPILKDIDELRNKISE
FT                   DMDILETMIISPFSVPYTTTIESWNTNLSNLSNLLNQIEVSQSQWLEFNLLFTNSNICS
FT                   SLPLEKAQFDQISESLLSLILYVKHAANIFDLIRSGNVSKSYTEITSKLNKIKKKFSEF
FT                   VESQRQQYPRFFFVNDQELVTILGAINDIDVLSGHLRKLYFSISSFDIQNGKIHSVVSA
FT                   EGEILKLSNEIELSIYKTVPELLRSLDLEIETTLKTSIRDCLMNSRSLDEIFESNVYQV
FT                   LTLWLQVSLSEKLHSYKHSKSKDELLEMETFLSRTCSWLNYKNVLSSDSGYKKLKIEGM
FT                   LLEVLKYQSLFDQLSKCTSNIDVDIMLDDWWMFRLIEGNEIAIECSRQDSIYPYAFNYL
FT                   GVPEHLVFTKGLANVYNFLDESFHQNYGVSIIGPAGTGKTESIKSFGYMFGIFVTVFNF
FT                   DDLIDFSSLQRIIAGILKLGLWASFDEFNRLEYTVMSAISEMISSIQHSLSNKNTTIDF
FT                   LGMKLPIHSHTKLFLTMNPKYRGRRNLPENLRRLFRVYYFGKSDSHHIVEIYLSMYGNK
FT                   DKYLAPKLINFLNDLKMSCSQQDHYDFGLRLIKAIFRQISAVPRATLDQNTIVSLMKVM
FT                   ILPRLTREDSKTFNKKLDEIFNYSNDREDTSLSSNFMKIFKSMDLLIQGEQLQKCLQLR
FT                   ELYGSNTGIILLGESGCGKTTILNALHKSFEQDLHHKIEVYYLDPKAIPKDHFFGYYDK
FT                   STTEWQDGIFSSIIRASNSSTECVPLWIVVDSDLDSSTMEAMNSMLDDNKLLTLGSGER
FT                   LKVGKNIKLICETDSVSKLTPATVSRCSVVHLPYLPANIDEYINHKIHLLTRYLNSNGY
FT                   QSIQQDILFEVSRLCESDIYKIVALSKDTTEAEINMNTQQLIDNFFYILIDFIGIYYSM
FT                   SVKCADHANMTLVLRFQLRKYLIFAFSGHLQQSVQLMFLHEYQRSCQEKFWGENETLAD
FT                   KAVDTILYTITDTYQLELKSTAIKNLSTDMDHLIQTSEISLYKEMINSYLFCNRSLLLI
FT                   GPPGSGKTMLIRNIIENNENYSSYFMSLSADSQISDIIRIIKSKTKAISKASEVVLVPK
FT                   QSKKFVLFLDEINLPRLDEYGSHKVSLFIRQLIDKQGFWDFQTHQWLQIMNILIIGACN
FT                   PLSYLGRVPLSNKFYKQVSVLFVDYPSANSLVYIYSEKFRRIFSLIPHLEKLNVDILKA
FT                   TIEIFYKFKEAFDERRETIYICTPRELTKLCKGLLTTVLNINESINEDVLFRVWLFEIW
FT                   HIFGERLMNADDQNILRDIIYKVSTQFEIKYTEPNELLFTSLISGEYQDVTKTNLMKFL
FT                   KNRIPTYIEEYKIPDFVIMDMMAGPIISIERILSKPNSHAILSGAPRLGKKTLTKLTSW
FT                   LMGLTTLEILIGDKDSFDQFFATLKNCIRDCISNDISYCLYVGCSADVETAYLEKINAL
FT                   IANADLPEIYEESELNIFLGEVKENAKHNNIILENELEVQLFIKEKISKGLHIVFSVSD
FT                   DNFDNNSNGLLCSPTLVNRCTVVWFPSWSSEVYYEIATKNLNRLPLSFPVSESLGKSSN
FT                   DTLKQLAQCIVEIDTYLRVNYLELKSTPSYFLDLLRVFENKYLAMLHQNDSSKSYCSRG
FT                   LEKINDAVLELKTLTSELENSRQQLSIKEDSARKTLDELLVDQNEVERKHEATIEIKKI
FT                   LEKQEAEVADRKLKLMNQINKIEPVVSAAREGVKNIKKEYLTEIRSMAKPPNAVVLIMS
FT                   AVCSLLGISFNNWKDIQQYMRKESFVKDIITFEPKGDNFKDRRSIVQTSYFADKNFNFA
FT                   AINRASRACGPLYHWIVAQIEYSEVLDECVPLENEIGDINLKSNHYKANILAAESMIID
FT                   LHTKMKLAKENYANLIGEVENIKRQIKANTNSLNRAIKLVKTLSAERKRWTVNERDYSS
FT                   NKSCLIGDSLYLTCASIYFGQLSELNKEKVQNLIFQSFKKYNISHSTLALIEEVSVEDK
FT                   AQYLSCGLAEDPYVIGMFDLLIKSPQFTSIIIDPQNEIVEILKSYHNQNISIMSVNDPS
FT                   FTKRYLKAIDFGGPVLITECEYLGTTTLSTLFDARASRRKNHIYLHTTSSTHKFPAYLL
FT                   ARVDIIDFSIKIGSIALRSLKATLDIIKPEYQKETEALRINKEQLKITLMHLEDRLLKE
FT                   LSDSSGPMLENDELLRTLEQLKNDSEEINEKIIETENNTAILQQIIENIKIIGNHAVQV
FT                   YRILEAITILDKHYKISISRYLQYFALALKENDLSTFNVIEKDTSRLNELKKHLIKMFY
FT                   CNIYGIISPSLKSEHRVVLAIALYICYNKTNKEPNNNDWLIKAITHLSAQSAIVTDKAD
FT                   NVDNIITENIDSLMQLKGMLDTFFKSKFSLENMINNKNFPNVVVINSHYQDGSSYITRC
FT                   YSRLIDNAISLGTKESLAWAEGKIQEGISKGGCVLLQNIELGEKWINSYVSSITKRPSE
FT                   KLKLFMIYNPTIKSTIIPTISNCDKIRFEGNDNICMMVNELFTMVKEYASSQRYVYLSY
FT                   VLAWLHAIIVFKMRFAPNGGFRQLVAFSDNDFIFLFNIGQRILNRSNNDQLFWQFIKHA
FT                   AHNHVYSIQLEDEKDKISMKRLIDEILPEEFYPKYMIVNEISISLQDSASCIEEQLASI
FT                   KLPQEWETVWLGFNKDSLRTHKNDIESKVLDDTKQLLNSIEYV"
FT   CDS_pept        839222..840193
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000233974" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18503373"
FT                   /locus_tag="CAGL0K08316g"
FT                   /product="Strain CBS138 chromosome K complete sequence "
FT                   /function="GTP binding"
FT                   /biological_process="small GTPase mediated signal
FT                   transduction"
FT                   /cellular_component="intracellular"
FT                   /cellular_component="membrane"
FT                   /protein_id="CAG61546.1"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0007264"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG527536"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR003578"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR013753"
FT                   /db_xref="UniParc:UPI00003B6CEC"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FMG1"
FT                   /transl_table=1
FT                   /translation="MMQVDYFSGIGGIPRGGGRSNSRVSSTTLPESLVSGQSDDTLNTY
FT                   GATSLKLSRSRINPFDRTLSQVESFEHMKRAHKIPDYHLKIVVVGDGAVGKTSLLISYV
FT                   EKVFKHENIPTIFENYVTNIQGPKGQIIELALWDTAGQEEYSRLRPLSYTGADVLMICY
FT                   AIDSITSLKNVEDVWFPEVRHFCPGTPVMLVGLKSDLYEEESCDSKVDPAEADSIAKKN
FT                   GAFAHIQCSAKLRVKVDNVFYAAINELLAEQLISQNHNAPILKSIFKLKKLKLSEPIDI
FT                   EEQYYDGENGGDDNDGSSSGNVAALPSTIVKKNIRKSKCIVM"
FT   CDS_pept        complement(840409..841389)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19351138"
FT                   /locus_tag="CAGL0K08338g"
FT                   /product="Similar to uniprot|Q08909 Saccharomyces
FT                   cerevisiae YOR385w"
FT                   /protein_id="CAG61547.1"
FT                   /db_xref="HOGENOM:HBG123806"
FT                   /db_xref="UniParc:UPI00003B6CED"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FMG0"
FT                   /transl_table=1
FT                   /translation="MPLFEKLIYSFSEKKTIPQQFPILLNNDQTLPPLVTYNMTRVMPI
FT                   VRKLASRSFMIFPSVQSYDIFKQKKGDSIDPDGMGIPLFEAVPSLLPTYIDGRPLLKIS
FT                   KFVLLPRDAPAPSSQYEIITQDDNYNLFKIPFCEVYYKLTGVASRRYEFQFSNPEILSP
FT                   NYIQSEAFSYSHRGTAEGFDLNWDISRIPFLVGKLVITVKQDTPPTYQNAVKGEKKQKP
FT                   SSYNYKTKTCAYYTKRFQDEVPKLISRRADLIIGELNNSHSLGITNVSIYTEIFACHAL
FT                   MIHELEHTRNNKSEKRNRRIDARDIKKEQRRERKEIRREARRHQH"
FT   CDS_pept        842615..844372
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000029869" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20197953"
FT                   /locus_tag="CAGL0K08360g"
FT                   /product="Strain CBS138 chromosome K complete sequence "
FT                   /function="RNA methyltransferase activity"
FT                   /biological_process="RNA processing"
FT                   /protein_id="CAG61548.1"
FT                   /db_xref="GO:0006396"
FT                   /db_xref="GO:0008173"
FT                   /db_xref="HOGENOM:HBG192193"
FT                   /db_xref="HOGENOM:HBG690163"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR010280"
FT                   /db_xref="InterPro:IPR016027"
FT                   /db_xref="UniParc:UPI00003B6CEE"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FMF9"
FT                   /transl_table=1
FT                   /translation="MNLLVKGSLVNIGLRSGILRRSIKRCFKMEALNNQNIEDSKKRQA
FT                   LQKNNQPLKKRPKLKRYKAKKVDPTSPLGVLQFEIDELLRENNLEKSQVENDVTAILND
FT                   TSFVTGPIASKYHREVSDVKVLKLGSNGDGLAIIPNPVETDKKQVAIVPFGLPGDLVRI
FT                   KVFKTHPLYVESDLLDVIEKSPIRKDELIKDKYFGKYSGSQFEFLDYSEQLKIKKSTIA
FT                   NAYKHFAPLLLAESLVPEISDTVASPLQYGYRTKITPHFDMPHKVKQLEVRPPLGFGQK
FT                   GRPKWRKETLEVGGTGPILDIEECALATDILNKGLSNERARFEKEFKNYKKGATILLRE
FT                   NTIILDPSKPTEEQLEEGSRDENGDISFIEVTDETTGVKLAKTCVTNTRQIVTEYVDGY
FT                   TFKFSAGEFFQNNNSILPLVTKYVRDNLQLGNGDKPRYLVDAYCGSGLFSICSSKGVDK
FT                   VIGVEISADSVSFAERNAKNNGVENCKFIVGKAEKLFESIDTPADSTSVILDPPRKGCD
FT                   ELFLKQLAAYNPARIVYISCNVHSQARDVQYFLKDTPEGKNYRVESIRGFDFFPQTHHV
FT                   ESVCVLSRV"
FT   CDS_pept        join(845535..845558,846140..846379)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000183557" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17446703"
FT                   /gene_name="RPS21"
FT                   /locus_tag="CAGL0K08382g"
FT                   /product="40S ribosomal protein S21 "
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="rRNA processing"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="CAG61549.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006364"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG499967"
FT                   /db_xref="HOGENOM:HBG524262"
FT                   /db_xref="InterPro:IPR001931"
FT                   /db_xref="InterPro:IPR018279"
FT                   /db_xref="UniParc:UPI00003B6CEF"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FMF8"
FT                   /transl_table=1
FT                   /translation="MENDKGQLVELYIPRKCSATNRIIKADDHASVQINIAKVDEEGRA
FT                   IPGEYITYALSGNVRARGESDDSLNRLAQNDGLLKNVWSYSR"
FT   CDS_pept        complement(846867..849335)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248789" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19351139"
FT                   /locus_tag="CAGL0K08404g"
FT                   /product="Similar to uniprot|Q06245 Saccharomyces
FT                   cerevisiae YLR166c Exocyst complex component "
FT                   /biological_process="exocytosis"
FT                   /biological_process="vesicle docking"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAG61550.1"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006887"
FT                   /db_xref="GO:0048278"
FT                   /db_xref="HOGENOM:HBG059821"
FT                   /db_xref="HOGENOM:HBG396910"
FT                   /db_xref="InterPro:IPR009976"
FT                   /db_xref="UniParc:UPI00003B6CF0"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FMF7"
FT                   /transl_table=1
FT                   /translation="MNSLYELDPRWKKLIHDPNNFLGGLTVEEFVQEVGRDRDPVDSTA
FT                   WNKKLDPKPYIRTFESILKELTSLQERMDNDKQMMADAVSKQELAYSSKVLNLSSGLGK
FT                   LVDNYNYLDNKLTSINQMVSPLSEKLQNSIKKKKNYIKSIELIIQYNTFLKNGKSEYVD
FT                   NMLNSKKLANRLNAAVLIKNQLLLARKIETNSIPATKSTTSTIEKYAEEMENEMLTKFN
FT                   NAYRENNFTQLNEIALILNHYNDGINVIQSFINQHNFFLDSDEVNKSMTGESPYLSEDV
FT                   RDKLMDPNYHIIVYSQELVDMLKNIEEVIKNESKIVKRVFEDSASYVLQLFIQRTFAQK
FT                   IEPQLEFLLNSALSFSHLAYVRTLHSLYSLLGKFVKDLTDYFQLLEVENEANLQAALEQ
FT                   CYTDFFSRWLFDRSKYFDIEKRSLEIILIEMTSRFNTLHEKDIRQRLLTNKFKASTNDS
FT                   PETRINELSTTNTANSKLSQITTFMKSRIDKDILPVSRSRSVKENENGSPIDHAGDDGY
FT                   NLETVDAIIKCIVEAIARVMELIPNKATSCIYEILELASMGIIGSYVKNALEVAYCSIS
FT                   KPEQNKVDEIDLSSMKYISITTEILSLLSTLIKSVCLPLLSNYPDVKKKVIIATNSQVK
FT                   NCEVMINLIMEEVFQQFSNKFIASLSKQKRKDFLPKSLDLLDQDTQPAVEIVNLLNSTY
FT                   SQVSQHLKSQNLTTFLSTIGEDLYRLLLDHYGKFQVNSTGGIIVTKDIIGYQTTVDDWD
FT                   IPDLSEKFATLRELANLFTVQPDLLDSLTKEGHLAHMSRGIIQTYIANREDFNQDNFMS
FT                   NMKQSLRQYT"
FT   CDS_pept        850532..851224
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000160229" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17446704"
FT                   /locus_tag="CAGL0K08426g"
FT                   /product="Strain CBS138 chromosome K complete sequence "
FT                   /biological_process="transport"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAG61551.1"
FT                   /db_xref="GO:0006810"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG333344"
FT                   /db_xref="HOGENOM:HBG372468"
FT                   /db_xref="InterPro:IPR009038"
FT                   /db_xref="UniParc:UPI00003B6CF1"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FMF6"
FT                   /transl_table=1
FT                   /translation="MGNRIEKELRVVGGEDIVRFYSHSISYNKGKMLFGILVALFLSVV
FT                   SAHNVLLPPHGRRCFTEKLGKGDELSITFQFGDRDPESSHQLTGDFTLTGVDSNTLHKT
FT                   LRDVSHGDVVFSAPHSGNFEYCFSNENSNIKTKDVTFNMHGIVYVDLDDPNANTLDSAV
FT                   RKLAKLTNEVKDEQSYIVIRERTHRNTAESTNDRVKWWSIFQLGLVVANSLFQIYYLKR
FT                   FFEVTSFV"
FT   tRNA            complement(851546..851617)
FT                   /gene_name="tRNA-His (GTG)"
FT   CDS_pept        complement(851940..852119)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17446705"
FT                   /locus_tag="CAGL0K08470g"
FT                   /product="Similarity"
FT                   /protein_id="CAG61552.1"
FT                   /db_xref="HOGENOM:HBG123807"
FT                   /db_xref="UniParc:UPI00003B6CF2"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FMF5"
FT                   /transl_table=1
FT                   /translation="MSMFAMGCPDVIQIIQLCGGKSTEGSSYHELIRGYSIACIDVLVS
FT                   RLLVDICRHSFSRD"
FT   CDS_pept        852307..854004
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000001080" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17446706"
FT                   /locus_tag="CAGL0K08492g"
FT                   /product="Similar to uniprot|P34248 Saccharomyces
FT                   cerevisiae YKL100c"
FT                   /function="aspartic-type endopeptidase activity "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAG61553.1"
FT                   /db_xref="GO:0004190"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG123808"
FT                   /db_xref="HOGENOM:HBG202308"
FT                   /db_xref="InterPro:IPR006639"
FT                   /db_xref="InterPro:IPR007369"
FT                   /db_xref="UniParc:UPI00003B6CF3"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FMF4"
FT                   /transl_table=1
FT                   /translation="MSSPFRAAAEQVLAKFLSPHSNETTTVDSELVDVFNKVNTFMSTN
FT                   QSQLNKVFDRWVDRTTFSFTQLISTHPSLYACVGMLAFALTVVTLGSFTSIKSIPHTAL
FT                   PPTKYDPLFDPTDFDLDTESIIVHKNETDAQKKKDGHKLANYDKIDVRHSLLIPLSCGA
FT                   VLMTLYFFIKRLQVRWLSIIVKGLTYQSILSHTFAATFVYNYLIQSFIRNLSYLFKFNP
FT                   LKILPRCRLTVSDDNVEIHQTGAVSNLCYKNQISGKIQEAKRVEKIKKTSWESHMYRRE
FT                   LKAPSSVKSDSQILNVYMSDATIYSFIFACIISALYFWFPRNWMLTNIVSLNLSVWTIS
FT                   QLNLKNLKSGTMILLVLFFYDIYFVFYNDVMVTVATQLELPFKLSIPVKFNPASKKFDF
FT                   SFLGLGDMIIPGMFIAMCYKFDIWKWHLKNVDREFHLLNWGYIGTYFKVALISYALSMV
FT                   TCMLCLNIFNVAQPALLYIVPFLLISISVVAKFNNDFKDMWNLQFDVIEIDDEKLSSGR
FT                   LEKEDQLTYSELLESDYIEDSDTDVNSDFTPESDDDLSLSDDDDEAED"
FT   CDS_pept        complement(854143..858612)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000112964" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17446707"
FT                   /locus_tag="CAGL0K08514g"
FT                   /product="Strain CBS138 chromosome K complete sequence "
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="CAG61554.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG123809"
FT                   /db_xref="HOGENOM:HBG202307"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="InterPro:IPR020636"
FT                   /db_xref="InterPro:IPR020671"
FT                   /db_xref="UniParc:UPI00003B6CF4"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FMF3"
FT                   /transl_table=1
FT                   /translation="MSVLIPHQQQRLRASSAAKKAAWNAMNKTVNIVSPHNNVNYVKKP
FT                   SPKTNSNHLDRVIKSVNDATKRLSEAESINSNNTKSSKRKSRDTVGPWKLGKTLGKGSS
FT                   GRVRLAKNIENGTLAAIKIVPKRTYNRRMRDQKMKTAGGVSSGTDSKDSSNREDPIKNG
FT                   TDSALNPYGIEREIVIMKLISHPNVMGLLEVWENKSELYLVLEYVDGGELFDYLVSKGK
FT                   LSEPEAVHYFTQIIQGVSYCHSFNICHRDLKPENLLLDKKNKVIKIADFGMAALELPNK
FT                   LLETSCGSPHYASPEIVMGKPYHGGPSDVWSCGIILFALLTGHLPFNDDNIKKLLLKVQ
FT                   AGRFQLPPYLTNDAKDLITRILVTNPEKRLTINEILNHPLIKKYRNPPAHIRKLNLLGR
FT                   GKSNSDLHVLEYNTPATVCLNSEEDIDQSILKSLQILWHGTPRQRLVERLLVEGATEEK
FT                   LFYSLLFQYKLKHSKPISATKLQKKIEDVVLENESTKTESKDSSNEPGIDNNNDTSDFT
FT                   QDGNSSEMVNELHTSAPMLEQKSQFSQHSLKSKETVPISDLPPLPPVIPTFAASSSKAF
FT                   RRSKSNLSSYLKRPKLENARSRTSLFNSSSNTSITSSSISELNTRPRGNIPLSPSNITL
FT                   TSLVSSRSLHNSASKKSLKNLQKRTLQNSESKRSLYSQTSISKRSLNLNDYLIGGPSNS
FT                   AELPPLPKLDSNNEFEMLCDKILNTSALDNILEEEEEDITPSKNTTQTNDVHNEDTIIR
FT                   KEMHDFEINVNNHQPEFKRQPSDFSVNGPDTSIFSIEPMPEGLGISKKPVRVQPTFNFI
FT                   IDEDKVDDSIKVKQVSGTGPSNNVLKDISNQINNGKGIENSKLHPTSNNNYKNIRNVTA
FT                   PEGNFTSKTFSLDPRRNVSQPPKESLFHSLLNNKSSKNAEENTQFESKSKQYNFMNKTA
FT                   HSEFEKERLNAHRDADRSNDQNVYNETSVLAQSSTIHESPLLSIPSTLLNTSMTFKNLV
FT                   DMLQENKLDDINETVAKESSAPLRKKSTKLSLAPHSNLVSDLNKRTSGYNTLASVDRSS
FT                   SDLSYAIDLPTNTNIAEIVYLSGNNKQSSEKNIFMLSNDNNETELFHTDENKTSIKSAV
FT                   NIFEDPPSDSTSLQTSSSESDSIPKVQRKAVSIETLNASNIITPAADVRVSLYGNNVSN
FT                   SNTMPRETTEELISRFKLTPEKPQHQVQKRFSSLTQTGRNTDSIALSQSMISMFKDAEE
FT                   NGNNKSVKVLDQVEEENASKLTPTSPKNRVTMLFDDYEAQQNITSDQSNKSSKVIEIPN
FT                   DSPIKVKVQKASTIFEKEIISAAEADENDHLRIPYESKSKKEIAQVHQQEQKEQQVRKP
FT                   TESQEKAVQKTTKPSWFSKLIHGFKTTGGSGHTKLIREHSTKMTFEEVHMITVKEFGNN
FT                   GIDYQLRTLDKKGDREKVEYDCKFVKGNFEFKIKIFNSGFPHQNTIITVKKKGKINSKE
FT                   TTDLFQRFNANIENLIKSAERNIESNPK"
FT   CDS_pept        860741..862270
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000253244" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17446708"
FT                   /locus_tag="CAGL0K08536g"
FT                   /product="Strain CBS138 chromosome K complete sequence "
FT                   /function="aminopeptidase activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="proteolysis"
FT                   /cellular_component="vacuole"
FT                   /protein_id="CAG61555.1"
FT                   /db_xref="GO:0004177"
FT                   /db_xref="GO:0005773"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG011112"
FT                   /db_xref="HOGENOM:HBG630643"
FT                   /db_xref="InterPro:IPR001948"
FT                   /db_xref="UniParc:UPI00003B6CF5"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FMF2"
FT                   /transl_table=1
FT                   /translation="MEEQRQIIEQLKQTLNALTVSQNTTSNKTPADEPFYHINEHTYED
FT                   CAQEFIDFTYENPTTYHVIEFFSKLLEGKGFKYLPEKKTWNDELEPGKPGRYYTIRNGT
FT                   NMTAWVIGKKWKPESGVGVVASHVDSLTAKLKPASLMEKVEGYKLFGVAPYGGTLNELW
FT                   FDRDLGIAGRVLYKKKNSSKVESTLVNSAPHPIGRIPSLAPHFGQPSEGPFNKETQAVP
FT                   FFGWCCDIDDEGTITDEEKKCPLVGKHSILLLRYIAELAGIKVSEILQLDLDLFDVQKG
FT                   TFGGIKKDFIFSPRMDDRLCSFTAMIAMAYYGATVDLDELSSFNMVALFDNEEVGSLTR
FT                   QGAESTLLKTSICRTAKRFTNMEGLEPPTLFANSIVLSADVNHLFNPNFKEVYLKKHSP
FT                   KPNWGMTISLDPNAHMATDVVGLAFVEELARKNKDTVQYFQIRNDSRSGGTVGPIVAAQ
FT                   LGARTIDVGISQLSMHSIRAATGTKDIAMAIKFFRGFFDNWREVYDNFGEL"
FT   CDS_pept        863000..865171
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000258898" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17446709"
FT                   /locus_tag="CAGL0K08558g"
FT                   /product="Strain CBS138 chromosome K complete sequence "
FT                   /function="glutamine-fructose-6-phosphate transaminase
FT                   (isomerizing) activity"
FT                   /function="sugar binding"
FT                   /biological_process="carbohydrate biosynthetic process "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAG61556.1"
FT                   /db_xref="GO:0004360"
FT                   /db_xref="GO:0005529"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0016051"
FT                   /db_xref="HOGENOM:HBG409912"
FT                   /db_xref="HOGENOM:HBG645312"
FT                   /db_xref="InterPro:IPR000583"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR005855"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="UniParc:UPI00003B6CF6"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FMF1"
FT                   /transl_table=1
FT                   /translation="MCGIFGYCNYLVEKSRGEIIDTLVDGLKRLEYRGYDSTGIAIDGD
FT                   ELDSTFIFRQIGKVSSLEKEIALQKPNRDVTFVSHSGIAHTRWATHGEPKQINCHPQRS
FT                   DPNNEFVIVHNGIITNFRELKTLLLNKGYQFESDTDTECIAKLFKHLYDTNLKNGHDLD
FT                   FHELTKLVLLELEGSYGLLCKSNHYPNEIIATRKGSPLLVGVKSEKKLKVDFVDVEFPD
FT                   ESMGKPDTPLVSASGEAINNNNVTVSGRNARHVEANAHNNNLMPIAANDFNLRHSQSRA
FT                   FLSEDGSPTPVEFFVSSDAASVIKHTKKVLFLEDDDIAHIYDGELHIHRSRKEVGASMT
FT                   RSIQTLEMELAQIMKGPYKHFMQKEIYEQPESSFNTMRGRIDFENKNVMLGGLKAWLPV
FT                   IRRARRLIMIACGTSYHSCLATRAIFEELSEIPVSVELASDFLDRRSPVFREDVCIFVS
FT                   QSGETADTMFALNYCLERGALTIGIVNTVGSSISRVTHCGVHINAGPEIGVASTKAYTS
FT                   QYVALVMVALSLSDDRVSKIERRKEIIDGLKLIPGQIKQVLNLEDKIKKLCVTELKDQK
FT                   SLLLLGRGYQFASALEGALKIKEISYMHSEGVLAGELKHGVLALVDENLPIIAFGTRDS
FT                   LFPKVVSSIEQVTARKGKPIIICNENDDVWAKKAEQINLVTLEVPQTVDCLQGLLNIIP
FT                   LQLMSYWLAVNKGIDVDFPRNLAKSVTVE"
FT   CDS_pept        complement(865470..866831)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000185898" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18503374"
FT                   /locus_tag="CAGL0K08580g"
FT                   /product="Strain CBS138 chromosome K complete sequence "
FT                   /function="pyridoxal phosphate binding"
FT                   /function="transaminase activity"
FT                   /biological_process="biosynthetic process"
FT                   /biological_process="cellular amino acid metabolic process "
FT                   /protein_id="CAG61557.1"
FT                   /db_xref="GO:0006520"
FT                   /db_xref="GO:0008483"
FT                   /db_xref="GO:0009058"
FT                   /db_xref="GO:0030170"
FT                   /db_xref="HOGENOM:HBG122224"
FT                   /db_xref="HOGENOM:HBG446828"
FT                   /db_xref="InterPro:IPR000796"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniParc:UPI00003B6CF7"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FMF0"
FT                   /transl_table=1
FT                   /translation="MTLNYASVQCVLRMRSAVMLGRRRLSRKALKQSTLFDIPMAPPDG
FT                   VLGLTETFNADENPNKINLTVGVYKDGWGQVTTFPSVAQAQKIIDMDVGMNTDLSYLPI
FT                   SGCEDFKKHTINFLYRDSCPQDGPALIKNDRISFIQTLSGTGALAVASRLLSSFISRKI
FT                   WIPKPSWPNHTNIFTQNGFTNPRFYSYYDRGDLTIGRWLQELRHEVGKDSNTKTPHCIV
FT                   LHACCHNPTGLDPTKKQWEDIMDTIYELGMIPIIDMAYQGLESGKLIDDAYLLRLCLDT
FT                   SRYRSWDNGLYLCQSFAKNMGLYGERVGSLSIVAPEHVPGVKEVLDSQLKQIIRSMYSS
FT                   PPGYGSRVAKLVLSNDKLKYQWYSDVETMVNRLKSVREMIHERLQWEEIVNFEQQHGMF
FT                   YFTKLGPDIVKKLREQYSIYLTNDGRMSLSGVNKSNVDYLCNSIKAVTSSKTLL"
FT   CDS_pept        complement(867311..868363)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000001079" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21046831"
FT                   /gene_name="SLD2"
FT                   /locus_tag="CAGL0K08602g"
FT                   /product="DNA replication regulator SLD2 "
FT                   /biological_process="DNA replication"
FT                   /biological_process="cell cycle"
FT                   /cellular_component="cytoplasm"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG61558.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006260"
FT                   /db_xref="GO:0007049"
FT                   /db_xref="HOGENOM:HBG058138"
FT                   /db_xref="HOGENOM:HBG202304"
FT                   /db_xref="InterPro:IPR021110"
FT                   /db_xref="UniParc:UPI00003B6CF8"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FME9"
FT                   /transl_table=1
FT                   /translation="MDMDVQQVKLKIKRWEHAFIAEHNRPPDKDDIRPLTEMKQLYKLY
FT                   SVLKSKERKAEPIQKQQTPRKDSNMVLGPTPQIYGKAVSIFEMKVSPLKVEETPTTEVE
FT                   EDIESEIESSVNRRNSDEASANEEKLGIHSVKKRLFESPKKTENTTHLAVPQVTRYGPN
FT                   SPLKLAQTVSIRQHLLTPKKKKAEPKSLYTPSPLLKRNSSKTLYELAHEHLQYVEEIKE
FT                   LDQQFKSEIVPIRHGNGQDIGDESDEVPEKKKRRTGVLRRLQFDEDENDRTIKKDLHKE
FT                   LLKLKSRKVKEFLGKEDNEPSEEEEEEQQKSEPLPVKKKKPKKYNLVSNNFRRLKLPKK
FT                   NRNPRFGRRR"
FT   CDS_pept        complement(869340..870380)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17446710"
FT                   /locus_tag="CAGL0K08624g"
FT                   /product="Strain CBS138 chromosome K complete sequence "
FT                   /function="DNA binding"
FT                   /function="transcription regulator activity"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG61559.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0030528"
FT                   /db_xref="HOGENOM:HBG123810"
FT                   /db_xref="InterPro:IPR018287"
FT                   /db_xref="UniParc:UPI00003B6CF9"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FME8"
FT                   /transl_table=1
FT                   /translation="MHPVPIAPNLHRPSTGSARLVVRTSKNWVLPPRPRPNRRNTIHSG
FT                   ANSSHTHTNNTHTNNAGNASSATTAVNSAATSAASTPAPPKRKRENSLPVNLKKVKKDY
FT                   NRVENCLAFLKFDDEEDTTTTSTDIDDDLFSNTSPVSSTCTPLTSASLNLKSVPFNGAS
FT                   AVSGVGMLNLSAGKNGAQKKQQRAKSAQYSYKPSSKDDSKYGNESTLDGDLDLEMEMSM
FT                   NLDDNINATSFTTATESKPEFFTINNITNATTSASPALNDPVTTDSSLSAKELEDFYNY
FT                   IPPSLEELIDEQDAHSKNNNGLFRDSLMSKSYESMNLMMFNDPSNTARQQDDLIVDTDG
FT                   DMFAFI"
FT   CDS_pept        873022..873969
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000247843" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20197954"
FT                   /locus_tag="CAGL0K08646g"
FT                   /product="Strain CBS138 chromosome K complete sequence "
FT                   /protein_id="CAG61560.1"
FT                   /db_xref="HOGENOM:HBG023828"
FT                   /db_xref="HOGENOM:HBG622381"
FT                   /db_xref="InterPro:IPR013641"
FT                   /db_xref="UniParc:UPI00003B6CFA"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FME7"
FT                   /transl_table=1
FT                   /translation="MPLVLMCGFPLSGKSTVARELAGYLREKGANVVVHSDETLGHKGR
FT                   ETREEDYNDTHAERKLRNEIMSAVRRDLSRSTIVIVDSLNYIKGFRYQLHCECKNSNTG
FT                   FMLVHCMATYADILKRDENGEESPRWGKELLDQLIQRFEEPDASNRWDSPMATVVSPET
FT                   LLPTHKQLVDQVLLGISDKSSSRNGSPSPGPMNRLSQNNPTLLKAATGADFVRLLDAKL
FT                   TETVRIIVRECQAAQAIGGPQRIIVSEDVRDINDDRCLFLDIPADAPQLTLPRLNRLKR
FT                   QFVQMNKNLRDVDLERAAPLFVAYIGQTLQSGLA"
FT   CDS_pept        875357..876019
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000974" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17446711"
FT                   /locus_tag="CAGL0K08668g"
FT                   /product="Strain CBS138 chromosome K complete sequence "
FT                   /function="protein dimerization activity"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="sequence-specific DNA binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG61561.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0043565"
FT                   /db_xref="GO:0046983"
FT                   /db_xref="HOGENOM:HBG123811"
FT                   /db_xref="HOGENOM:HBG203014"
FT                   /db_xref="InterPro:IPR004827"
FT                   /db_xref="InterPro:IPR011700"
FT                   /db_xref="UniParc:UPI00003B6CFB"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FME6"
FT                   /transl_table=1
FT                   /translation="MGLENTELPSSVLGVSERIRSMIMENSELGSRLVSLLLVNSGNAA
FT                   EIIESINKGGASNVRSKSKHKSNEVKPVVAGAQSDRDYTYKNTTEDARVSGDDDEDAVV
FT                   TTSSQWDNRAITTTGGHSSANSEDEVEDNESLLLKALEKRRKNSEASARFRIRKKQRRM
FT                   ENLEKLAQLNSHIDDLNKKIDGLLQENRHWKSKLEEINEQKSKQLLEQIKKKNGILL"
FT   CDS_pept        complement(877494..879137)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17446712"
FT                   /locus_tag="CAGL0K08690g"
FT                   /product="Strain CBS138 chromosome K complete sequence "
FT                   /protein_id="CAG61562.1"
FT                   /db_xref="HOGENOM:HBG123812"
FT                   /db_xref="UniParc:UPI00003B6CFC"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FME5"
FT                   /transl_table=1
FT                   /translation="MDYLQEIKEEVRLQERSESLGLGLQLMTPTESIHEAQEILESRDA
FT                   DITMADLSKALEIPTTPVVEIESVFADSPLLLHAVDTTPIAHGGSDIGLGFLPASPVVQ
FT                   KLRSNSYSASINNNMTYHFNATILSNVADTTNTGTTASMGANSPNPNLLSPRSLGSSFK
FT                   KHVVQRGASVDAVSLDLHTREYTAESPGYFDIGDSKRNSLQKFRSSLNIATAHSSSKLL
FT                   QRRNSRASISASSPMSNLGYFEDYNHNYTRSRKGSIASATTTVTQRNTSLGSNVRRSLS
FT                   KIASTTGTIKRAFSSASLNANNAKTANPEGNSNDNGFHETMSHSFSRMSQNSGRNSVAD
FT                   VRNGMFNLHISRENSAYLEPNTISDDELSNSSSTFTNKMLLEDGYSLQNSTPVENWSNT
FT                   GFVGIKSQGNYREDRGEDDKFLVDIDKLTTEVPVISVTDRLGSKNSTPLIEQSSIVNAE
FT                   VKCKGRNRNNSNASSLASGSTQKMGLDEYIKVLIGQQNLEDERLEYLEKRFKECGWCSE
FT                   EELQTIRRKRVMINRKWANKISRYQNKLEL"
FT   CDS_pept        complement(879866..880252)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19351140"
FT                   /locus_tag="CAGL0K08712g"
FT                   /product="Similar to uniprot|P40571 Saccharomyces
FT                   cerevisiae YIR015w RPR2 RNase P subunit "
FT                   /protein_id="CAG61563.1"
FT                   /db_xref="HOGENOM:HBG123813"
FT                   /db_xref="InterPro:IPR007175"
FT                   /db_xref="UniParc:UPI00003B6CFD"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FME4"
FT                   /transl_table=1
FT                   /translation="MAKVKKGKGKGNGGGREHFQRVNYLAQLSRHVAQATGDVSLTQLY
FT                   NRNLVQVSHKTKTRLSPSLKRSMCKQCKIAQIPTITTKVSVEKHTGCLAIECQCHQRPH
FT                   KSKRVNNKRSVKRFPINACRSLDH"
FT   CDS_pept        complement(880549..881325)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19351141"
FT                   /locus_tag="CAGL0K08734g"
FT                   /product="Similar to uniprot|P40570 Saccharomyces
FT                   cerevisiae YIR014w"
FT                   /protein_id="CAG61564.1"
FT                   /db_xref="HOGENOM:HBG123814"
FT                   /db_xref="UniParc:UPI00003B6CFE"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FME3"
FT                   /transl_table=1
FT                   /translation="MVLVVEAFGSENEVKGVSVMRNLHMLCYVVIYLRFVRDRSVLNML
FT                   LVYIALSLAGFLKDLLVSYLHRQLETMRDGESYRRNSNDGNGLLETEVIRTILIKSVRY
FT                   LQILIVAEALYCVMYHGYSGSPLFYYDSPGKVGDVVEPAFHYKYGYFIMNLIGEEMPYM
FT                   SSRWKLLAIDVVLLILQLVVITKSLEPELDGIKLIIPELRTHQLGMASILLFNTTSSQD
FT                   SSRLITLCTCQEPDRCEHNTSPSALPRTERRSYGAT"
FT   CDS_pept        881947..882996
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17446713"
FT                   /locus_tag="CAGL0K08756g"
FT                   /product="Strain CBS138 chromosome K complete sequence "
FT                   /function="protein dimerization activity"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="sequence-specific DNA binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /protein_id="CAG61565.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0043565"
FT                   /db_xref="GO:0046983"
FT                   /db_xref="HOGENOM:HBG123815"
FT                   /db_xref="InterPro:IPR004827"
FT                   /db_xref="InterPro:IPR011616"
FT                   /db_xref="UniParc:UPI00003B6CFF"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FME2"
FT                   /transl_table=1
FT                   /translation="MLTALGSMGENYPVLRPKDSVAEKMAMSKIHISKKWKLPPLRPKG
FT                   SHERAKPSPSMDAGAKVSPAGDSPTGEDSKHMSGPNRKRLQNREAQRAYRERSRNKLQT
FT                   LEDNVETLQGMVKMWQSKYKQLASEFDQYKQSSNEKIVELEKTISESKEDSKCYICMKN
FT                   VDLDGLKENARNEDIKPFFQDEFLSNAIKNFQPMEAVSLKRKQEKNSSSPSITPRSSTT
FT                   SFAAVLNDVDKGNCGFCNDNTACVCRDITSTLSAKPPQRRSDILLDTMSKSGLSTESIK
FT                   SNYAVSALRSTHCSENPSKCTKCSDIDTSCLKSVPADNKRSSIYMEELPMEFEVNLNDL
FT                   FPSPKRQRT"
FT   tRNA            complement(883144..883216)
FT                   /gene_name="tRNA-Thr (AGT)"
FT   CDS_pept        883874..884401
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000201071" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19351142"
FT                   /locus_tag="CAGL0K08800g"
FT                   /product="Similar to uniprot|Q03677 Saccharomyces
FT                   cerevisiae YMR009w"
FT                   /function="dioxygenase activity"
FT                   /function="metal ion binding"
FT                   /biological_process="L-methionine salvage from
FT                   methylthioadenosine"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAG61566.1"
FT                   /db_xref="GO:0019509"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="GO:0051213"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG020936"
FT                   /db_xref="HOGENOM:HBG660685"
FT                   /db_xref="InterPro:IPR004313"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniParc:UPI00003B6D00"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FME1"
FT                   /transl_table=1
FT                   /translation="MVEIYVHDENDSVDFRQPHNSGKTVALEDLGKIGVIYKHIADQAD
FT                   VDILAKERNYKNRDIVTINVDTFKGDKNALEKQLGIFYKEHLHEDEEIRYCIEGSGYFD
FT                   VRNGKDDVWVRCKVGPGDLLILPAGIYHRFTLTETNHIKALRLFKDEPKWQAYNRPDAD
FT                   SLPVRHEYLQSI"
FT   CDS_pept        884999..886354
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248556" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18503375"
FT                   /locus_tag="CAGL0K08822g"
FT                   /product="Similar to uniprot|Q03687 Saccharomyces
FT                   cerevisiae YMR010w"
FT                   /protein_id="CAG61567.1"
FT                   /db_xref="HOGENOM:HBG058703"
FT                   /db_xref="HOGENOM:HBG396015"
FT                   /db_xref="UniParc:UPI00003B6D01"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FME0"
FT                   /transl_table=1
FT                   /translation="MDGAELIQEHELAAVEQIAEAAAESAKNQDSYVVTLTSYLPKLDQ
FT                   FYIPEWLTMRVLTGYIYSCTPLFSYGAAILSIERCQTAFGFSIDICATMLIASILRISY
FT                   FFFVPYEVTLLRQSIIMVLVQLLLLRTTLKYRPEEYKYDNLQSVEPFTQLIHDVWFEYF
FT                   AIRNKPRMFSDEWKNLLRSLSFERLMGFIFKIFLVFVYKFLKFFDPSFKRVGSFWQWND
FT                   DRKYWKFLIIFATFQFSFTLLITKVIAWENFAHNVGSLIGGISLLVESLLPLPQISILH
FT                   KLKSVQGFKIILLISWLCGDTVKLSFLLSLNSGEKNVDTSSLFEFFALFQMGLDFYIGG
FT                   QYIYYKFYYNPEGTVVNGYRGTPVIGGSQDHEFMELQNEFADGPLNELNEKAFNGKEHR
FT                   SNSTPKRKLSYSQHLSKTPSSSRKASIGNIEVSSPRRGHSKSYTFSSEKSAT"
FT   CDS_pept        887412..888938
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248644" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17446714"
FT                   /locus_tag="CAGL0K08844g"
FT                   /product="Similar to uniprot|P23180 Saccharomyces
FT                   cerevisiae YHL021c"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAG61568.1"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG058705"
FT                   /db_xref="HOGENOM:HBG397801"
FT                   /db_xref="InterPro:IPR003819"
FT                   /db_xref="UniParc:UPI00003B6D02"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FMD9"
FT                   /transl_table=1
FT                   /translation="MIRSHMRRFRHNAATSLLRHTRLYSQASGKILDASFTDESTTVTF
FT                   LHESMVQPNDSVPTSLDATPDTQDKIRPFTVCFNNIFLRDASKSPKTVDPVSGQRLVTT
FT                   AELLDEHNGRRATVPRSVNISEDGKRLVVDWSDGDSYAYDLDFFFKYKGSSFLTKSIRN
FT                   QMSKHKRVFWNRDLLNSKIDKNRDGSFFSFDQVMNDDKLLYRTLVNLQQFGITFISGMP
FT                   TIRDETDANDANIYMVRNLCERIGPLRKTFYGEVFDITNQNLKDYDQDLPPPHDYNIPF
FT                   ENIASPLHMDLQFLENVPGFKILHALKNESENDTNIFVDSLYAARNIRETDNEAYEALQ
FT                   HVPINYTFKNKNKRYYQSKPLVEEYESNEHNTLIGNYEYLVKCVNYSPPFQAPFTYGIY
FT                   NKLTNVPKIEGIEDPLTTSPGKVTERLVFRDFLRGLQQFEKMVYDHENQLRINLPENTA
FT                   VIYNNRRILHTRTNHNTRQSDLVWFKSCYFDLDTFKSKLKFLEEAFEKSK"
FT   CDS_pept        889559..890548
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000209236" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21046832"
FT                   /gene_name="RPN8"
FT                   /locus_tag="CAGL0K08866g"
FT                   /product="26S proteasome regulatory subunit RPN8 "
FT                   /cellular_component="proteasome complex"
FT                   /protein_id="CAG61569.1"
FT                   /db_xref="GO:0000502"
FT                   /db_xref="HOGENOM:HBG474324"
FT                   /db_xref="HOGENOM:HBG524656"
FT                   /db_xref="InterPro:IPR000555"
FT                   /db_xref="UniParc:UPI00003B6D03"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FMD8"
FT                   /transl_table=1
FT                   /translation="MSLHHDNVTIAPLVLLSVLDHYERTNTPEGKRCVGVILGDSQTNT
FT                   IRVTNSFALPFEEDEKNSDVWFLDHNYIESMNEMCKKINAKEKLIGWYHSGPKLRASDL
FT                   KINELFKKYTQGNPLLLIVDVKQQDVGLPTDAYMAVEQVKDDGTSTEKTFLHLPCTVEA
FT                   EEAEEIGVEHLLRDVRDQAAGGLSIRLTNQLKSLKGLQKKLNDIVIYLNKVINNELPVN
FT                   HTILGKLQDVFNLLPNLGYNEETDVSATSNDMVTASNNLQRALTVKTNDELMVIYITNL
FT                   VRAIIAFDDLIENKMQNKKLQEERNKELQADINKVESETAETEKVATD"
FT   CDS_pept        complement(890872..892476)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248845" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20197955"
FT                   /locus_tag="CAGL0K08888g"
FT                   /product="Similar to uniprot|P09032 Saccharomyces
FT                   cerevisiae YOR260w GCD1"
FT                   /protein_id="CAG61570.1"
FT                   /db_xref="HOGENOM:HBG146854"
FT                   /db_xref="HOGENOM:HBG397970"
FT                   /db_xref="UniParc:UPI00003B6D04"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FMD7"
FT                   /transl_table=1
FT                   /translation="MQIQAFIFCGRGHNLSPFAKHPNSAAVTQEDTILSDDTVPKALMP
FT                   LANKPMLEYTIDWCDQANFSEINIVAHHDQIDEIKQFLSTFLALRTQQFEIISKALSAA
FT                   NHNHHLQKPKPINFISSKMNSNGEALQKELLDKIKGDFVLLPCDFITDIPPQVLLDQFQ
FT                   NRDDDNLALTVYYKNNVESVDKKQFQRQQFFTIYSENEDTEKQPVLLDVYPKEDVMKNK
FT                   YLQVRNQMLWKYPNATVSTSILNSSIYMCSYDLCQLLREQTHQEKNNDDSEGNNVNDSP
FT                   RTKNSKGTEDYDDAQNSAHRNLSEIKPSYFKKKNELIRDNINCHKPLGKLFRDLSRRSW
FT                   QHSSKRETMGIFIIPEPCVFIRANNLNAYMEANRFILKIKAQATQSNVQTNNLSTSAIG
FT                   ADSLVGGNVTILEKSNIKMSAIAGGCKIGNRCRVAGSILLANVELEDDVILENVIIGPG
FT                   AKIGKKSKLTNCYVEGSYVLPARSTHKGETLRKIILNTDTEMDSEVAYSTSDEDSSDVM
FT                   TEEFTDEDFGDDDFFER"
FT   CDS_pept        893007..894317
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000225143" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21046833"
FT                   /locus_tag="CAGL0K08910g"
FT                   /product="Similar to uniprot|P53549 Saccharomyces
FT                   cerevisiae YOR259c CRL13"
FT                   /function="ATP binding"
FT                   /function="nucleoside-triphosphatase activity"
FT                   /biological_process="protein catabolic process "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAG61571.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0017111"
FT                   /db_xref="GO:0030163"
FT                   /db_xref="HOGENOM:HBG460402"
FT                   /db_xref="HOGENOM:HBG724153"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005937"
FT                   /db_xref="UniParc:UPI00003B6D05"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FMD6"
FT                   /transl_table=1
FT                   /translation="MSEEQDPLLAALNESNNNGGSGDNAAVSGEASAEPLEAAPEPEPV
FT                   DPEKEAYEKALRHFKKKLMEHRRYDDQLKQRRQTIRDLEKIYDKTENDIKALQSIGQLI
FT                   GEVMKELSEEKYIVKASSGPRYIVGVRNSVDRSKLKKGVRVTLDITTLTIMRILPRETD
FT                   PLVYNMTSFEQGEISFEGIGGLTDQIRELREVIELPLKNPEIFQRVGIKPPKGVLLYGP
FT                   PGTGKTLLAKAVAATIGANFIFSPASGIVDKYIGESARIIREMFAYAKEHEPCIIFMDE
FT                   VDAIGGRRFSEGTSADREIQRTLMELLTQMDGFDNLGQTKIIMATNRPDTLDPALLRPG
FT                   RLDRKIEIPLPNEAGRLEIFKIHTSKVKKSGEFDFDAAVKMSDGFNGADIRNCATEAGF
FT                   FAIRDDRDHIIPEDLMKAVRKVAEVKKLEGTLEYQKL"
FT   CDS_pept        complement(894474..895109)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248858" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17446715"
FT                   /locus_tag="CAGL0K08932g"
FT                   /product="Similar to uniprot|Q08702 Saccharomyces
FT                   cerevisiae YOR258w"
FT                   /function="catalytic activity"
FT                   /protein_id="CAG61572.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="HOGENOM:HBG252706"
FT                   /db_xref="HOGENOM:HBG397937"
FT                   /db_xref="InterPro:IPR001310"
FT                   /db_xref="InterPro:IPR011146"
FT                   /db_xref="InterPro:IPR011151"
FT                   /db_xref="UniParc:UPI00003B6D06"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FMD5"
FT                   /transl_table=1
FT                   /translation="MKWDSALQVYIDHPEKYGKDTVVYFDEDAVIIHDSFPKARFHLLV
FT                   LPRSNTLTKKHPTIGLNSSVKNQLENYVQRAIDYIYEGFTQHYQPSDKVQSIFADKDTF
FT                   IKNFLAVGIHSVPSMKNLHIHVITKDFDSPRLKHKKHYNSFNTNFFVNWIDLPLKSIPN
FT                   VKETELKYIKGSPLICSYCGQDYGSQFKKLKDHLTEEFNKHFTEIIEL"
FT   CDS_pept        complement(895464..895940)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000233018" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17446716"
FT                   /locus_tag="CAGL0K08954g"
FT                   /product="Similar to uniprot|P06704 Saccharomyces
FT                   cerevisiae YOR257w CDC31"
FT                   /function="calcium ion binding"
FT                   /protein_id="CAG61573.1"
FT                   /db_xref="GO:0005509"
FT                   /db_xref="HOGENOM:HBG483331"
FT                   /db_xref="HOGENOM:HBG746798"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="InterPro:IPR018248"
FT                   /db_xref="InterPro:IPR018249"
FT                   /db_xref="UniParc:UPI00003B6D07"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FMD4"
FT                   /transl_table=1
FT                   /translation="MSGIRMSPARGSQLTEEQRQEIFEAFSLFDMNNDGYLDYHELKVA
FT                   MRALGFDLSKREVLDLIDKHDNDRRRQIKYDDFFQEMGERMLKRDPVEEIKRAFQLFDK
FT                   NGDKKITVQDLREVAQELGENLTMEECHAMIDEFDMDDDGAINEEEFISICMDN"
FT   CDS_pept        896389..898770
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000074725" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20197956"
FT                   /locus_tag="CAGL0K08976g"
FT                   /product="Similar to uniprot|Q08693 Saccharomyces
FT                   cerevisiae YOR256c"
FT                   /function="peptidase activity"
FT                   /biological_process="proteolysis"
FT                   /protein_id="CAG61574.1"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="GO:0008233"
FT                   /db_xref="HOGENOM:HBG058092"
FT                   /db_xref="HOGENOM:HBG203862"
FT                   /db_xref="InterPro:IPR007365"
FT                   /db_xref="InterPro:IPR007484"
FT                   /db_xref="UniParc:UPI00003B6D08"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FMD3"
FT                   /transl_table=1
FT                   /translation="MDLPSEPPSYDVVNGQQSVRGEVGHASASASASASADIETGRTRD
FT                   DSFDMDIDESALYENEGDGMIGNLGSTSIPYISRIKNRLNDNIIEPVQNNIIDPLVGLN
FT                   YIVTDTVNYYVSKVGNPFILSRFIYIFIISIVAYGLLSREDPNKDHVSGTRGSFADHDA
FT                   FLNYARLTADLSKFERDLEYLSSMPHMSGTKGDTAMRQYIYQSMKNNNIHLLREWEAEG
FT                   FANYPKDDGMSLRIRPQSGEPFSIELTDVNFNPGSPNGELRDINLIYGHYGSEQDLQLL
FT                   KEAQLLKEDFVLLIKYDQYVSQQVLMAQNYGAKAIVFISDVINGNENVIKQNSVSISQY
FT                   GAGIMEIRYPNLKYSENSETYSKTMPSIPTLPLSYKQGRQLMELLHSGIKYEDKYFSGK
FT                   PGIVKVDMRVDNVLRTAQPISDFVGKIEGKEQSDRAIVIAARRNSIDNGATTSAFGTAM
FT                   MLSLIQLFQEMKFRFNWKPLRNIYFISFGGSDFNFEGSNTLVEQRLSALKEEIYAMVDI
FT                   SEVGLDFEDLGHLDIQCHPLMYDFFKSKSDHSQVDVNVLPVHDFGDWTPYLTHGIPTAT
FT                   FSKSKLKSKLLAHTKADTFERVGHLLKQSNYQEKLLDVLIFLFRSALLLVDKPVIPFEV
FT                   STFVTELDSMLNDLEISHKGQIRFDTIIKGLLMWKRLGKECTAWKHEWSNIVENLDNGM
FT                   EPSLFSVHRWAWNKKITNIGRRLCAPNGLTDRNNYKNVIFGPTLFANNKDLLNWSFPGV
FT                   RDAIYKQDYNKAQEELDGIGEILMNAAKIFSEETTDSSYK"
FT   CDS_pept        complement(898883..899623)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000066005" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20197957"
FT                   /locus_tag="CAGL0K08998g"
FT                   /product="Similar to uniprot|Q08692 Saccharomyces
FT                   cerevisiae YOR255w"
FT                   /protein_id="CAG61575.1"
FT                   /db_xref="HOGENOM:HBG058093"
FT                   /db_xref="HOGENOM:HBG202894"
FT                   /db_xref="UniParc:UPI00003B6D09"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FMD2"
FT                   /transl_table=1
FT                   /translation="MRAPPPQRKSKSRYFAPYFVNIRELLRFRKIKAFWNRQKLFKKQF
FT                   ENLHQVYQQRYNSSIDSHPDGQVALCNHENLTQITPISGIRIEDMCCLSSTHESQSADK
FT                   KPLLIATFPRGCNRSPTVRILKRNKWSWLPISKRKYKLSFFNNEIFDPQLHSKSIEVKS
FT                   HTCANTVRMIRKYAHEKANVKIIFHNRNIIKSKFLDGHEDAIRPPSYIEFGNNHTLRIE
FT                   DFRSLKRKRPRKNTHKQSYYQTIR"
FT   CDS_pept        complement(899951..900457)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000238056" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17446717"
FT                   /locus_tag="CAGL0K09020g"
FT                   /product="Similar to uniprot|Q08689 Saccharomyces
FT                   cerevisiae YOR253w"
FT                   /function="N-acetyltransferase activity"
FT                   /protein_id="CAG61576.1"
FT                   /db_xref="GO:0008080"
FT                   /db_xref="HOGENOM:HBG397974"
FT                   /db_xref="HOGENOM:HBG530048"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniParc:UPI00003B6D0A"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FMD1"
FT                   /transl_table=1
FT                   /translation="MGRSIINLDNVYENNLGMMAKIAKIVYPNQQFEESFFSELFKGGN
FT                   DKKKEAYMAQIAYYSEIPVGTIKLLLLQKKKSDSLQKGLHIELLAVLEKYDDHEIKEKL
FT                   LEYALDECKKNHQHKLFTATRSSDEQLMNWYKEHGFTETGSKGEPVTLSDGTSEETVLL
FT                   IRELD"
FT   CDS_pept        complement(900862..901326)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000074723" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17446718"
FT                   /locus_tag="CAGL0K09042g"
FT                   /product="Similar to uniprot|Q08687 Saccharomyces
FT                   cerevisiae YOR252w"
FT                   /protein_id="CAG61577.1"
FT                   /db_xref="HOGENOM:HBG058096"
FT                   /db_xref="HOGENOM:HBG395749"
FT                   /db_xref="InterPro:IPR021346"
FT                   /db_xref="UniParc:UPI00003B6D0B"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FMD0"
FT                   /transl_table=1
FT                   /translation="MRESKVQEKKRAHNEKRSNELARVKFIQDVIKSDSFKDKKNFSYE
FT                   EAAVFIEQFINRDDPELEQFKKKQRSNRPTPNRQLLLEQKKKLEMEEFKKGFLCPDLAD
FT                   EQSVVFLRNWNGTFGAMSTFKMIRINNEGKQVVGGHNKFTGSENNEIEMA"
FT   CDS_pept        901778..902686
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000157237" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17446719"
FT                   /locus_tag="CAGL0K09064g"
FT                   /product="Similar to uniprot|Q08686 Saccharomyces
FT                   cerevisiae YOR251c"
FT                   /protein_id="CAG61578.1"
FT                   /db_xref="HOGENOM:HBG289502"
FT                   /db_xref="HOGENOM:HBG709927"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="UniParc:UPI00003B6D0C"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FMC9"
FT                   /transl_table=1
FT                   /translation="MSLFKLITPCAFVELTKASKKVVPVDSTWYLPNLKRDGKQEFMDV
FT                   ERIPGAVYFDIDDIRDSASEFPHMAPDLATFNEGMSQLGVNKEDILVVYDRIGNFSAPR
FT                   CAWTLVMLGHPEVYLLNNFNAYKKEGYPLDTTKWTKLTQYPKSNYKSETNLCPENVITY
FT                   EQMLELVKSGELKKKYNVYDARALNRFEGKAPEPRPDISSGHVAGVQPLPFTEILDQPD
FT                   LTFPQEQVDMEKKVQEAFKKLNNTYDPSKPTIVMCGTGVSACIIRTALEHSGVKDIKLY
FT                   DGSWVEWVLRSDPKLIAKDRE"
FT   CDS_pept        903073..904428
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000231935" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21046834"
FT                   /gene_name="CLP1"
FT                   /locus_tag="CAGL0K09086g"
FT                   /product="Protein CLP1"
FT                   /function="ATP binding"
FT                   /biological_process="mRNA processing"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG61579.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006397"
FT                   /db_xref="HOGENOM:HBG211231"
FT                   /db_xref="HOGENOM:HBG396677"
FT                   /db_xref="InterPro:IPR010655"
FT                   /db_xref="UniParc:UPI00003B6D0D"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FMC8"
FT                   /transl_table=1
FT                   /translation="MAEVEALPGLKQPVDDAGLLEDANQVHTLVIPSGHIWRVELSSDE
FT                   KLSLKVTAGIGEIFGTELANNVEYTFWDWKFGIYAVEELEIEWKCPQLHDRELSIVENT
FT                   TAHNVYNLHFALEKMRSSTFDGPRIMVVGEKNTGKTALCRTLCSYAIKNKPYQPMFVNL
FT                   NPVEPIFSPPGCVTAVPISSTLDAQLPRWGETMTSGATRLHGKQPIIKNFGFETIAENR
FT                   SLYKLVTKKLFETVSERLQNDSLVHRSGCIVDSPPLENCDDEYSELVEAIVGLRINYLI
FT                   ILCNDNDKGREIYTKVSKIVNTYVGERLLRVPTMAGVFEKDDVYIRAQQRAAIREYFYG
FT                   DTRTVLSPYNLGCDTSDITVWRPKSVLQGENTNLDTLEVAPVDSSTLQYALVAITYASR
FT                   KSDSEEVLQAPILGFGLITELNEKRNKLKILLPVPGRLPPNAMILTSFRYLE"
FT   CDS_pept        904808..906784
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20197958"
FT                   /locus_tag="CAGL0K09108g"
FT                   /product="Strain CBS138 chromosome K complete sequence "
FT                   /function="binding"
FT                   /protein_id="CAG61580.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG123816"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniParc:UPI00003B6D0E"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FMC7"
FT                   /transl_table=1
FT                   /translation="MTQCPIKVSYTLTPYDLTILVLIYMYVFEGIHVPLKIFLRLIPEY
FT                   EDTTEELLLLHLEPVSSKSIEPVLPYLKDIIKLLETEKRVDIAKSLLGHLQNIDGLEVI
FT                   NNLVWVLDKECLLKSNKNKDQIMIGSVNKLIAKKSVLGVYIRYCFKKYICGGFEEREDL
FT                   WNSFVFFRHQFLNDVDSLSYRSLDLEEYKFQYFEFGTTSKVVLPSYESQSDLKSIELMK
FT                   KLIKKTNNTGLSKENTLIVSPDQLHNYINWEVSQVYFLKTKSSNYDNIFDNLTLHDITR
FT                   FPAIFFIRYLNAVNENRYQDALDFLHNYFDYTLTQSSENCYHISLLYLATFHASFGDAN
FT                   SALKAFEEATKIARENKDTSTLNVIMIWVINFLEKYPIFADRFYVTVDQIIKYLKSSSD
FT                   TDNAVILKNAYRFDSIMQMYKCTNAIDIFESTLKYMTIVFQSIKISDVPYKYLNYASMM
FT                   WKVLGQRLIADIYEKIIPINNNDGFREDILHYEHLLEKKDYTPIGEFIERKKKCRLTFQ
FT                   QTLELRILEVRYLVVVREYWSAIEVIESSLVEFSRFISESKWQSLLEFEKARILIECKA
FT                   SIRAIPLIQNLYDRAITTHDPYFASKAVLLLVHALAKIGKLDESRRLFTANLGVMYQFH
FT                   DLDDEINRISNVVNNIKYKNMTI"
FT   CDS_pept        complement(907150..907965)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17446720"
FT                   /locus_tag="CAGL0K09130g"
FT                   /product="Similarities with uniprot|Q08673 Saccharomyces
FT                   cerevisiae YOR247w SRL1"
FT                   /protein_id="CAG61581.1"
FT                   /db_xref="HOGENOM:HBG123818"
FT                   /db_xref="UniParc:UPI00003B6D0F"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FMC6"
FT                   /transl_table=1
FT                   /translation="MQLKQYISALALAISTASAASAYSNSTYQASYQNAPLSSVNPTAA
FT                   VSSVDANGNAAAAVPSSSSSSTFSATRGDTTTLQPPQSVVAQEVIITHSDETTTYYETS
FT                   TLYSTVYLTNSKSKSVAAQDAAQQQKENVITVTKTDANGGVVTVVTTVTVGADSRPTGT
FT                   VISDGSSGTTTSTITSTLFVTVRQSAVSVGPSNAPIGKELAGINSVSSSQSASAQGCVP
FT                   VTTTVTDTVTDTVVSTVTATPSPSIQYVTVTMASNGTIASNGTINGTHF"
FT   CDS_pept        910285..911268
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI20197959"
FT                   /locus_tag="CAGL0K09152g"
FT                   /product="Similar to uniprot|Q08651 Saccharomyces
FT                   cerevisiae YOR246c"
FT                   /function="binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAG61582.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG533752"
FT                   /db_xref="HOGENOM:HBG750976"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI00003B6D10"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FMC5"
FT                   /transl_table=1
FT                   /translation="MTWDPSELPYYNPQVDDRVAVVTGGNSGIGWFTVLHLYMHGFRVY
FT                   VCGRNSHKVSRAMDDIIEEAVRRHNLYLKGLHDQKPTRYLGSLQYLHTDLTDLKCVDRA
FT                   AAKILRMENHLDVLVNNAGVMAVPYEITKDGFEIQMQTNYIAHFLLTMRLLPLLRCSHG
FT                   RVVTLSSLGHHIIFKYSKLDETWNYFPNFVFTWFRYAMTKVASIQYTKMLAIKNPDILF
FT                   VSVHPGLVMNTNLFSFWTRLPLVGIFFWLLFQVVGFMFGVSNEQGAYSTLRCSLSQELT
FT                   TTNDNGKYFTTGGKESRSSYVANNLDDAASTWIWTMKQLRNRGFDI"
FT   tRNA            join(complement(911623..911660),complement(911560..911605))
FT                   /gene_name="tRNA-Ser (CGA)"
FT   CDS_pept        complement(911911..913677)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000906" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17446721"
FT                   /locus_tag="CAGL0K09218g"
FT                   /product="Similar to uniprot|P25639 Saccharomyces
FT                   cerevisiae YCR061w"
FT                   /protein_id="CAG61583.1"
FT                   /db_xref="HOGENOM:HBG058003"
FT                   /db_xref="HOGENOM:HBG395691"
FT                   /db_xref="InterPro:IPR018825"
FT                   /db_xref="InterPro:IPR018827"
FT                   /db_xref="UniParc:UPI00003B6D11"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FMC4"
FT                   /transl_table=1
FT                   /translation="MRFWWIVTLANLCAAHMHMDDDEDMSNEMGMGVSDTNLTPVPHEP
FT                   KHLHGQPILDTHLTPAERLYWEKYDTTTFFTTDLGNRSAFKFHVATMFILLFLSYPVCL
FT                   ILNSVASSWYLAALTANLALTVASLISLLVFSTTFPEEWYANNFYHKTSWTVLILMLVH
FT                   YIAAVGTLAAKRFGSGYVSLDIETVAYPLQDYDNYEIPDVVVNDGNTEDPSRLSPPTTV
FT                   TPNDDTQESSLSHSHSEESLRFTDDSHKKPRKDKLLNKIPVNSKLQTIMDKFGVFFGII
FT                   FGFLNYPMLLILFVDACTGIAIGNLLGKGPRVFNLLAHWIKGGVFFVLGIVSLARYCGV
FT                   GQKYGWAWNRLIIDRRSPYANSVWFKYSPIGGITMEGFESFLIFFYGSTNVFLEHLAGA
FT                   GGAWTAKDLQHVSIAFMFFGTGLCGLLVEGFLNKWRFTHALVRTDYKEEEVLVANPGYS
FT                   PNPFPTFTIFWTGILMSQHAQASETSTTIHVQWGSLLSYGSFFRLFTFLILYFSPEVNM
FT                   EPFKPITELVSSFCLLAGGLIFMESTDQVVEGFEYRGFTPMFTFNISVGIVSLIMAWEM
FT                   ILLFWRRYLASN"
FT   CDS_pept        complement(914042..914470)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17446722"
FT                   /locus_tag="CAGL0K09240g"
FT                   /product="Similar to uniprot|P25638 Saccharomyces
FT                   cerevisiae YCR060w"
FT                   /function="binding"
FT                   /protein_id="CAG61584.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG123819"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniParc:UPI00003B6D12"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FMC3"
FT                   /transl_table=1
FT                   /translation="MSWKSYKKPGHQDVNRQRNLKHWNNGLQDKLTMSFQHFKDIGNEH
FT                   FKKGEYDLAIEQYRKCISLEPTNAVGYSNLAMAYLKNRCPDEAKTACEMGLSYCKDTKL
FT                   RQKLQYRLELATTNKRPKTLQQLEIREVERIPPELASL"
FT   CDS_pept        914614..915393
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000160430" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19351143"
FT                   /locus_tag="CAGL0K09262g"
FT                   /product="Similar to uniprot|P25637 Saccharomyces
FT                   cerevisiae YCR059c PMN1"
FT                   /protein_id="CAG61585.1"
FT                   /db_xref="HOGENOM:HBG144558"
FT                   /db_xref="HOGENOM:HBG407584"
FT                   /db_xref="InterPro:IPR001498"
FT                   /db_xref="InterPro:IPR006575"
FT                   /db_xref="InterPro:IPR016135"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020569"
FT                   /db_xref="UniParc:UPI00003B6D13"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FMC2"
FT                   /transl_table=1
FT                   /translation="MDELVVEELESLEAIYPDLLKRDDAENIFAMKVPQHEKFTVKISL
FT                   PDKYPATEPPHVLEVSVAQGDYDSKYLTTLFQEVMDSMFHQGSVCLFDFFTELDGVLYD
FT                   DEEESSMDAAEVVDNSALVPVDPFEGWTASDPISDRGSTFMAFAAHVNSEEEAFQMLDH
FT                   LKTDSKMRRANHAMCAWRIKKQTDSNDIIYQDCDDDGETAAGSRMLHLVTIMDVWNVIV
FT                   VVARWFGGVHIGPDRFKHINSTAREAILRAGFTPAKK"
FT   CDS_pept        915766..918501
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000160363" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17446723"
FT                   /locus_tag="CAGL0K09284g"
FT                   /product="Strain CBS138 chromosome K complete sequence "
FT                   /protein_id="CAG61586.1"
FT                   /db_xref="HOGENOM:HBG037471"
FT                   /db_xref="HOGENOM:HBG721153"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR007148"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="UniParc:UPI00003B6D14"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FMC1"
FT                   /transl_table=1
FT                   /translation="MKSDFKFSNLLGTVYRQGNVQFSHDGNMLLSPVGNRISVFDLVNN
FT                   KSFTFAYEHRKNIATFDVNKQGTLLLSVDTDGRAILVNFKTRNVLHHFNFKDKCYSVKF
FT                   SPDGRYFALAVGRFLQIWKTPDVSQDRQFAPFVRYRVHAGHFQDITSFTWSHDSRFLLT
FT                   TSKDLTSRVWSINSEDKELVATTLAGHRDYVLGAYFNSTQEKIYTISKDGAVFTWEYIS
FT                   KAQKEGLDEEDLEDEDLSKLSWRITKKNFFYANQAKVKCCTFHINSNLLIVGFSNGEFR
FT                   LYEMPEFVMVQQLSMGQNPVNTVSVNNSGEWLAFGSSKLGQLLVYEWQSESYILKQQGH
FT                   FDATNSLTYSPDGSRVVTAAEDGKIKVWDVASGFCLATFEEHTSAVTAVQFAKKGQVLF
FT                   SASLDGTVRAWDLIRYRNFRVFTATERVQFTCLAVEPSGEVVSAGSTDSFDVFVWSVQT
FT                   GQLLDTLSGHEGPVSCLAFSMENAVLASASWDKTIRIWSIFGRSQQVEPLEVFADILAI
FT                   TITPDGKHVAVSTLKGQLTIFDIASGKQIGNIDCRKDIISGRFLQDRFTSKNSERSKYF
FT                   TTINYSFDGKSIIAGGNNNSICLYDVPNEVLLKRFIVSRNMNLNGTLEFLNSSRMTEAG
FT                   SLDLIDSSGEYSDLEDRIDGSLPGSHRGGDMSTRSSRPEIRVTSVQFSPTANAFAAAST
FT                   EGLLIYSIDETLIFDPFDLDIDITPQATLEVLAEKDYLTALVMAFRLNEEYLINKVYEN
FT                   VPVTQINSVCNQLPVVYVSRLLTFIGNFATTSQHIEFNLLWLKALLIAHGSFMKQHEHM
FT                   FSSATRAVRRFIGRIAEDVTFLSATNKYAYRFLTSTSGKGADSSEEEIQNISDSSSSDE
FT                   DDVVMQSDDDEDGEWIGFQEKKQQLALSEDDSESEDELLQ"
FT   CDS_pept        918817..920409
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000000904" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17446724"
FT                   /gene_name="CTR86"
FT                   /locus_tag="CAGL0K09306g"
FT                   /product="Copper transport protein 86 "
FT                   /function="binding"
FT                   /biological_process="threonine biosynthetic process "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAG61587.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0009088"
FT                   /db_xref="HOGENOM:HBG049097"
FT                   /db_xref="HOGENOM:HBG058005"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR019156"
FT                   /db_xref="UniParc:UPI00003B6D15"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FMC0"
FT                   /transl_table=1
FT                   /translation="MSEKKKILQDIDRLLSEANSDPQLYHDNLGLLNDFVIETANNTAI
FT                   RDKFSRDKETWQLIKTILVNSHVEDISGWSAEVIFLYKRLLRGVFILARNLAVSGSEIA
FT                   QELLLQNIAYKIFNNSLKVGKLDDGMQLALYSTILSFLHNMSSKSVVFDRSSSKELFEF
FT                   LHFPVKLNYEYTKDILLPYLLYFKDLIQHDDFLYYFLRYDKVDSILCGLILDKIMRDES
FT                   QIFEIVSGTRIVSPDVNLSDIDMILLRTFALISTHESFIPYLEDKENNSFNIFIDLLKL
FT                   MQLVVTNIDSWDKFQLTSIMTWTYKIFEKNADQIKNYFKNKLENEEIAKKLHAKCVITL
FT                   DIMAKLCQFNHVQKFIISYKGLDQLISLLNIFQDNLIRVNFTKTSQASDITGVKATNKL
FT                   GEKLAKDSLIEERIDLINMKIKETNFPECKLLIIEIIAMLTHENREIQNQVRELGGLGV
FT                   ILSNCVIDDNDPFIKERSIMCIKFLLKDNKENQNFVANLESKRVANDETLQEAGYEVDI
FT                   SKDGKLSLKSTNQ"
FT   CDS_pept        complement(920567..922105)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000230745" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17446725"
FT                   /locus_tag="CAGL0K09328g"
FT                   /product="Similar to uniprot|P16120 Saccharomyces
FT                   cerevisiae YCR053w THR4 threonine synthase "
FT                   /function="pyridoxal phosphate binding"
FT                   /function="threonine synthase activity"
FT                   /biological_process="threonine biosynthetic process "
FT                   /protein_id="CAG61588.1"
FT                   /db_xref="GO:0004795"
FT                   /db_xref="GO:0009088"
FT                   /db_xref="GO:0030170"
FT                   /db_xref="HOGENOM:HBG123097"
FT                   /db_xref="HOGENOM:HBG521025"
FT                   /db_xref="InterPro:IPR000634"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR004450"
FT                   /db_xref="UniParc:UPI00003B6D16"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FMB9"
FT                   /transl_table=1
FT                   /translation="MSSSQVYRSTRSAEQESKSFEEAVIQGLATDGGLFVPSTIPTVSK
FT                   DTLFSKWSKLSFQELAFEIMRLYIDSKEIPDADLKSLIERSYSTFRSDDVTPLVKNVTG
FT                   NEENLHVLELFHGPTYAFKDVALQFVGNLFEYFLQRINKDLPEEQRKRLTVVGATSGDT
FT                   GSAAIYGLRGKKDVSVFILYPTGRISPIQEEQMTTVEDKNVQTLSVAGTFDNCQDIVKA
FT                   IFGDKDFNSRHNVGAVNSINWARILAQMTYYFYSYFRATDGKEGKVKFVVPSGNFGDIL
FT                   AGYFAKQMGLPVEKLVIATNENDILDRFLKTGTYERSANVLATHSPAMDILISSNFERL
FT                   LWYLAREFLAEKDDLKAGEIINTWFTQLKTEGKFVVDKSIIEGALQDFASERVSNEETI
FT                   QTIKKMYEISQNPKKYVLDPHTAVGVCATERLIKKDNDKEIQYVSLSTAHPAKFAEAVN
FT                   QALSSFDGYSFESDVLPAELKRLSTLPKKIKLVEKADVTLVKNTIEEELAKMGL"
FT   CDS_pept        complement(922651..923949)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093748" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17446726"
FT                   /locus_tag="CAGL0K09350g"
FT                   /product="Strain CBS138 chromosome K complete sequence "
FT                   /protein_id="CAG61589.1"
FT                   /db_xref="HOGENOM:HBG123820"
FT                   /db_xref="HOGENOM:HBG396432"
FT                   /db_xref="InterPro:IPR006828"
FT                   /db_xref="UniParc:UPI00003B6D17"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FMB8"
FT                   /transl_table=1
FT                   /translation="MGNNPSLDYQRTVKNSPRKHKEMVQVDDIEARVADIDLQNSEQPP
FT                   AERVLNRKKSTLLFDDESNNEEEYSEENEEEKVRYRAESISSTSSCSSHASDDIQQDEV
FT                   CDRTEEATKLERQSREDHSDEHIRTATQSESDLARTTTNTTEVGIDESRHEEKEKQESS
FT                   SSASNGMVPVEIRWEQGGEKVYVTGSFTNWRKMIGLIPVESEPGHFKIKLQLAPGTHRF
FT                   RFIVDNQLRFSDNLPTATDQMGNFVNYLEVSAVPKSDSTSSRTGKERKDKNKKSVSKVS
FT                   KDRSTVGPLSARSCIALEIEKEPDDFGDGYTRYHEELPQEPKYEFSSEIPAIFVDQSII
FT                   EQLTMERQRKKSNNMSWLTPPQLPPQLENVILNKFGEPLSQSTENNAGALPIPNHSVLN
FT                   HLVTTSIKHNTLCVATNNRYRQKYVSQIYYVPL"
FT   CDS_pept        complement(925647..926837)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18503376"
FT                   /locus_tag="CAGL0K09372g"
FT                   /product="Strain CBS138 chromosome K complete sequence "
FT                   /function="nucleic acid binding"
FT                   /function="zinc ion binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAG61590.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG123821"
FT                   /db_xref="HOGENOM:HBG204452"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="UniParc:UPI00003B6D18"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FMB7"
FT                   /transl_table=1
FT                   /translation="MAKRPVRLPSDNKERPFKCEHCSRGFHRLEHKKRHMRTHTGEKPH
FT                   GCSFPGCGKSFSRSDELKRHNRTHTGVSQKKKKTKGKGAKIQDPMAGEEKLVELVNVQF
FT                   PVPYTSVQNGETNMSPPIPGSQPISIPIANPLPHPTSGVYFNVQPGTSPLVAIAQQQLG
FT                   MVNYHGYPTVAASESITPVPILSTSASSVALSDMSHTSSAFSNIGGGHSGAGSLSTSPS
FT                   SMNDVYLNCNSNNLPHKVNNTTNPCAPTLPPVINITNSAVGYNNVLNSLQNKTSKANSR
FT                   VTKAEKGGPLLSTSPIDIKPLSTNNSSTSLVALLKSDASLAPLKKGPLQLASSTRSTAK
FT                   YLDGVSDGDDNRYYSQGDEDQDDDTDTCTTPRENIKITLPPLSNLIKGIEIFNGQA"
FT   CDS_pept        complement(930063..930728)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000233968" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17446727"
FT                   /locus_tag="CAGL0K09394g"
FT                   /product="Strain CBS138 chromosome K complete sequence "
FT                   /function="GTP binding"
FT                   /biological_process="protein transport"
FT                   /biological_process="small GTPase mediated signal
FT                   transduction"
FT                   /protein_id="CAG61591.1"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0007264"
FT                   /db_xref="GO:0015031"
FT                   /db_xref="HOGENOM:HBG527536"
FT                   /db_xref="HOGENOM:HBG745225"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR003579"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR013753"
FT                   /db_xref="InterPro:IPR015595"
FT                   /db_xref="InterPro:IPR020851"
FT                   /db_xref="UniParc:UPI00003B6D19"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FMB6"
FT                   /transl_table=1
FT                   /translation="MNSSEDYGYDYDYLFKIVLIGDSGVGKSNLLSRFTTNEFNLESKS
FT                   TIGVEFATRTIKVEDKKIKAQIWDTAGQERYRAITSAYYRGAVGALIVYDISKSGTYEN
FT                   CNHWLTELKENADDNVAIGLIGNKSDLEHLRAVPTEEARGFASENQLFFTETSALNSEN
FT                   VDLAFRELIEQIYKMVNKHQVDLGENAKGSSGAPKGPTISLAPVPGEKKKKSKSNSCC"
FT   CDS_pept        complement(931067..932143)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000225864" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20197960"
FT                   /gene_name="NCS6"
FT                   /gene_synonym="CTU1"
FT                   /locus_tag="CAGL0K09416g"
FT                   /product="Cytoplasmic tRNA 2-thiolation protein 1 "
FT                   /EC_number="2.7.7.-"
FT                   /function="ATP binding"
FT                   /function="tRNA binding"
FT                   /function="transferase activity"
FT                   /biological_process="tRNA thio-modification"
FT                   /biological_process="tRNA wobble uridine modification "
FT                   /cellular_component="cytosol"
FT                   /protein_id="CAG61592.1"
FT                   /db_xref="GO:0000049"
FT                   /db_xref="GO:0002098"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005829"
FT                   /db_xref="GO:0016740"
FT                   /db_xref="GO:0034227"
FT                   /db_xref="HOGENOM:HBG023943"
FT                   /db_xref="HOGENOM:HBG541846"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR012089"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020554"
FT                   /db_xref="UniParc:UPI00003B6D1A"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FMB5"
FT                   /transl_table=1
FT                   /translation="MSYTAPTDPVNKQEVVKLSQLCELCHGRKAVLRRPKNLQKICKEC
FT                   FYYVFETEIHNTIVSNNLFQRGEKVAIGASGGKDSTVLAHILKLLNDRHDYGVKLVLLS
FT                   IDEGIVGYRDDSLATVKRNQKQYQLPLEIVSFRDLYDWTMDEIVAIAGIRNSCTYCGVF
FT                   RRQALDRGAAKLDINHVVTGHNADDMAETVLMNILRGDVARLERSTAIITQSAGSPIRR
FT                   SKPFKYCYQKEIVLYAHYKKLDYFSTECTYAPEAFRGTARELMKNLEAVRPSCIIDIIQ
FT                   SGENLVLKKKKRHPNSKVEFKDGNRCERCGYLSSNKICKACMLLQGLEKNRASMSIDND
FT                   TNVDGAARVMRTLEKLSF"
FT   CDS_pept        complement(932509..934836)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17446728"
FT                   /locus_tag="CAGL0K09438g"
FT                   /product="Similar to uniprot|Q12050 Saccharomyces
FT                   cerevisiae YOR144c EFD1"
FT                   /function="ATP binding"
FT                   /protein_id="CAG61593.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="HOGENOM:HBG123822"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="UniParc:UPI00003B6D1B"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FMB4"
FT                   /transl_table=1
FT                   /translation="MKKQISLSEVLTGRPTTTKTRKPRVKGTKNDTSCTNTTDMRVSED
FT                   KLNTEEDARLRTRHIEPIVNSTKEPVSLKSFLMTRPQKPKTTEVIDLDEDGDVISIENE
FT                   SITMNSKAMEPENFKKTSHREMFNNFEKKKKTRGKNNELEITNEPYLGYEKIRRYNDVS
FT                   KLKELPTSLFPKVQLVAEKSMNIIDIGQEHFAEKRVRNRTADYNFSVDEYMQLNPIRKL
FT                   NPDAITDIPVSVSVSDSSNSQKLLWNDMMAPKNIQDVLLEPKLKEDVFMWISSAFHKLK
FT                   RPTTRNKLKKQTKNDRLRNEIEDFIVPDGMIVFGDDEDTTNSKVNESNHFDNEVEFVPL
FT                   MILHGEGIGKNTLIKNIANHLNSQIYEVASNCNRGKKEIKEMLLEFSTTHYVKGTKDGI
FT                   ILIDDVDVIFREHDKFFWQALEKVLMVSRRPIILTTRDINFIPTYLLDICEEEKSIFLA
FT                   KRVSRGTVQKMLAKYIEVLNQPLNSALIEKAIEIHGADVRGCLLDLQFLDGYKTGCDIN
FT                   TPCNLSVSIQDSNCINSQANVAELLSNSDIILNATEWNSNFITEPDSTLMTRSALEYNA
FT                   KQSDDTLKLKNDYLVDYQLHLNDELRQQRLPFEINIGHEIYKILVDSRSHKTSSKPVKS
FT                   KKYKIDKVVRASAEYLGTRIDSTQGKDRGNRARSSRRRIQEVLDRLSSNYEYSADKEDE
FT                   IMMDLEMYPYSTLSCEINPMIHEIAKRDNEIKSFNRQLFESETKGLAKEEMNTVVYKLT
FT                   NEGLLKPIFFRANPQSLLDYWK"
FT   CDS_pept        complement(935326..936111)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000181708" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17446729"
FT                   /gene_name="PNO1"
FT                   /locus_tag="CAGL0K09460g"
FT                   /product="Pre-rRNA-processing protein PNO1 "
FT                   /function="RNA binding"
FT                   /biological_process="ribosome biogenesis"
FT                   /cellular_component="cytoplasm"
FT                   /cellular_component="nucleolus"
FT                   /protein_id="CAG61594.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0005730"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0042254"
FT                   /db_xref="HOGENOM:HBG014182"
FT                   /db_xref="HOGENOM:HBG380350"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="UniParc:UPI00003B6D1C"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FMB3"
FT                   /transl_table=1
FT                   /translation="MVAPTAVKRQEEATAGPSRILGDGAPTAMIDEDDDEILIDQDMEE
FT                   EAPKKSKKEAAGVVLDESGKPRFGAAKDQATTKVKLESRKVPVPPHRMTPLRNSWNKIY
FT                   PPLVDHLKLQVRMNLKTRTVELRTHPKHTTDPGALQKGADFIKAFTLGFDLDDSIALLR
FT                   LDDLYIETFEVKDVKTLTGDHLSRAIGRIAGKDGKTKFAIENATRTRIVLADSKIHILG
FT                   GFTHIRMAREAVVSLILGSPPGKVYGNLRTVASRLKERY"
FT   CDS_pept        936377..938326
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000113511" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20197961"
FT                   /gene_name="MDM32"
FT                   /locus_tag="CAGL0K09482g"
FT                   /product="Mitochondrial distribution and morphology protein
FT                   32"
FT                   /biological_process="mitochondrion organization "
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="mitochondrial inner membrane "
FT                   /protein_id="CAG61595.1"
FT                   /db_xref="GO:0005743"
FT                   /db_xref="GO:0007005"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG059551"
FT                   /db_xref="HOGENOM:HBG202860"
FT                   /db_xref="InterPro:IPR012571"
FT                   /db_xref="UniParc:UPI00003B6D1D"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FMB2"
FT                   /transl_table=1
FT                   /translation="MIRRRIVGFLRRPLGSEGGPLVSPIVGLVRPLVYPVNRAASPVTA
FT                   VSPVVRPVGMRFISGPVEREAIRAGISNNTDFLHVQNILLQKDQERQRRELLLKDADNF
FT                   FERFKVKTKWVLIRGNRPFSKDEIYTLFSWLLLSQIVWIVVGTTTFLSLVIMASNTMFA
FT                   KEFVGETLGNILNNNKYINGIDFTFKDAMVPEWKKKMIRFHNVTMKSNDKDDTKGVSMN
FT                   LKLNQVEVSLSVVKWLSGKGLVNDISIFGISGDISINDKKESNVESLINWVTESNPTYE
FT                   LNNFTINDSSTVIHDKANNKHLNMNIYSLVIPRLRFDHLLTDIFSADVLVGSVNDSLFN
FT                   IHKRQNKLLPAFFSDKGRDNRSKTIDKNENDGRFTNLRLNAININELNLNRTGAFNWID
FT                   DGTIEISADIMIPNTDENNEGNGLKTLLGYPGGDPLVNKNTPENKYVVIDVKFKFKDLK
FT                   TKFPNEEPKLSSGEKILSLNELKPVIAYVNSRSGFIHFLTSLEDSNQSRTNVESVDDNK
FT                   NWGLSNISIRRKKSYPNTTVISSKPYWNSTSEDNERNLPLPLNQEIIKFHNISVQDDNE
FT                   LVLRCRIVQNVEQLENLSSLKISKMWDTITMEMYMDLLKVVEDWEYRNKNDWMKQWGAT
FT                   FASQLLLVGFGAMV"
FT   transit_peptide 936377..936418
FT                   /gene_name="MDM32"
FT                   /locus_tag="CAGL0K09482g"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FMB2 "
FT   mat_peptide     936419..938323
FT                   /gene_name="MDM32"
FT                   /locus_tag="CAGL0K09482g"
FT                   /product="Mitochondrial distribution and morphology protein
FT                   32"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FMB2 "
FT   CDS_pept        complement(938579..939088)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17446730"
FT                   /gene_name="SPP2"
FT                   /locus_tag="CAGL0K09504g"
FT                   /product="Pre-mRNA-splicing factor SPP2 "
FT                   /function="nucleic acid binding"
FT                   /biological_process="RNA splicing"
FT                   /biological_process="mRNA processing"
FT                   /cellular_component="spliceosomal complex"
FT                   /protein_id="CAG61596.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005681"
FT                   /db_xref="GO:0006397"
FT                   /db_xref="GO:0008380"
FT                   /db_xref="HOGENOM:HBG123823"
FT                   /db_xref="InterPro:IPR000467"
FT                   /db_xref="UniParc:UPI00003B6D1E"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FMB1"
FT                   /transl_table=1
FT                   /translation="MFSLKLGKNKKKKKVPKGDSELFGSEASVDDKVSLTQYNYADERE
FT                   KEKPKKRKIELATAESETIALKRAKNNIGDDSIVQELEALPEKVEDKEYEEMPVEEFGA
FT                   AMLRGMGWTDENELEDSKSHSKKLPHEQIHPEGLGIGAKSQEMSNPVSVKDLVNDFMPV
FT                   KKVPKQ"
FT   CDS_pept        939503..940798
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000225143" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17446731"
FT                   /locus_tag="CAGL0K09526g"
FT                   /product="Strain CBS138 chromosome K complete sequence "
FT                   /function="ATP binding"
FT                   /function="nucleoside-triphosphatase activity"
FT                   /biological_process="protein catabolic process "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAG61597.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0017111"
FT                   /db_xref="GO:0030163"
FT                   /db_xref="HOGENOM:HBG460402"
FT                   /db_xref="HOGENOM:HBG724153"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005937"
FT                   /db_xref="UniParc:UPI00003B6D1F"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FMB0"
FT                   /transl_table=1
FT                   /translation="MEELGISGPLESNGHANGNGAGNGNVKSYANLLEQLGNSKVFSMQ
FT                   GNNDVYLRLKKLEKELELLSLQEEYIKDEQRHLRLELSRAQEEVKRIQSVPLVIGQFLE
FT                   AIDQDTGIVSSTTGMNYVVRILSTLDREQLKPSTSVALHRHSNALVDILPPDSDSSISV
FT                   MGENEKPDVTYADVGGLDMQKQEIREAVELPLVQADLYEQIGIDPPRGVLLYGPPGTGK
FT                   TMLVKAVANSTKAAFIRVNGSEFVQKYLGEGPRMVRDVFRLARENSPSIVFIDEVDSIA
FT                   TKRFDAQTGSDREVQRILIELLTQMDGFDQSTNVKVIMATNRADTLDPALLRPGRLDRK
FT                   IEFPSLRDRRERRLIFGTIASKMSLAPEADLDSLIIRNDAISGAVIAAIMQEAGLRAVR
FT                   KNRYVILQSDLEEAYAAQVKTDSDVDKFDFYK"
FT   CDS_pept        complement(940917..942407)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000172163" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20197962"
FT                   /gene_name="SMP3"
FT                   /locus_tag="CAGL0K09548g"
FT                   /product="GPI mannosyltransferase 4 "
FT                   /EC_number="2.4.1.-"
FT                   /function="transferase activity, transferring glycosyl
FT                   groups"
FT                   /biological_process="GPI anchor biosynthetic process "
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="intrinsic to endoplasmic reticulum
FT                   membrane"
FT                   /protein_id="CAG61598.1"
FT                   /db_xref="GO:0006506"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0016757"
FT                   /db_xref="GO:0031227"
FT                   /db_xref="HOGENOM:HBG059554"
FT                   /db_xref="HOGENOM:HBG398390"
FT                   /db_xref="InterPro:IPR005599"
FT                   /db_xref="UniParc:UPI00003B6D20"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FMA9"
FT                   /transl_table=1
FT                   /translation="MDNKLIWLLPAIGLVVALQPSYIHPDEHFQTLEMLMIKFYGISGT
FT                   VPWEFEPTNNARSYFPLYAFYGPLFYLMRDILKVQNPLNILRIIRFYNFMLYLSVLYYA
FT                   LPKLVNENKLQNKGRVNEALVFILSSYITWCYQCHSFSNSLETILLLLVLSNYTDILSN
FT                   KAGLLQLVSTGFLISVGTFTRISFPAFLLLPSIQVFLKVLYRKWIQMVVIAVSMTLSTS
FT                   IIVYFDTFMYESDEIIIAPLKNVVYNLNVDNLAKHGLHPRYTHLLVNIPLILGPGLLMI
FT                   RNTKNDFLNLPLLSIISSLFFLSALRHQELRFLLPVVPLFSTLLTRFRYRPYLFRIWLV
FT                   FNAAMCIIMGIFHQGGVIPMISNINAEQDLTIDIWWKTYSPPTWLYNNDILTVSTTSIV
FT                   NNIENLDLVQFNVKTNHVVDLKGCDFDLVLEAIQNFRINGVKSLRLIVPNSMTSNVAAL
FT                   NQTYLVTKENSVFPHLDLDHLDSGIQNIIGLSEYKVSL"
FT   CDS_pept        942861..944054
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000157893" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20197963"
FT                   /locus_tag="CAGL0K09570g"
FT                   /product="Strain CBS138 chromosome K complete sequence "
FT                   /function="phosphotransferase activity, for other
FT                   substituted phosphate groups"
FT                   /biological_process="phospholipid biosynthetic process "
FT                   /cellular_component="membrane"
FT                   /protein_id="CAG61599.1"
FT                   /db_xref="GO:0008654"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="GO:0016780"
FT                   /db_xref="HOGENOM:HBG521081"
FT                   /db_xref="HOGENOM:HBG737235"
FT                   /db_xref="InterPro:IPR000462"
FT                   /db_xref="InterPro:IPR014472"
FT                   /db_xref="UniParc:UPI00003B6D21"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FMA8"
FT                   /transl_table=1
FT                   /translation="MGYFIPKEAIANLKYYKYQSEDRSLISNYILRPYWRWFSQLFPMW
FT                   MAPNLVTLSGLGFIILNVLTVLYYDPYLNTETPRWTYFSYALGLFLYQTFDACDGMHAR
FT                   RTGQSSPLGELFDHCIDSLNTTLSLFPVCSMLGCGYSMILIGTQFMVLGNFYLSTWEEF
FT                   YTHRLFLSEFSGPVEGILLLVFQFILCGLFGTQRVWHTKLLSIHLPLTIGNSDIFELET
FT                   VHLMICFSTFALLFNILAATSNVFQYFKEHNKKNDMEEVEAEKKEAMIALMPFFIYFAT
FT                   VFALVAVDNLFISFPFIISVGLTMAFVVGRMIVGHLTKQKFPLVNFPMFIPISQLIMYI
FT                   IFVCYFKSDRETMVLALLWGGFGVSLGIHAMFINEIIYEFTTYLDVYALSIKHPKST"
FT   CDS_pept        complement(944633..945070)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000206849" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17446732"
FT                   /locus_tag="CAGL0K09592g"
FT                   /product="Similar to uniprot|P49334 Saccharomyces
FT                   cerevisiae YNL131w TOM22"
FT                   /biological_process="intracellular protein transport "
FT                   /cellular_component="mitochondrial outer membrane "
FT                   /protein_id="CAG61600.1"
FT                   /db_xref="GO:0005741"
FT                   /db_xref="GO:0006886"
FT                   /db_xref="HOGENOM:HBG123824"
FT                   /db_xref="HOGENOM:HBG737273"
FT                   /db_xref="InterPro:IPR005683"
FT                   /db_xref="UniParc:UPI00003B6D22"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FMA7"
FT                   /transl_table=1
FT                   /translation="MVELTEIKEDTVQDPPVTPAGLGDVAVKGARVEDEEDDSDFEDDF
FT                   DENETLLDRVKALKDIIPPQHKNRICAVFSTSCSIIKSAFTRGSGLAWTLTTSALLLGV
FT                   PLSLSILAEQQLIEMEKTFDLQKDANDILAQGDEKNTVATA"
FT   CDS_pept        complement(945448..948609)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000210833" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21046835"
FT                   /locus_tag="CAGL0K09614g"
FT                   /product="Similar to uniprot|P53914 Saccharomyces
FT                   cerevisiae YNL132w"
FT                   /protein_id="CAG61601.1"
FT                   /db_xref="HOGENOM:HBG020862"
FT                   /db_xref="HOGENOM:HBG329959"
FT                   /db_xref="InterPro:IPR007807"
FT                   /db_xref="InterPro:IPR013562"
FT                   /db_xref="UniParc:UPI00003B6D23"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FMA6"
FT                   /transl_table=1
FT                   /translation="MAKKAIDSRVPALIRNGVQTKQRSFFVIVGDKARNQLPNLHYLMM
FT                   SADLKMNKSVLWAYKKKLLGFTSHRKKRENKIKKEIKRGTREANEMDPFETFISNQNIR
FT                   YVYYKETEKILGNTYGMCILQDFEALTPNLLARTIETVEGGGIVVILLKSMSSLKQLYT
FT                   MTMDIHSRYRTEAHDDVVARFNERFILSLGSNPNCLVVDDELNVLPISGAKSVKALPPA
FT                   DSDELTPKQQELKDLKESLEDVQPAGSLVSLSRTVNQAHAILSFIDAISEKTLNTTVAL
FT                   TAGRGRGKSAALGIAIAAAVAHGYSNIFVTSPSPENLKTLFEFIFKGFDALGYQEHADY
FT                   DIIQSTNPDFNKAIVRVDIKRDHRQTIQYILPQDSYVLGQAELVVIDEAAAIPLPIVKN
FT                   LLGPYLVFMASTINGYEGTGRSLSLKLIQQLRTQTVQTTDDATQTTVVSRDSQKDTRSH
FT                   LSRQLKEVSLDEPIRYAPGDPVEKWLNKLLCLDVTLIKNPRFAARGTPHPSQCNLFIVN
FT                   RDTLFSYHPVSESFLEKMMALYVSSHYKNSPNDLQLMSDAPAHQLFVLLPPIDPKDGGR
FT                   IPDPLCVIQIALEGEISKSSVRNSLSRGQRAGGDLIPWLVSQQFQDEEFAGLSGARVVR
FT                   IATNPEYSSMGYGSRAMELLKDYFEGKFTDLSEDTKPRDFSLKRVDPKELEKANLLKDE
FT                   VKLRDAKTLPPLLLKLSEQPPHFLHYLGVSYGLTPALHKFWKNNDYAPVYLRQTANELT
FT                   GEHTCVMLKVLEGRESHWLVEFANDFRKRFLSLLSYDFSKFTAVQALGVIESSKKPGKT
FT                   LEEQHTVKELTKSQLDDIFSPFDLKRLDSYANNLLDYHVIVDLLPMLSILYFGDKMGDS
FT                   VKLSSVQSAILLAIGLQHKSIDDITKELNLPSNQTIAMFSKIMRKFSVYFRNLLSETIE
FT                   QQLPEQQDDELADMNGEDITTYDAAQAFDQMEEDLEEAGSEAIKAMKEKQKELINSLNL
FT                   NKYAIDENNEEWEKSKKSLEKAAKSEGVVSLQTGKKRTTESADSIMKQEMNAVKKSKKS
FT                   KKSKK"
FT   tRNA            join(complement(948944..948981),complement(948884..948920))
FT                   /gene_name="tRNA-Phe (GAA)"
FT   CDS_pept        949389..949853
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18503377"
FT                   /gene_name="FYV6"
FT                   /locus_tag="CAGL0K09680g"
FT                   /product="Protein FYV6"
FT                   /cellular_component="chromosome, telomeric region "
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG61602.1"
FT                   /db_xref="GO:0000781"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="HOGENOM:HBG253272"
FT                   /db_xref="UniParc:UPI00003B6D24"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FMA5"
FT                   /transl_table=1
FT                   /translation="MSEEKKLQFVTEGQADVEKQSEREEAIQGAIETERKKRVRKTLRD
FT                   QLRANAIKKQKKSNRESAEVKKLNQLSKEETRYFKELEKNREQEIQRLTQFHKDKDYEY
FT                   EKKRQQLLSRSPDKQSGKPDTLSSNQNNGSTERVILKVKNKNRPRLVVKK"
FT   CDS_pept        950337..951458
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000294684" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17446733"
FT                   /locus_tag="CAGL0K09702g"
FT                   /product="Similar to uniprot|P53912 Saccharomyces
FT                   cerevisiae YNL134c"
FT                   /function="oxidoreductase activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAG61603.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG447528"
FT                   /db_xref="HOGENOM:HBG454398"
FT                   /db_xref="InterPro:IPR002085"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI00003B6D25"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FMA4"
FT                   /transl_table=1
FT                   /translation="MSIPATMKAAVIDGDHLTVKEVPVPEVRDGMVLIKTRAVAGNPTD
FT                   WKHIVSKIGPQGSISGCDVSGEIVKIGANVDTSKYKIGQKAYGLTHGSSVKHPDNGAFA
FT                   EYSLLDPKIAYFPNQDITMSGKDTIPEGTVKYFEDGASFPVSLTTAGAVLHSNLGLDLK
FT                   WEPSEPQRDHPVLFWGGATGVGQLLIQVAKKIHGFTKIVTVASKKHEAQLKTYGADEVF
FT                   DYHDADVIEQIKKKYPDLQIVVDCVSNENTIKQVYKCATESKSATIVQLTHLSIKDIPE
FT                   EDRRDNKTIIGSMLYLATGEDVPFGPVHLPADPKFRKDVEEFVAFINPRINEGIIHHIP
FT                   IKIYKNGLDDVQQILDDIKFGKNSGEKLVAILN"
FT   CDS_pept        951822..952166
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000154887" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18503378"
FT                   /gene_name="FPR1"
FT                   /locus_tag="CAGL0K09724g"
FT                   /product="FK506-binding protein 1 "
FT                   /EC_number="5.2.1.8"
FT                   /function="peptidyl-prolyl cis-trans isomerase activity "
FT                   /biological_process="protein folding"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAG61604.1"
FT                   /db_xref="GO:0003755"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="HOGENOM:HBG430304"
FT                   /db_xref="HOGENOM:HBG731200"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="UniParc:UPI00003B6D26"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FMA3"
FT                   /transl_table=1
FT                   /translation="MSETIEGGVKIDRLSPGDGKTFPKQGDLVTIHYTGTLENGQKFDS
FT                   SVDRGSPFQCNIGVGQVIKGWDAGIPKLSVGEKARLTIPGPYAYGPRGFPGLIPPNATL
FT                   IFDVELLKVN"
FT   CDS_pept        complement(952549..955125)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17446734"
FT                   /locus_tag="CAGL0K09746g"
FT                   /product="Similar to uniprot|Q12019 Saccharomyces
FT                   cerevisiae YLR106c"
FT                   /biological_process="regulation of transcription "
FT                   /cellular_component="H4/H2A histone acetyltransferase
FT                   complex"
FT                   /protein_id="CAG61605.1"
FT                   /db_xref="GO:0043189"
FT                   /db_xref="GO:0045449"
FT                   /db_xref="HOGENOM:HBG123825"
FT                   /db_xref="InterPro:IPR012423"
FT                   /db_xref="UniParc:UPI00003B6D27"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FMA2"
FT                   /transl_table=1
FT                   /translation="MDWSIVDEIRLFRWVSEFKPCGSQNVGNVKKIVDRLNNPEKYPVL
FT                   MLQKDTSRRRISKVFTIEDVVRKLSQYYDLDEAGRVEDGVRDVGGADDDTSSLQLDIPD
FT                   LDHSDTKRHDNRERSLAETLGEGTLDHDHSFTIGSDRSIVRQDTKNSSFVSGVENSIKD
FT                   TSQFSANSSKGNADMAQEIKVTGTPKKTADNTISNFDDIEMPDAHQESEPDTPLETQEQ
FT                   NNVEESGNNNEEKAIEVDKDVGNESIGNSESVAEEPAHISSKEDIPSKETSNVDHLSKA
FT                   TNSNEIEENSMHSGKGEKELAIELEKSNTQDEKTGLPTEDDIENNNDTNKSAVSDTEQS
FT                   KDESATIGDNKKENTAQEIQTSEQHSSRSPANDVNDDSLKSAHETQVNEFEKDETSGTN
FT                   QPIKEDSMSKKIPEEIKETTTAAGVNCGEESEIRKDDEETSTLSSVDESSNMNDSNQLE
FT                   EVDVEINKNSEEGSPISELNGKQITEENALANKDTPDGDTKEAAPTEKKTETQDIESTS
FT                   EAGELRVHEGNEKETTSDSNNQEQENKESDLDIALAKNDVEQELQNDNVTENTTIDRES
FT                   NDGTLQESETQDKVEVAPIGNSDIKSEDKGEFQDTSIVNENNEDTQVNSEEANDDRDIS
FT                   DNKGESNEKLEEGKKTEEDSGINDNQKVDLKDNDASDDVVGDQTTKVGSNNDIEDKNDE
FT                   EATVKETNNESSEEQDYMAANTEDKDTNEDEKLVDSKIEGPKTRKRQREEEAKDKDETL
FT                   DEKMSIRRSRRSATSNAITEAPASKSQATTPEPEAVSSKDTPQKQTKKPKLPDEPLAKR
FT                   TRHSAALQSVVAEKEKEEEPKKKRKKNAKKAVQQPTRMSSRLRNKK"
FT   CDS_pept        955542..956996
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000209594" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17446735"
FT                   /locus_tag="CAGL0K09768g"
FT                   /product="Similar to uniprot|P27929 Saccharomyces
FT                   cerevisiae YNL137c NAM9"
FT                   /function="rRNA binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAG61606.1"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0019843"
FT                   /db_xref="HOGENOM:HBG051720"
FT                   /db_xref="HOGENOM:HBG397980"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR018079"
FT                   /db_xref="InterPro:IPR022801"
FT                   /db_xref="UniParc:UPI00003B6D28"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FMA1"
FT                   /transl_table=1
FT                   /translation="MPRKAVLLNSLTRGRVRTSFNKYNLFNLYKKGNIDFRSKSLYQQK
FT                   WSAKQETRAYHGEHITESRWQTMFSPKLDSVAQLDASLRGGVTKETPFLMQTFATLEKR
FT                   LDFAVFRAMFASSVRQARQFILHGNVYVNGVKIKHPGYTLKPGDTFNVKPEKVLQALGS
FT                   KKPSFEEALKVDKKQVVLWNKYVKEAKTNPQKAWSDKVAKFESMLDTNEKKHEFLKRLK
FT                   KEDTNLQNEEYKILKALTPKDILAEIISIHLKKAKDDTTPVPIEEFKTLAKYDEAILPT
FT                   IHKIYETYLFSKTILLDKLKGKNKEEIKEFASSLISPKDDAKKDLIASSKTSLREGKNQ
FT                   LSDFVKKYSQSVINHFKNKQTDGSIANSSFDPKWAENLKYHPRLDLEAIKEDEVKAREA
FT                   INLPWQSKHLYGRKDSNKPYFTPWKPRPFLAPFAILPHHLEISFKTCHAVYLRDPVARP
FT                   GHSEVISPFDIPVHERAYMYYIRRGK"
FT   CDS_pept        complement(957215..958792)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000206192" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17446736"
FT                   /locus_tag="CAGL0K09790g"
FT                   /product="Strain CBS138 chromosome K complete sequence "
FT                   /function="actin binding"
FT                   /biological_process="cytoskeleton organization "
FT                   /protein_id="CAG61607.1"
FT                   /db_xref="GO:0003779"
FT                   /db_xref="GO:0007010"
FT                   /db_xref="HOGENOM:HBG028695"
FT                   /db_xref="HOGENOM:HBG444917"
FT                   /db_xref="InterPro:IPR001837"
FT                   /db_xref="InterPro:IPR006599"
FT                   /db_xref="InterPro:IPR013912"
FT                   /db_xref="InterPro:IPR013992"
FT                   /db_xref="InterPro:IPR016098"
FT                   /db_xref="InterPro:IPR017901"
FT                   /db_xref="InterPro:IPR018106"
FT                   /db_xref="UniParc:UPI00003B6D29"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FMA0"
FT                   /transl_table=1
FT                   /translation="MSDSKFAMQGYNLVKLLKRLEDATARLEDVTIYQEGYLQSKMESG
FT                   VIDHQSSGGSGIEAKAAGVKSESQEVPQAVASMPASIEKFDKFIKERVEPFVELSEKID
FT                   PVVFQITELFKGAFDAQLEFLKVAVKSKKPDFTSQAFADALQPITKAITAIGDLKDANR
FT                   QSKYFAFLNAVTEGAPLFSWITVETPVSLVGDFKEAAQFWTNRVLKDFKDTNPDASTWV
FT                   QNFMSIFDKLKEYVKEYHTTGVSWDAKGSDFETVFKNSKNTQSSTSSPAAPSPAPSAGG
FT                   PPPPPPPPPASVFEVKNDTAEKPAASGIDAVFAELNQGENITKSLKKVDKSQQTHKNPE
FT                   LRASSVVASKAAPPPKPKKPSALTTKKPPRKELLGNKWFIENFDDESEPIVIETQKDES
FT                   VFIGKCCKTLVQIKGKVNAISLSETESCSVVLYSSISGMDIIKSNKFGVQVEGSLPQIS
FT                   IDQSQGGSIYLSKESMSTEIYTSCSTSINVNLPIGEDEDYVEFPIPEQLKHTFDNGKMK
FT                   SDVFVHAG"
FT   CDS_pept        959122..960138
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20197964"
FT                   /locus_tag="CAGL0K09812g"
FT                   /product="Similarities with uniprot|P38833 Saccharomyces
FT                   cerevisiae YHR127w HSN1"
FT                   /function="nucleotide binding"
FT                   /protein_id="CAG61608.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="HOGENOM:HBG123826"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniParc:UPI00003B6D2A"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FM99"
FT                   /transl_table=1
FT                   /translation="MAVRVRVRGRKSKGKGHGHGGERITVKQEAGEDIDQLVQVQKPRA
FT                   KLRVQEAATQKRREKPAARVTPAREVPLADRIEVKHKSVKTSRTGSNDRQRNRANGVDP
FT                   FERMIRHQLGVIGYTEITNPQMKRFLSLSTPNKINAMRGLGFTDERIMSLFNSTGVKVT
FT                   ELSMKKADQMQKQKQNQKDSSDTGFGKRKEKSTNGVRNNTQSIEGTPSTIVDTPRNGLE
FT                   IPLMSPGLAITNRNKLVISTSTKPDNGNLLTIYNLTLGLDQEKLKDILESYGNTEIDKV
FT                   VVRDLPTGSAMATVHLKEPSTEELIRVRDFFHGATVDGRTIQVMISADPTKNLSSAI"
FT   CDS_pept        complement(960272..960475)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19351144"
FT                   /locus_tag="CAGL0K09823g"
FT                   /product="Similar to uniprot|P0C074 Saccharomyces
FT                   cerevisiae YNL138wa YSF3"
FT                   /protein_id="CAR58055.1"
FT                   /db_xref="InterPro:IPR009846"
FT                   /db_xref="UniParc:UPI00017BD8C2"
FT                   /db_xref="UniProtKB/TrEMBL:B4UN39"
FT                   /transl_table=1
FT                   /translation="MSQSSTSTEEWLLKVRRDTISSMIQHSGLNEYIMLAKGDDCRRTT
FT                   QIDLIEKYCNSFPAGHSYGQKK"
FT   CDS_pept        complement(960893..964855)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20197965"
FT                   /gene_name="NST1"
FT                   /locus_tag="CAGL0K09834g"
FT                   /product="Stress response protein NST1 "
FT                   /biological_process="response to stress"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAG61609.1"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006950"
FT                   /db_xref="HOGENOM:HBG123827"
FT                   /db_xref="InterPro:IPR008604"
FT                   /db_xref="UniParc:UPI00003B6D2B"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FM98"
FT                   /transl_table=1
FT                   /translation="MPSGSKSKKKKSKSKGGVKKHAVEKVAPPIEAEIMDERDESDYPT
FT                   SRVIKRGPNGDVIVESLPDKSTSGKKSKKKGKLSDLEVSESAKQMGITLDSHWESLSPD
FT                   EKKNILRIEKEEVLEIIRNYQNDHNCSCSVCGRRHMAMNQEMERMYNLLYELEEQRDPD
FT                   MNPVKFHLGIIKELQISKNKQILDQTEGPNDNTTHEEVVKNFLSSDIADKLKEEVHQFK
FT                   QKQLSKQECNRPSSLANDNIEEEIPCAQIPQANEEAMTKDIQKTLEQLSVVEPVSKINV
FT                   IQEDDLGEIKEENKEYLKFTESFISSQPKIAQKFIQKLDENPCMKAITDEVMQNSSYEF
FT                   LDALKNLWAPNLLKIVESEDDDNLVNLNETLDPIEFTTMLHHGNPLSQQDYYDLQGAIS
FT                   RKVVNAFNFENRKLEHLSPLEVELFGRFMSSDQDNIFHNMLLEAYNERFKEEPFKMMSN
FT                   IPQIIKAVATLTNLDGRMMDDVDENHFTSEEERYDDDITDYSDSEYEDYDSEYDDIDNG
FT                   DIISDVDEPFSTLKSDQLRVNYDTNSGNINHSDNYESNSRLREVTDENEENLQYDTPQE
FT                   KYNYSDHGKDHGTIADEDEDSIDEGYESSIDDMERLEEGRRLIQIAITKLLQGRIMESY
FT                   HEKEADSNRLKLLKELEEEQMKKKEKEVKKIKKKEKEKEKRRLQQLAKEEEKRKKEEEE
FT                   RSAREEQERREMERREAQRKKVEEAKRKKDEERRRKLEEQRKREEQQEKQRKAKEEQKR
FT                   KREEEKKKKEELERQLREEELMKKKEEEERLLREKERAEILKKETELAMSMKENHSSQS
FT                   LSIQNQFFSNPQNSNIGMQNYFNNDLDNTNAGLGNGGPTNLGVRKNSHVLGLTQVYSDK
FT                   ANNSPGKNDDNNEINNEILNIINAATTAKSGSRTSMDMQALLQPPFTDNVNDQIRSSNL
FT                   INDQASGMNSNGLSTNFHSPYGSNVFSGENQLSNNLQNDILTGLNADTSSTNLASWTSL
FT                   PALNNLNANQHILSNNQTPLHQQKGTSPISNTMMDTKRDYLGDELSKLTTMLTTNSLNE
FT                   SPAFSSSNLQSSLWNDQNSSGKTPLGSNTTQIPLSQPAFLGTEPPVHRSSIWGDSSASM
FT                   FNFSQRLSVPTNSNSVSSQTVPNQNIGMGSSFTNPSIWSTGSDFNVPSRDMNSGVAFTN
FT                   SFSNTSPRNQFALNSGSMLQNQSQRQNIMDNIRLLSNSPQNNGYIPIDLLYQSINKQST
FT                   SDFPSFLNNVIDLERSHNYDLVKDQTGVINGVRVGSENRPVSTAFSNFHQNMDPTMKGP
FT                   EHLSNSIPGTARNFEGNSYLAKEATMNIIPSSSLDR"
FT   CDS_pept        complement(965222..966433)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000204444" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19351145"
FT                   /locus_tag="CAGL0K09856g"
FT                   /product="Similar to uniprot|P53934 Saccharomyces
FT                   cerevisiae YNL092w"
FT                   /protein_id="CAG61610.1"
FT                   /db_xref="HOGENOM:HBG175515"
FT                   /db_xref="HOGENOM:HBG738863"
FT                   /db_xref="InterPro:IPR012901"
FT                   /db_xref="UniParc:UPI00003B6D2C"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FM97"
FT                   /transl_table=1
FT                   /translation="MEDLTDEQVIEETLSAYKQYRDYALKEYYTPRLVKWEALPEIQRK
FT                   LVPSYSSYLSNLKRCISLNADFIEGAVEFFEHASGIQGSVSRPVSRSNMEKVVSMLAQL
FT                   YREWSAEASSERDILLSRLMPFLSELQGNSSSEEPLEILVPGLGTARLIADLVMHGYRS
FT                   EGNEYSYYMIIMSMFMLNGGLSSKGIEIYPFVHTNSHWKERNLMFKPIRIPDFDIQSEL
FT                   AGNNLMQISMGSFVDCYGPNEGILGSSHYNINQEMNLKRLNSKSTKDVVVTNFFLDTSG
FT                   NVIDYLLAIEHVLRPGGTWINFGPLVYHHENDNDSDINYEVDPYSGERTDHSPIPMKGI
FT                   ELTVDEIVAVALKLGFTMLKREDGILSGYGQLPFPESGLNGLPGYRCSYWVMKKRTELM
FT                   EGAL"
FT   CDS_pept        complement(966692..968584)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000857" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17446737"
FT                   /locus_tag="CAGL0K09878g"
FT                   /product="Similar to uniprot|P53933 Saccharomyces
FT                   cerevisiae YNL094w"
FT                   /protein_id="CAG61611.1"
FT                   /db_xref="HOGENOM:HBG123828"
FT                   /db_xref="HOGENOM:HBG202684"
FT                   /db_xref="InterPro:IPR017210"
FT                   /db_xref="InterPro:IPR019236"
FT                   /db_xref="UniParc:UPI00003B6D2D"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FM96"
FT                   /transl_table=1
FT                   /translation="MEGMDNGNSGNGSNGSKRQMLYDFVRKTKEVYIPNIRQMTSKPYM
FT                   PDGMARDGPSDISNSQYPENMFIQYYPSYYTRNDINDGRKALYDVVIRLNILEPGDITR
FT                   RRNRVLLSLCKQYLKPGNSDPDAIQSETDLSQAKGFNEEELETLTNRIQGFLCARVPGA
FT                   PLLITLHGDTPNDIHKIEIQADNIGYVETSVMTEFEPRRINITVQTPDYFPAIVTKDVS
FT                   NLTYIKQDGWGLISDIDDTIKHTGITGNKKSMFRNVFVHEFERWKIDGMPSWYYTLRDV
FT                   YNFDFFYVSNSPLQLYPVLVNFIESNYPRGPIFLKQYTGNFMKSLMTSSANRKSGKIRS
FT                   ILEDFPNKKFILVGDSGEQDLEAYTKLACEFPDQIRAIFIRCCSNSLSDFSVEDKNIMK
FT                   TLNELIQRLYFNKSVGSSTTSLPISRKSFRDDLVDNIRKIPPLPLRRRTTAEVARPVDS
FT                   FARDTPVSRRSTTDRLRRPPPPIPNKRIQLSREQEESIMATRHLNSDDHRSNADESPKR
FT                   PPALPPRRTDSTLYDTIQDKSSLSPSASSISSSAQSSVSEGFFIPSSQNDMEGTGTIVD
FT                   KRADNWQGRVINAIDELKSANVNVHFAFFMEPELCLEDSLSIIESTKERTPSEK"
FT   CDS_pept        969098..969703
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000142072" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19351146"
FT                   /locus_tag="CAGL0K09900g"
FT                   /product="Strain CBS138 chromosome K complete sequence "
FT                   /function="sequence-specific DNA binding"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG61612.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0043565"
FT                   /db_xref="HOGENOM:HBG103388"
FT                   /db_xref="HOGENOM:HBG435328"
FT                   /db_xref="InterPro:IPR003958"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="UniParc:UPI00003B6D2E"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FM95"
FT                   /transl_table=1
FT                   /translation="MEKMEKTYGQEPGQEPGQEPGQEQEQALEQSREQEQGRGAGMKGE
FT                   ELDVQFDNGAHEDGLEFEEDEDVFRNVGLGLEGHYKEIMIEYWQQLINEIESTNEPGSE
FT                   YQDDFKSHSLPFARIRRVMKTDEEVKMISAEAPIIFAKACEVFITELTMRAWCVAEKHK
FT                   RRTLQKADIAEALQMSDMFDFLIDIVPRSTIGAQNNSS"
FT   CDS_pept        970442..972091
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21046836"
FT                   /gene_name="VTS1"
FT                   /locus_tag="CAGL0K09922g"
FT                   /product="Protein VTS1"
FT                   /function="RNA binding"
FT                   /function="nucleotide binding"
FT                   /biological_process="protein transport"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAG61613.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0015031"
FT                   /db_xref="HOGENOM:HBG058890"
FT                   /db_xref="HOGENOM:HBG202932"
FT                   /db_xref="InterPro:IPR001660"
FT                   /db_xref="InterPro:IPR010993"
FT                   /db_xref="InterPro:IPR011510"
FT                   /db_xref="InterPro:IPR013761"
FT                   /db_xref="UniParc:UPI00003B6D2F"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FM94"
FT                   /transl_table=1
FT                   /translation="MLANKFDEMHHPVPDSSMNGNPLCNSSANVGQGNRNSNPIQSRGT
FT                   GHSSSPIYNNPLRTAHPGAVLLSPQSSSLNIIDTTVGNAMSPTVPSSAASSIFFNDFGL
FT                   DSSTNLNKSAMNANSNRPMTTIPLSSNSTSQSYTLSFQQENKKTNSNSTLNNVNNGLVT
FT                   AGSVSNSHNNIFLDSFLSHDNTMQPNNSSNNNNNNNQNANNSLNFNTDVNQLCTWMSML
FT                   TANQQSVVMDNIISVLNESTLNYTKMKLDTMFGTTSSSPTSAEAMQNLGQPKESGNQNS
FT                   NQNNIASPIPSTLDSVFANNSMKYLQSQSTSGSNHFHQAFNSKGSSMNWSSQASNIQNP
FT                   AYDYLNDYRQRPKSAEPPLSHQTHYQPSNLSISQFKPQNSNGNSSNTNTNRNLNNSNNS
FT                   NNNSTANNNNIGSNNTKRMNDITNSADVPVTSSFQNLTLNNQNGSTTTSSNNGNSSSGA
FT                   SSNSSMNPKSLTDPKLLNNIPIWLKTLRLHKYSDILNDLSWEKLIYLEDEDLLKRGVLA
FT                   LGARRKLLKAFTIVRDYKNRDLIDNSAYLNIK"
FT   CDS_pept        complement(972332..974059)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000066009" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18503379"
FT                   /locus_tag="CAGL0K09944g"
FT                   /product="Strain CBS138 chromosome K complete sequence "
FT                   /function="3',5'-cyclic-nucleotide phosphodiesterase
FT                   activity"
FT                   /function="metal ion binding"
FT                   /biological_process="signal transduction"
FT                   /protein_id="CAG61614.1"
FT                   /db_xref="GO:0004114"
FT                   /db_xref="GO:0007165"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="HOGENOM:HBG058891"
FT                   /db_xref="HOGENOM:HBG202933"
FT                   /db_xref="InterPro:IPR002073"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR023088"
FT                   /db_xref="InterPro:IPR023174"
FT                   /db_xref="UniParc:UPI00003B6D30"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FM93"
FT                   /transl_table=1
FT                   /translation="MTTLFIIGTEPQNIAENSAQVDVFDRIITLKDVDSLIDKIYTDRL
FT                   APRLKAFAYETSLSVVCFNGNNISGISPDNLDRILKRFLPALNITVVQSIEFLNDKDFM
FT                   DSIRNNKVIGNDTILRINHWVYHQHDKPTGDSNDTCYTNLYSLMSHLTTSNSFAKNEPI
FT                   PRIIRNINFREYFNDIYGQYDSDTVMEKHFIDTLSTWNFCAIKFTTKELILCAFFLLRS
FT                   LSKRANVLISDNKLLLLLITIEASYHQINKFHNFRHAVDVMQATWQICSNLGGNGSIDL
FT                   SPLTVLLLSMSAIGHDIGHPGTNNQLLCQHESFLATNFDNKSVLENFHNTLFQNLLVDH
FT                   WPQILKAARYKTVQSGEINVTDIPFVNLKKSNNINENDDNDKKMTINVITNAILATDMA
FT                   MHAKYVDKLDELLKVPQHLLPLPTLIAVIIKAADISNVTRPLSISARWAFLITLEFNDC
FT                   SLLDKYASDVKEDGTSSKTACYNSNGKQRVTDPEYYKRNSPEYIVDLVLNREEEDDEKY
FT                   LKRLLQSYPNIPQGQIFFINTFAGKFFGRLGELFPELQFLSNNVNSNKSYWESMVAKN"
FT   CDS_pept        complement(974931..977090)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000265546" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17446738"
FT                   /gene_name="PRT1"
FT                   /locus_tag="CAGL0K09966g"
FT                   /product="Eukaryotic translation initiation factor 3
FT                   subunit B"
FT                   /function="nucleotide binding"
FT                   /function="translation initiation factor activity "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAG61615.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003743"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="HOGENOM:HBG024617"
FT                   /db_xref="HOGENOM:HBG381136"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR011400"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR013979"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniParc:UPI00003B6D31"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FM92"
FT                   /transl_table=1
FT                   /translation="MAAAEIKLEDIPVDDIDFTDLEKEYSVDDEFKFDNYVVVTGAPVI
FT                   PESKVPVLKKALGGLFSKAGKVVDMEFPLDDDKKSKGFLFVECGSDVDAKKIIKAFHGK
FT                   RLDLKHRLFLYSMRDVEKLSEQGAGEFVEPELPGFVPTSTLKSWLADEDGRDQFVIQKD
FT                   NLTGIFWNSMHESEDDVVESRTNWSTNYVRFSPRGTYLFSYHPQGVTSWGGPQFDRLRR
FT                   FYHPNVRTSSVSPDEHYLVTFSPEPIELDDSVPESPFTKRNEGHHICVWEIDTGLLCAS
FT                   FPLTKNPNLQWPFVKFSYNDKYCARFVGDRLAVYDCTNKFSLLEAPALKVSGIRDFSFA
FT                   PTGVELQPFNKNDEPSVLLSYWTPETNNSACTASVVQVPRGRVLKTVNLVQVSNVTTYW
FT                   PEGGEYLVFNVERHTKSKKTLFSNLQICKLTEKDIPVEKIEVKDRIMEVGWEPHGHRFI
FT                   TISTTEGPDDNIAIPKNVVRFYAPEKKEGVKNKIVVKRWVVIKEIEKKFYNTVSWSPAG
FT                   RFVTVCALVKPNMRKSEFQFFDLDYPGEKNLNERKDVLATLKDVGESNYGAATDLCWDP
FT                   SGRFLTAWSSSLKHKMENGYKMFNIAGVIIKEDILPNMKNFAWRPRPESLLSNAEKKKV
FT                   RKTLKEWSAEFDEQDAMANDSAVRDLILKQRAMLKEWREYRAAKAQTTTIFDIAPWLDT
FT                   TKDHEDFVKIEEIKEEIVEEIKEKL"
FT   CDS_pept        977846..978436
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000233147" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19351147"
FT                   /gene_name="TVP23"
FT                   /locus_tag="CAGL0K09988g"
FT                   /product="Golgi apparatus membrane protein TVP23 "
FT                   /cellular_component="Golgi membrane"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAG61616.1"
FT                   /db_xref="GO:0000139"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG059967"
FT                   /db_xref="HOGENOM:HBG526983"
FT                   /db_xref="InterPro:IPR008564"
FT                   /db_xref="UniParc:UPI00003B6D32"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FM91"
FT                   /transl_table=1
FT                   /translation="MDHVRNFYDTILRSSHPLLMAFHLAGKAAPLAFYIAGFLFPSFTA
FT                   LFITIVLLLAADFYFTKNISGRRLVQLRWWYDSSATSTETFTFESHKQYTAGPPINPID
FT                   SKLFWWSMYLTPAIWFVLGILAILRLKLITFILIAVATCMTGWNTYGFRCCDRWNPNNS
FT                   QSTEPFFQLPSIPGLDNITRLARFQSFFQSAAN"
FT   CDS_pept        complement(978660..979838)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000164004" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17446739"
FT                   /locus_tag="CAGL0K10010g"
FT                   /product="Strain CBS138 chromosome K complete sequence "
FT                   /protein_id="CAG61617.1"
FT                   /db_xref="HOGENOM:HBG026213"
FT                   /db_xref="HOGENOM:HBG714063"
FT                   /db_xref="InterPro:IPR007823"
FT                   /db_xref="UniParc:UPI00003B6D33"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FM90"
FT                   /transl_table=1
FT                   /translation="MFKVEGWDIKTDKVAFSDSKKEKKAKNKKEKRTKSKKFENRDGAD
FT                   ITDVADVQDAEARDVQDVEARNAYVDKRKVEYDKKEETNSKKRKVSKDKEEAPQPTIAQ
FT                   SQVAKKLTPLQQKMMAKLTGSRFRWINEQLYTISSKDALQLVKDQPQLFDEYHDGFRSQ
FT                   VQSWPENPVDVFVDQVRLRAKKPVNAPGGLPGLKDRKIVIADMGCGEAQLALDVNTFFK
FT                   KYNKKAKKSHQRNWEVHSFDLKQANERITVADIRNVPLPDNSCTIVIFCLALMGTNFLD
FT                   FIEEAYRILAPRGELWIAEIKSRFADGKGDEFVNTLKLMGFFHKKTDDENKMFTRFEFF
FT                   KPPAEIIEERKAKLERRQKFIEVETEKEELEKKRSKIAEGEWLLKPCIYKRR"
FT   CDS_pept        complement(980068..981372)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17446740"
FT                   /locus_tag="CAGL0K10032g"
FT                   /product="Strain CBS138 chromosome K complete sequence "
FT                   /protein_id="CAG61618.1"
FT                   /db_xref="HOGENOM:HBG123829"
FT                   /db_xref="InterPro:IPR018856"
FT                   /db_xref="UniParc:UPI00003B6D34"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FM89"
FT                   /transl_table=1
FT                   /translation="MEHGELVSEYRCYSERVSRGLYHAEVCMTVRMLHSCLDQSHARVL
FT                   GGKLYWKNRAIRRLKFVGTVIGVKYMWLKGDDYAVIHLDDSSDSSILKCKCEVNQLNSF
FT                   GININAGFIGSRVEVCGVYNTEFNELEVGFIGVLPSTLFSEIEHWRKCCLLLRMPDDLT
FT                   DEELKASGIGDDEMQDGRDSPLDEYFSTPPQNKAQFIEKLVLRDVKDKLEITSPDPVRN
FT                   ESISVVDDTCDNTTLGSNTIDLRTAIEPITQPEVSGNDNFYKPATGSTSKRKLYRKLFI
FT                   AIYLIPEEECTINDLARDIGITSVLKGFLDGQGHISNDDMQIILQEYLSQLITGDVLVI
FT                   TARNRVSLKKLHALKAYTQKRINLLLKIQALLGTVRYQDVLQSTSMAIPAETIIDAFKE
FT                   SLRTIDAGVAWFIETHQHSFTIHFTYSQSTQTCNN"
FT   CDS_pept        981723..984107
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000115832" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18503380"
FT                   /locus_tag="CAGL0K10054g"
FT                   /product="Strain CBS138 chromosome K complete sequence "
FT                   /function="DNA binding"
FT                   /biological_process="regulation of transcription "
FT                   /protein_id="CAG61619.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0045449"
FT                   /db_xref="HOGENOM:HBG059965"
FT                   /db_xref="HOGENOM:HBG203147"
FT                   /db_xref="InterPro:IPR004875"
FT                   /db_xref="InterPro:IPR004906"
FT                   /db_xref="InterPro:IPR006600"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012287"
FT                   /db_xref="UniParc:UPI00003B6D35"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FM88"
FT                   /transl_table=1
FT                   /translation="MLSIEQRYNICLMAERHPRWTQLELAKWAYDTFQLDKVPSQGTIS
FT                   RLLSRKSTYMNCKEHERDATRLRTPNNLLVRRIIQEWISQSLWNGIPITSPIIQETAHS
FT                   VWQRIPPEFREGNGSFSYKWITNFLAKMDVNISALDEELPKTPKVWTFEERSALKDLFA
FT                   KVPPKDLFTLDETFIAYNLPLDYAQYEASRIQRKIEVATVMLCSNLDGSEKIKPMVVGR
FT                   YNSYKSFRNYFPSEPIDPVSQSMLGQKMAEKFNVTYHSNRKSWLTSNLFHNWLAQWDKR
FT                   LGAYNRKIWIVLDDSCSHRIVNVHLKNINLVYTSANSRFLPFNWGVLDEFKTRYRIQQY
FT                   QALIELQRRLESKLKSKEILISFEQSQLTMSNAFKFISRAWSDIPVDTIKANWKSSGLL
FT                   PNDMIKLNETVSMAFKKNEALEAKLEKLCNEYHCEKKWDYEMLLDLNIENKNTNFLSTE
FT                   ELVESAIIENYEPDGVDNDAQPSTNEFNAQLPESENTKQFIEGQNGYTHLESRKNSLNI
FT                   GDPKSNYNSDFLNLITSGYHANQNSTSSNNDAFTQTNIFDVSTLIDKSNIFMDANDDNI
FT                   DFNNVNVDLPLGNEEYLNDLFPQSIDVSHTTTKPIDIHDNSAIIEQTFDDLTTGKTDRT
FT                   NSVEHDDSTNQLDNNVQQILDFYGTSPESHTSSNGLKSVQTSDSSSPLDTIQEGNSLKT
FT                   DIEIASSLQVLLKHINHNTLKFNKRTVKQLSNTYQELVKKVKKNQNQQKQKPEQFKFED
FT                   IFFNNSNSDNPTTNESNYDLALEKTNGGTSQFQVKEVDPFF"
FT   CDS_pept        complement(984275..987301)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20197966"
FT                   /locus_tag="CAGL0K10076g"
FT                   /product="Strain CBS138 chromosome K complete sequence "
FT                   /function="binding"
FT                   /protein_id="CAG61620.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG059963"
FT                   /db_xref="HOGENOM:HBG395717"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR016902"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="UniParc:UPI00003B6D36"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FM87"
FT                   /transl_table=1
FT                   /translation="MASKPDQIEPTGVKDEVNSTNDMTTRVISRNDLQINNENDVNENT
FT                   TDANTNDECMTTVPSTIDESPKDSRIENKDFGSKNNVAFLEDTVSTEDDQISRAANHIG
FT                   RDESVDTETAESVVLGKVYTDIDKSSPVSEAATNNNNADTSIIETQTSKGDDDKDDEDD
FT                   EDDLEDEDGEDDEDEEDDEKEDDDDDEDDDGDEPPLLKYSRIKNLFVDLPKRDSISTCC
FT                   FGETFFAFGTHMGLLHITKPDFSAIKTLKCHRSSILCINIESDTIATASIDGTVIIISM
FT                   DDLQNLTAYDFKRPVNAVALHSNYSTNKLFISGGMAGDVILTQRNWLGNRSDIILDSKK
FT                   GPIMGIFIVDDMLIWMNDDGITICDIPSRTIMLTTKFPIGLEYERPDLFKPFLHKIDTD
FT                   RFMVGWGRHLWAFKFSKITDPKNESAKLVSLISSAASSLKITPEKNVVLESHHCLDQYL
FT                   AGIASFKGDQLMCLGFPVSENNDPLKGILPQISIIDLWDASEIYSNDIVTKDYDKSNLN
FT                   DYHLGVQLNNDINEYYLISKFDYIKIDTLTLKDHYDWYYEKKNYTRAWEVGKVILPPHS
FT                   LFGLGVKAVNDLIHKKQILNALEMSRRVFDTIDQLHNQELRSDNDLDWGKLYEHFLQIS
FT                   QAYQLSDFLPNSKRIPSQIYEKILSSLIDNNKIEDLKDCIIKWGDKITNIETIETKLLQ
FT                   LKSAQQTSNSKKELIDSLVSLNLEAKRFSKVIPYMIENKDDRIFEILVRNKLTSHFLSD
FT                   ITSIILVPLGDKDINKLDIKDLRQILKKSTDFICTSLRTIRLSYLIERLSADTNLSKLK
FT                   LVVLEEIFTRDPSLLRGNEDTMVELYALCDPPKLLPFLKEYDGYSNTKAIDICKGRKDL
FT                   YHELIYLLGRVGETKRALSIIIDELNDPQLAIQFVKSWGDQELLDFMIGYSLDKPDFVI
FT                   ALLQCEDQSGNMHVKVLKGVPENLEIEGIAPILKNMTKEDMLEIVSKQILASIVEEDTE
FT                   NYAKDWIKYRKLGRVFDVH"
FT   CDS_pept        987635..987856
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000199698" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18503381"
FT                   /gene_name="TFB5"
FT                   /locus_tag="CAGL0K10098g"
FT                   /product="RNA polymerase II transcription factor B subunit
FT                   5"
FT                   /function="DNA binding"
FT                   /biological_process="nucleotide-excision repair "
FT                   /biological_process="regulation of transcription "
FT                   /biological_process="transcription"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG61621.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006289"
FT                   /db_xref="GO:0006350"
FT                   /db_xref="GO:0045449"
FT                   /db_xref="HOGENOM:HBG175461"
FT                   /db_xref="HOGENOM:HBG560304"
FT                   /db_xref="InterPro:IPR009400"
FT                   /db_xref="UniParc:UPI00003B6D37"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FM86"
FT                   /transl_table=1
FT                   /translation="MVRARRGVLLKCDPSIKALIVQIDSERHDIILEELDETHLLVHPT
FT                   KVEFIKMELNRLLSKNIYNPLDEEEEEH"
FT   CDS_pept        complement(988255..988584)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000201340" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19351148"
FT                   /locus_tag="CAGL0K10120g"
FT                   /product="Strain CBS138 chromosome K complete sequence "
FT                   /protein_id="CAG61622.1"
FT                   /db_xref="HOGENOM:HBG059961"
FT                   /db_xref="HOGENOM:HBG203146"
FT                   /db_xref="UniParc:UPI00003B6D38"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FM85"
FT                   /transl_table=1
FT                   /translation="MKLPFRYTRAQLEIFRFSFCLLAPVAVMYYIGTDTDKKLNVPGFW
FT                   PDPESLNQIPKEPYEIKAELARMKKERLEKRLKLEKRLKEEFGLDVEAEKAKMREELGL
FT                   TSKTE"
FT   CDS_pept        988919..989686
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000072578" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17446741"
FT                   /locus_tag="CAGL0K10142g"
FT                   /product="Similar to uniprot|P38957 Saccharomyces
FT                   cerevisiae YDR078c"
FT                   /protein_id="CAG61623.1"
FT                   /db_xref="HOGENOM:HBG059957"
FT                   /db_xref="HOGENOM:HBG512107"
FT                   /db_xref="UniParc:UPI00003B6D39"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FM84"
FT                   /transl_table=1
FT                   /translation="MNEDASVINYSEIFSTLVKDDGVDDMVASFLYYMFPRELFIRGLS
FT                   LLESSDMFIYVFDAMKGESSESEVNTDVDTSVNLSSKENIATSTTATQINAKDNSVDVT
FT                   KNYLNKLYEDDDLLQYRLIVKSSSSDGIETPVYVDLHNWLCSCEEYTEIMRECLLADKD
FT                   LVQEFVQLIDDFSCFRDDTFGQIEAHSLSLQKYVNTKKLLCPHLLAYSIILLSSPKVLR
FT                   HYTVEKPGVIVIPITSIDEWLKLHINVLYSEKK"
FT   CDS_pept        complement(990287..990940)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21046837"
FT                   /locus_tag="CAGL0K10164g"
FT                   /product="Strain CBS138 chromosome K complete sequence "
FT                   /protein_id="CAG61624.1"
FT                   /db_xref="HOGENOM:HBG123830"
FT                   /db_xref="UniParc:UPI00003B6D3A"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FM83"
FT                   /transl_table=1
FT                   /translation="MKFTTAFATLAIASSAVMGQFSNSSIPIDPSTSVPSQNTTTVSST
FT                   TTPPTTSSTTTIPAPPPGFNSTTTETEIEVVTAYTTYCPYPTTFTQNGVTYTVTSATTL
FT                   TITDCPCTITKPKPHPQPQPQPTTKPAPGPEPKPQPQPQPQPSTKPAPKPDTTTTVRQS
FT                   VAPHPTTILSTQRSSLAAQPTSSQHVIVTQHVNGAANLAASSVMGLAALLALFM"
FT   CDS_pept        complement(993120..994133)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17446742"
FT                   /locus_tag="CAGL0K10186g"
FT                   /product="Similar to uniprot|P38953 Saccharomyces
FT                   cerevisiae YDR076w RAD55 DNA repair protein "
FT                   /function="ATP binding"
FT                   /function="DNA binding"
FT                   /function="DNA-dependent ATPase activity"
FT                   /biological_process="DNA metabolic process"
FT                   /protein_id="CAG61625.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006259"
FT                   /db_xref="GO:0008094"
FT                   /db_xref="HOGENOM:HBG123831"
FT                   /db_xref="InterPro:IPR014774"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="UniParc:UPI00003B6D3B"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FM82"
FT                   /transl_table=1
FT                   /translation="MSFGVPLSQLIVNAPKPISTGLTALDNELDGGFRYKSSYEIYGIP
FT                   GIGKTWLASETVKTYLQENDDGKVLWITTSGVAPQMLLRSEAEVKERIEYIRITKFTEL
FT                   LYFYQKQVMSEPDSISQSQSPAESAMPSTGTEAITNDTNSNDSYRLVIIDGLSRLLNLQ
FT                   LHSLSKKNCTTLHDTKCRYLIILMTLITKYNNKNNACHVILNDSMNTTYVPENNGGAED
FT                   ELEMVEDGFNFFVKSHNYLYENNKRRRVYAPNVIRSALVANNALGNRDSRWEIFIKRRI
FT                   GIFWEWEDKVTRNLDTECSKKATGNGRCRVALVHKDRQKSSQSLNFSVVPFDIDLD"
FT   CDS_pept        complement(994696..995625)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000172696" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17446743"
FT                   /gene_name="PPH3"
FT                   /locus_tag="CAGL0K10208g"
FT                   /product="Serine/threonine-protein phosphatase 4 catalytic
FT                   subunit"
FT                   /EC_number="3.1.3.16"
FT                   /function="metal ion binding"
FT                   /function="phosphoprotein phosphatase activity "
FT                   /cellular_component="cytoplasm"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG61626.1"
FT                   /db_xref="GO:0004721"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="HOGENOM:HBG488218"
FT                   /db_xref="HOGENOM:HBG716770"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR006186"
FT                   /db_xref="UniParc:UPI00003B6D3C"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FM81"
FT                   /transl_table=1
FT                   /translation="MLVDLDEILVSLKEGRHIPEETVYALCMDSQELLMNESNVARVDT
FT                   PVTICGDIHGQLHDLLTLFEKSGGVEKTRYVFLGDFVDRGFYSLESFLLLLVYKLRYPD
FT                   RITLIRGNHETRQITKVYGFYDEVMRKYGNSNVWRYCCEVFDYLSLGAIINDSIFCVHG
FT                   GLSPDITTLNEIRAIDRKQEVPHEGGMCDLLWSDPDEVDTWSMSPRGAGFLFGKGEVDE
FT                   FLHVNNVDLIARAHQLVMEGYKEMFDGGLVTVWSAPNYCYRCGNVAAVLKIEDNLERKY
FT                   TIFEAVQAQNGVGNTIIPTKKAQMDYFL"
FT   CDS_pept        complement(996303..997643)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000787" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18503382"
FT                   /locus_tag="CAGL0K10230g"
FT                   /product="Strain CBS138 chromosome K complete sequence "
FT                   /protein_id="CAG61627.1"
FT                   /db_xref="HOGENOM:HBG192556"
FT                   /db_xref="HOGENOM:HBG202850"
FT                   /db_xref="InterPro:IPR007149"
FT                   /db_xref="UniParc:UPI00003B6D3D"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FM80"
FT                   /transl_table=1
FT                   /translation="MSEEEKHNMSEEQVELAPEEPPKEEAEDSVEDGKDQEETMPEKEE
FT                   EMDDLFGDDEDDEDEEEITTGRGRNGTTGISDDEEDDDEEGITRRSREREDYDMEDYDD
FT                   EAKEQEMYTRKFYGEDAVNYSDDDEPHTFKESNVDLIRHIIPYKTRTTNNEHDEIFYAK
FT                   VPAFLTIDPVPFDPQTFEATVDERLSKSASKEDQLGDRLIDENTIRWRYSRDAEQHVFK
FT                   ESNAQIVQWSDGSFSLKLGDEYTDIIVNDTDNTFLTVSHDQQELMQCYDGGEITKTMMF
FT                   IPTSTNSKIHQKLSKAVSRRNARQNLGPGSYIIKQDPEIEKKELEKLQGQIIRERRKRQ
FT                   QKEIETRENAENGFAETGEFKRGNTPSRSSRQNEYEDDGFLVDDEDEEDFIDDGEEEEE
FT                   EEEDDDLDADRLRNAKRQGEHAFTEDDDEEDDNKRRKTAIISSEEDD"
FT   CDS_pept        complement(998144..1001947)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000094458" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18503383"
FT                   /locus_tag="CAGL0K10252g"
FT                   /product="Strain CBS138 chromosome K complete sequence "
FT                   /function="ubiquitin thiolesterase activity"
FT                   /biological_process="ubiquitin-dependent protein catabolic
FT                   process"
FT                   /protein_id="CAG61628.1"
FT                   /db_xref="GO:0004221"
FT                   /db_xref="GO:0006511"
FT                   /db_xref="HOGENOM:HBG058469"
FT                   /db_xref="HOGENOM:HBG202851"
FT                   /db_xref="InterPro:IPR001394"
FT                   /db_xref="InterPro:IPR018200"
FT                   /db_xref="UniParc:UPI00003B6D3E"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FM79"
FT                   /transl_table=1
FT                   /translation="MRMNDDAVTGMGVHFGGDPPEADLQGEPIPSADVTNIEDDGRQLL
FT                   YPNIGTHLPLKTSDRLLDDILCSVGFLTSGDNKSILNSNTLEYSKQRPHIKGSAVGFFQ
FT                   DQVIIQTKYEYPSKSCPEHNKIFVIMGILIGTDYLEKAEKKQISEVTEIPIYHVKISVK
FT                   VRSILENSKKLVGVSRYYKLDQLHDYDRVDFPSYDPTDSKLLDSALYATDDTNKIVLIE
FT                   IYKPEFDPEDKDLSVSSVQIKNRFAQAKEKFPQLAKEESPTQLDSINTLFKLFKGPLKR
FT                   KSDDAPQKSIEAEHPLLISNMNPSALVTHFGFTYTNENIPGGEYMAPDLVNYLGDPNIQ
FT                   KLRDTFTRKCLELIAYGNIIISSLPQNITSTAEFSKKYRILRTIQPEFSLFSWLQLLGD
FT                   FKSRNIELLNVNEHKGYHLQEAQKRVYYSPFDIDSNFTNLSVCLHYAERDIIQNYERLI
FT                   TLDEPNIGIYFDSLSVVANRKGSYQLLSYCGKQDVIGQEALQNSLAVFGIDYTKVTLES
FT                   LDENLLLSVYKHEWKENPDNNRISDLKNALRLLAKYFTSDYLKFYVDYEPYRIIQKAYD
FT                   LLEIDESVDEDIIQTAYTIKINDAPGLKIDCDRALYTIAYSRRSLMLFNFLFDQCPEFQ
FT                   RYYGAQSLGYHQSFEILQINENITEPNLLHVFQQKWKNTLLEEPDQLLKYRAALTKIAL
FT                   ERNSNLLLNFLETGNINPNSLPAENWPTGINNIGNTCYLNSLLQFYFAISPLREYIVQY
FT                   QKTIADLSSNPDSIISKRRIGGRQVGKNEIERSVQFLYQLRDLYNDMIFSSQRCVTPKR
FT                   ELAYLAFAPSSIDVEFENAKTKSPISNIEGSNSTTDSQPMPSTGENIDHNMDIEQEERN
FT                   NEEINSTNNIESNDLVSNNHDIEMLDTDKENEGNMEIEDTAIKVAKIDPEQLENALELG
FT                   RQQDVTECIGNVLFQLESSSSPTSLSEDHEQNDLIKELFFGETNQHIKPLKADSVTRTK
FT                   VERFVSLLVNIADHPKDVYDALDLYFKEEYLTMEEYGEVKRELAIKKFPTILQIQIQRV
FT                   YYDRERFMPYKSIEPLPFESDIYLDRYADTDDVKLLQKREETAELKRQLRSFKERQKEL
FT                   LSRNELGLSRRDAYKETANFLRSEVLQNTNISISDPDLLATKLEESASKVADELSDLYV
FT                   KITNLEEKINHQFDDFTEHGYTLFAVFIHRGEASYGHYWVYIKDFVNSIWRKYNDETVT
FT                   EVPEEEVMNFTEGNTATPYFIVFVKKGHEKDIEPLKRMIEKN"
FT   CDS_pept        complement(1002502..1003200)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000184972" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17446744"
FT                   /locus_tag="CAGL0K10274g"
FT                   /product="Strain CBS138 chromosome K complete sequence "
FT                   /function="oxidoreductase activity"
FT                   /function="transition metal ion binding"
FT                   /biological_process="oxidation-reduction process "
FT                   /biological_process="protein metabolic process "
FT                   /biological_process="ubiquinone biosynthetic process "
FT                   /protein_id="CAG61629.1"
FT                   /db_xref="GO:0006744"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0019538"
FT                   /db_xref="GO:0046914"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG267823"
FT                   /db_xref="HOGENOM:HBG656570"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR011566"
FT                   /db_xref="UniParc:UPI00003B6D3F"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FM78"
FT                   /transl_table=1
FT                   /translation="MMIRNTVTKSSKRSFSVLSSLKATEQSSSKTKSTKEVKYENLSEA
FT                   QRAYLSRVIRVDQAGELGANYIYAGQYFILANKYPHLKPVLKHMWEQEIHHHNTFNNLQ
FT                   IKNRVRPSLLTPFWKVGAFAMGAGTALISPRAAMACTEAVETVIGGHYNEQLRCLNNQY
FT                   NLDKSDNSGVGQTEEVKSLIANIKQFRDDELEHLNTAIEHDSHLAVPYYLLTESIKGIC
FT                   RVAIWGAERI"
FT   CDS_pept        complement(1003568..1004314)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000214294" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21046838"
FT                   /locus_tag="CAGL0K10296g"
FT                   /product="Strain CBS138 chromosome K complete sequence "
FT                   /function="hydrolase activity, acting on ester bonds "
FT                   /biological_process="lipid metabolic process"
FT                   /protein_id="CAG61630.1"
FT                   /db_xref="GO:0006629"
FT                   /db_xref="GO:0016788"
FT                   /db_xref="HOGENOM:HBG174717"
FT                   /db_xref="HOGENOM:HBG618579"
FT                   /db_xref="InterPro:IPR001087"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="InterPro:IPR013831"
FT                   /db_xref="UniParc:UPI00003B6D40"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FM77"
FT                   /transl_table=1
FT                   /translation="MLQVKKLLLFGDSITQFSCGRCESVEEAGRIDGFSLGSGLGAVYN
FT                   RKLDVVTRGFSGYNTRWCLPVLDAVLDAELQGQNEVALSVIFFGSNDSVSDGPQRVPLE
FT                   EYCQNIVKMVGKMKAAKIKTVLVTPARVDKQQWSHHFAEDAKVGYVRSDALYKEYRDQL
FT                   LKIGEQEGIPVVDLYTEFGKHDVSSLLTDGIHFSSEGYRVFFLALMKTIRENLPELAPE
FT                   NLPWHLPYWRDVTEDPTSVIAALNKY"
FT   CDS_pept        1004753..1007506
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000788" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17446745"
FT                   /locus_tag="CAGL0K10318g"
FT                   /product="Strain CBS138 chromosome K complete sequence "
FT                   /function="zinc ion binding"
FT                   /biological_process="signal transduction"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAG61631.1"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0007165"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG123833"
FT                   /db_xref="HOGENOM:HBG203275"
FT                   /db_xref="InterPro:IPR000198"
FT                   /db_xref="InterPro:IPR001781"
FT                   /db_xref="InterPro:IPR008936"
FT                   /db_xref="UniParc:UPI00003B6D41"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FM76"
FT                   /transl_table=1
FT                   /translation="MSVSVDSVISGDSKELPVCVKCKEPITTGHAYELGYDRWHIECFA
FT                   CHKCDRLLTCDSDFLVLGTGALICFDCSDSCKSCGKKIDDLAIILSSSNEAYCSDCFKC
FT                   CKCHENIQDLRYAKTKKGLFCLHCHEKLLAKRRTYDEKKRKLLEKKNLPKIPKITDDDV
FT                   ESPSLNPIMKSRQTDDDMKKSSSSLEIPKRSVNRPRSAIRDAQIMKENGLVKSTSDSII
FT                   THYLDVDETKENESKDVIDKSSSRKNSAVSEKQLLSPNRPAHLRKSSLSAPAEEFYTAT
FT                   EFQSPLRNNIIRSPLRDQSQKSPFRGSKTDILLKSPKSHRRGMVLDTDDENSPESFNIL
FT                   DCFDPSDGSSLMAPPIVGSSNHTSLGNSESPRTFPTSLTKELSNDKLRNDKSAVMEGIV
FT                   NGELDTSSIHSFEGEQDNLKNEDDKGHSQDNVLSKGRIGELNLNSSRLGNSDSDSLYEG
FT                   SKQYNSSSEILKQNGSLSKPPLNHDRDYNDSDYFYEKEIKREIMRSEMHLRKLRHEVDV
FT                   YRNKKKKYQKEIDEMKLARKELKLSLDNLQQEWNQLRAQIDESIIDHNDEDLSMISEAR
FT                   GKGTQPELAEVASVARTSNSKPRFWKLFSSSKETVIPPLISQPMQFPMQAVNYGINSTS
FT                   AMFSLGSNSDDNPLKLDISHPVLKNVNEFDDLKLISLQNTNDQSMANRSSSPITSDGSK
FT                   LYGSSLAARAQFEGNSIPFIIRACISFIESSDEFLTSEGIYRKSGSQLRIEELEKKFAD
FT                   YPVNKDSVEAPPPRFLEDQDIHTVTGVLKRYLRKLPNPVLTYQVYEPLISLVRDENLIE
FT                   ALPLINSKMTTESKSSERYFFMVETIRKILLNIPESHFDVLRLLSKHVCKVSSYSSINL
FT                   MTIRNLALIFAPNLLRDYTGMKEIEDMREKDYLMTFLFTYHEEILH"
FT   CDS_pept        complement(1007620..1009332)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000034027" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17446746"
FT                   /gene_name="ADE2"
FT                   /locus_tag="CAGL0K10340g"
FT                   /product="Phosphoribosylaminoimidazole carboxylase "
FT                   /EC_number="4.1.1.21"
FT                   /function="ATP binding"
FT                   /function="phosphoribosylaminoimidazole carboxylase
FT                   activity"
FT                   /biological_process="'de novo' IMP biosynthetic process "
FT                   /protein_id="CAG61632.1"
FT                   /db_xref="EMBL:AAC27548.1"
FT                   /db_xref="GO:0004638"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006189"
FT                   /db_xref="HOGENOM:HBG170177"
FT                   /db_xref="HOGENOM:HBG516369"
FT                   /db_xref="InterPro:IPR000031"
FT                   /db_xref="InterPro:IPR003135"
FT                   /db_xref="InterPro:IPR005875"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR013816"
FT                   /db_xref="InterPro:IPR013817"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR016301"
FT                   /db_xref="UniParc:UPI00003B6D42"
FT                   /db_xref="UniProtKB/Swiss-Prot:O74197"
FT                   /transl_table=1
FT                   /translation="MDSRTVGILGGGQLGRMIVEAANRLNIKTLILDAPNSPAKQITNA
FT                   SDHVDGSFANKEDIEALAAKCDVMTVEIEHVDVNALKEVQKQFPKLEIYPTPETIGLIQ
FT                   DKYVQKQHLVKNRIPVVPSITVENSKESLIKTGSSLGYPFVLKSRTLAYDGRGNFVVKS
FT                   EEDIEKGLEFLANRPLYAEKWASFKKELSVMIIRSLDGRVYSYPIVETIHKNNVCHLCY
FT                   VPARVPDSVQHKAKLMAENAIKSFPGCGIFGVEMFLLDDDSIVLNEIAPRPHNSGHYTI
FT                   NACVVSQFEAHLRAILDLPMPKNFTSLSTNSTNAIMLNLLGDPETKDKELQICERALNT
FT                   PGASVYLYGKESKPNRKVGHINIVCSSMKECDKRLQFIMGLKTDPIKHSVMEILNAEEV
FT                   RKPLVGVIMGSDSDLPVMSAACKMLEQFEVPFEVTIVSAHRTPYRMNKYASEAVSRGIK
FT                   VIIAGAGGAAHLPGMVAAMTPVPVIGVPVKGSTLDGVDSLHSIVQMPRGVPVATVAINN
FT                   STNAGILAVRMLGIHNYDYVKKMEEFLNKQEEEVLQKAAKLESIGYEKYLESK"
FT   CDS_pept        complement(1009984..1010889)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000168307" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18503384"
FT                   /locus_tag="CAGL0K10362g"
FT                   /product="Similar to uniprot|Q12375 Saccharomyces
FT                   cerevisiae YOR130c ARG11"
FT                   /function="binding"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="mitochondrial inner membrane "
FT                   /protein_id="CAG61633.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0005743"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG541806"
FT                   /db_xref="HOGENOM:HBG735918"
FT                   /db_xref="InterPro:IPR001993"
FT                   /db_xref="InterPro:IPR002067"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="UniParc:UPI00003B6D43"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FM74"
FT                   /transl_table=1
FT                   /translation="MSGAEETQWLAAAFRDILYGSIAGALGKVIEYPFDTVKVRLQTQG
FT                   RHVFPDTWSCITYTYKNEGIIKGFFQGIASPLAGAAIENAALFLSYNQCSKFLQHYTNV
FT                   SDLTNILISGAFAGSCASFVLTPVELIKCKLQVSNLQSLPLGVAGGNTVTERHTRIIPT
FT                   IQAVIKNRGFIGLWQGQSGTFIRESFGGVAWFATYELMKKYLKSRHNIEDPSLPNDNKT
FT                   WELLASGASAGLAFNASIFPADTVKSMMQTEHLGLKTAIKKIFVEKGLRGFYRGLGITL
FT                   IRAIPANATVFYVYETLSKL"
FT   CDS_pept        complement(1011380..1017694)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000141935" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18503385"
FT                   /locus_tag="CAGL0K10384g"
FT                   /product="Strain CBS138 chromosome K complete sequence "
FT                   /function="ATP binding"
FT                   /function="phosphatidylinositol phosphate kinase activity "
FT                   /function="zinc ion binding"
FT                   /biological_process="cellular protein metabolic process "
FT                   /protein_id="CAG61634.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0016307"
FT                   /db_xref="GO:0044267"
FT                   /db_xref="HOGENOM:HBG059126"
FT                   /db_xref="HOGENOM:HBG203609"
FT                   /db_xref="InterPro:IPR000306"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR002498"
FT                   /db_xref="InterPro:IPR011011"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR017455"
FT                   /db_xref="UniParc:UPI00003B6D44"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FM73"
FT                   /transl_table=1
FT                   /translation="MAIGQGTLPKDDQIEYNNEAGGTSTISEPIDLITRTGLVPKTTTT
FT                   TEITTEDILSNDITVPRVNDKSSNQLINDEMENHSYKESLSVNKLPHELNDNADHMDIK
FT                   SKNIEPINTIVIPDTSNFLPISNDIDKQEYISDPTSDKEEPPVESNTFLRSERNGEITS
FT                   NDLRSELRVDKNIQLRASPNQNKTLLFALANDMNSKRSSTYASKSTVKAIPIRNHSSHS
FT                   MARGFNSYYDNDDVSSLKSRSSSMAASFSKGFLLGFYNNRNKHANNQKVVLSKEYWMKD
FT                   ESARECFTCGKRFNTFRRKHHCRICGQIFCKNCTLIINGERFGYDRSLRVCQNCYKHAD
FT                   NYQDSSDEEYYEEENSVITREPSTNLMNEHLSKKEEQDSMNDFNIQEEGDSSIFNTPNK
FT                   NNEVLFIHDDDVHSIITSKQDSKLFISTPPPPPKMAIPATKQGESLEIAFNNNLVNRNS
FT                   NKTISHDGNNEKITIRDLDDPTSYKPNEKKNPNSTPSLRRSLFQYMGKTNRDQANNHMP
FT                   SNPLPDSSLLNNRNFQFKFNFRPELYNERRKSFGADKFNSNENKNAINVSQSPKLSLEY
FT                   DNNDLEDEASMSLYSSLHGSIPTDKPIGFVRTSSKSDQRAMASLHRIRHKRTGKSKSIS
FT                   MTYPSNLDSDFISQSSPNLLSVVSDELPLPQPTSILYRTGWDKASTGTNNAWKRHSSLT
FT                   SVRPSAEPKPELNKVAQIHLNSLLDQVLGDQDIADKELWKNKLLSLLSQIQNIILSAKD
FT                   LNTLDYRQNYLKIKRITGGSIDASEYINGIVFSKNLPNKHMSRKIENPRILLLMFPVEY
FT                   ERSENKFLSIDSVIAQEKEYLNKLVSRILSLSPDIIYVGANVSGYALDLFCNAGIVIQY
FT                   NMKPQVLERIAKYTDADIALSIEKLATNIKMGECQLFEVKSYLYDKHISKTYTFLRGCE
FT                   PTLGGTILLRGANETVLRKIKQIVEFMVYATFSLKLESSFFNDNFLQLSVEHYLLAKTE
FT                   SKNQQPEGYYSDFVEKFNNRLLSVSPTVSFPLPFLLKQARNLERELRLLEDQESTVHAA
FT                   KEEYQIGLLSDISNKLTKMELVNLGRYIMEKEIQDLKNEYKKRARQWEVYYSLTRNMLG
FT                   TGSHQSITVLYSMVSIKTATPCIGPQLMTIDYFWDSDISVGQFIENIVSTAWHPCKQGC
FT                   NTYLFDHYRSYVHGDGKVDVMLERFETKLPKLRDIILTWSYCKKCGCSTPILQISQKTW
FT                   NYSFGKYLEIMFWSERHSLLGVGKCGHEFTKDHVKYFSYNDLVVRLEYSDLEIHELITP
FT                   SRRIRWKPNRDIIMKVELYYGILDKINYFYSNVSERLDRIKLDGLVVDKMEPGKQKLNE
FT                   MKIMLENNKRNLLEKLEKQYKDTPGTEHLHLNSILRSLYNQTNFWNNEFKEFGETYLPS
FT                   ENDITRITTSQLKKIFGEPKKPDLIPESTHLNVSDRSNELERISESQSFISESKEDSVD
FT                   NNRAAERINALREHTKKPSISTSMINLSKHDQPSFIEHSVPPTTYNDSGYDSRVGKLTN
FT                   FFDQLHFDALTKEFELERELQKLQLNKSKSRKFRLQNSTPIVEIYKDVKDAVDEPLHND
FT                   EKIQNDDSNEVESVDYSNSSKAHRSTQQKKVSEMLESELKNSINRWGEAYINSDSNLAS
FT                   MEHLEKKGETDITKDNNKILDTDQKSVEVAPQPEKSTLMKTLATFWADRSAYLWKPFSF
FT                   PIGANEHVFTDSDVIIREDEPSSLIAFCLSTSDYNNKMASIKDDTDVAPVEKVVNNQDH
FT                   KKSSNQQNISDSSEKTHANSNIESVNETSSVLTEEKASVSDKYFDPAKNLEAIMTKKTA
FT                   IHLRYQFEDGLVVMSCKVFFAEHFEAFRKICNCDENFIQSLSRCVKWHSNGGKSGSGFL
FT                   KTLDNRFVIKELTHSEVDSFIKFTPSYFEYMAQAMFHDLPTTLAKVFGFFQIQVKNPIS
FT                   GSKNYKMNVIIMENLFYNKKTSRIFDLKGSMRNRHVEQTGKANEVLLDENMVEYIFESP
FT                   IHVREYDKKLLRASLWNDTLFLAKMNVMDYSLVVGINNDDYTLTVGIIDFIRTFTWDKK
FT                   LESWVKEKGLVGGGNSIMKQPTVVTPKQYKNRFREAMERYILMVPDPWYQDTN"
FT   CDS_pept        1018029..1019090
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000189291" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17446747"
FT                   /locus_tag="CAGL0K10406g"
FT                   /product="Similar to uniprot|P43599 Saccharomyces
FT                   cerevisiae YFR018c"
FT                   /function="peptidase activity"
FT                   /biological_process="proteolysis"
FT                   /protein_id="CAG61635.1"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="GO:0008233"
FT                   /db_xref="HOGENOM:HBG059127"
FT                   /db_xref="HOGENOM:HBG203608"
FT                   /db_xref="InterPro:IPR007484"
FT                   /db_xref="UniParc:UPI00003B6D45"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FM72"
FT                   /transl_table=1
FT                   /translation="MQLFNSWLLFCLAVVLASKGNDYGIHHLDYHIDNLQEKLTINRKE
FT                   YRKHVKSNLIVPFNSTRIPGSTEAIKIQDFIIHNFNQSMWNVEIDNFTEKDYNFTNLVF
FT                   TFEPDEDFADDDYIVLAAHYDTMILPEGFVGAMDSAASCAILLYIGQFLEYVHGTDDQL
FT                   FDPILKNASKGIKLIFFDGEEALVEWSDDDSIYGSKHLAAKWEKSGQLKDIHLLALMDL
FT                   IGGRDRLPIPSYFRNSHEYYKMLSDIEHSYLQLIKDETQDVKPLRNLGYAKRKSLNIND
FT                   DRFLIHDKNFMGDDHVPFYEKNVPILHLIPSSFPSTWHTINDDFRHLDQQTIYKWAVMM
FT                   SEFIIRSVESDTQ"
FT   CDS_pept        1019646..1020206
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17446748"
FT                   /locus_tag="CAGL0K10428g"
FT                   /product="Similar to uniprot|P43598 Saccharomyces
FT                   cerevisiae YFR017c"
FT                   /protein_id="CAG61636.1"
FT                   /db_xref="HOGENOM:HBG123834"
FT                   /db_xref="UniParc:UPI00003B6D46"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FM71"
FT                   /transl_table=1
FT                   /translation="MSQLEQASVTMNSSLEFINMQNPPPPKDSPYLAYIDKGCGESPTN
FT                   IKSVPYPTRRRSTNYVNTLRDKGLLREMEEVRTDVDKVSSKGDNNYTYGNLTSMSQQDM
FT                   KHESSKYFMAGSSHIPPQFDKLVYMGDSIDYDGPRRQYMEAEDAMDPLYKGYNGKVYKR
FT                   RPSFQYEDFKKDVYDKLHIFNDN"
FT   tRNA            1020559..1020629
FT                   /gene_name="tRNA-Gly (GCC)"
FT   CDS_pept        1020845..1023103
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000271637" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21046839"
FT                   /locus_tag="CAGL0K10472g"
FT                   /product="Strain CBS138 chromosome K complete sequence "
FT                   /function="ATP binding"
FT                   /function="ATPase activity"
FT                   /protein_id="CAG61637.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0016887"
FT                   /db_xref="HOGENOM:HBG543560"
FT                   /db_xref="HOGENOM:HBG758042"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="UniParc:UPI00003B6D47"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FM70"
FT                   /transl_table=1
FT                   /translation="MASIGTQVRKTCTSVDPIVTDYAVGYFNHLSGLTFDAVMSKQLDL
FT                   DSEVQFVSEMLVSAGADKEKVKDLSANILEQLNTQLKENASKLELTGDTSKRLLDINVL
FT                   KSHNNKANLNASLSLLGVGGDIEHAGRQMETRVDLKKLAKAEEKIAKKVAKRNNKFVKY
FT                   EASKLIGERKDEDYDSFFLEINPLDFGSSAGKSKDIHIDTFDLYVGDGQRILSNAQLTL
FT                   SFGHRYGLVGQNGIGKSTLLRALSRRELNVPKHISILHVEQELRGDETKALQSVLDADV
FT                   WRKQLLTEENKINERLKEIEKLREEFDEDSLEVKKLDNEREDLDAHLIQISEKLVDMES
FT                   DKAEARAASILYGLGFSTEAQQQPTNSFSGGWRMRLSLARALFCQPDLLLLDEPSNMLD
FT                   VPSIAYLAEYLKSYPSTVLTVSHDRAFLNEVATDIIYQHNERLDYYRGQDFDTFYTTKE
FT                   ERRKNAQREYDNQMAYRKHLQEFIDKFRYNAAKSSEAQSRIKKLEKLPVLEPPEQEKSI
FT                   DFKFPDCEKLSPPIIQLQDVSFGYSPDKLLLKDVNLDIQMDSRIALVGANGCGKTTLLK
FT                   VMLEQLRPLSGYVSRNPRLRIGYFTQHHVDSMDLSTSAVDWMSKTFPGKTDEEYRRHLG
FT                   SFGITGTLGLQKMQLLSGGQKSRVAFAALCLNNPHILILDEPSNHLDTTGIDALVDAMK
FT                   NFTGGILMVSHDISVINNVCKEIWVSEKGTVNRFNGTIYDYRDYILSAADAAGVVKRH"
FT   CDS_pept        1023698..1025185
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000202292" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17446749"
FT                   /locus_tag="CAGL0K10494g"
FT                   /product="Strain CBS138 chromosome K complete sequence "
FT                   /function="ubiquitin thiolesterase activity"
FT                   /biological_process="ubiquitin-dependent protein catabolic
FT                   process"
FT                   /protein_id="CAG61638.1"
FT                   /db_xref="GO:0004221"
FT                   /db_xref="GO:0006511"
FT                   /db_xref="HOGENOM:HBG027359"
FT                   /db_xref="HOGENOM:HBG524155"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR001394"
FT                   /db_xref="InterPro:IPR018200"
FT                   /db_xref="InterPro:IPR019955"
FT                   /db_xref="UniParc:UPI00003B6D48"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FM69"
FT                   /transl_table=1
FT                   /translation="MSNDTFSFNIKHAGKVLPITLSNDATALDLKTQVEELTQVPRSRQ
FT                   KFMVKGGLSDDSIANLQTIIKPGSTVMLLGTPDANLLSKPAEKHRFVEDLSPDQQVQQF
FT                   NSTPLGLQNMGNTCYLNATLQALFRADELKDLILQYDPSKVTNSDANDEIHYKIVLELK
FT                   RTFETLKKRSFKSVLPIMLLNTLRKCYPQFAERDPQGGFYKQQDAEELFTQLFHTLTVV
FT                   FGDKFANQFQINFRATIKDTANEDDVTVREDESDMKLQCHISGTTNFMKNGLIESLNEK
FT                   IEKRSDITGLNSTYAVQKQITKLPKYLTVQYVRFFWKRSSGKKSKILRKVVFPFQLDVA
FT                   DLLTPEYANEKIKVREELREVEKAKNEKEREAKKRKVEQTDVVMTPKEEYETKKALEES
FT                   EREYWLNEFKKRFPSNLAAGENPSSVYDLIGVITHQGANSESGHYQAFIRDESDENKWY
FT                   KFNDDKVSPIEKEKIEALAGGGESDSALILLYKGFGL"
FT   CDS_pept        complement(1025428..1025913)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000202371" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17446750"
FT                   /locus_tag="CAGL0K10516g"
FT                   /product="Similar to uniprot|P43594 Saccharomyces
FT                   cerevisiae YFR011c ochre suppressor tyr-tRNA "
FT                   /protein_id="CAG61639.1"
FT                   /db_xref="HOGENOM:HBG123835"
FT                   /db_xref="HOGENOM:HBG738556"
FT                   /db_xref="InterPro:IPR012471"
FT                   /db_xref="UniParc:UPI00003B6D49"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FM68"
FT                   /transl_table=1
FT                   /translation="MGAQASKSTDPVAPTLFTPQSKIEFSQALLSQLEDVSEMDYSRKE
FT                   YAEKCIEQKISSRLSELEVETLRKFKDTLNDSMQTDSDDGSNKNTACTGKLNEKLTDLS
FT                   QKLEAFKKLEEDKKQKFGLEEKEGPRAKLTECLIKNKGKPLNCVDEIAAFKEFMDSK"
FT   tRNA            join(1026436..1026475,1026487..1026523)
FT                   /gene_name="tRNA-Tyr (GTA)"
FT   CDS_pept        1027333..1029588
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000113086" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19351149"
FT                   /locus_tag="CAGL0K10582g"
FT                   /product="Similar to uniprot|P43596 Saccharomyces
FT                   cerevisiae YFR013w IOC3"
FT                   /protein_id="CAG61640.1"
FT                   /db_xref="HOGENOM:HBG059652"
FT                   /db_xref="HOGENOM:HBG203605"
FT                   /db_xref="UniParc:UPI00003B6D4A"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FM67"
FT                   /transl_table=1
FT                   /translation="MNSDETNGVGEASTTSPLSNDSNNQASSSMHNQNDPTTEYGFGLR
FT                   RSARERVPRKRDIYEIDPSVYLPKKKKPKSKATKKVVASKSKDAKAKNAKVKPQQSDKS
FT                   KVKKSSTPKPPVRTPEIPIPVVNNKDWTANIPLYNSELRNQNAKISRLKNENMKAVPYA
FT                   GDILKIMSFVNKFNYFFVNELQSLSFQDFEIGLDLYPDPLINTGKEIQRLYADYIPVKE
FT                   VVGCQDKMNLLLLTIMDLLFRPVETEREPQVEWSDLKSTSKKTFQSYIEKIRLYAPEWG
FT                   YPKEWRKNISTETLMKPASSTFEKDDIGPAVDQKHKEILTPNIYQWPANEPIDIDQDPL
FT                   QTKGLQRTGILALEAKDRIVFLRTLVDWCCSYSPLLHHEIYILTHYKRDPPFGIQTKHV
FT                   PRYLLQGLDETFSYYKKLCNLVQSRLEIRSKKKHVKKQMKEGKNDEIVHRLEILQKLKT
FT                   QMKGKTEDEKLKLMIENYEDWEKVFKGETPENPLSNPYEDKIYKLRSEEFFIGRVPHVG
FT                   DFYLPRMQTYEYMSSMNTYTDLKTLDNIFNTFESKKYNPFTLFENDSPFMSSNFKILFH
FT                   DKIALIQDVISGADMTEKNYWYEMCYDSETLLKFIDFIDQKIQQPSTAEPEKEEIRSEN
FT                   GDPSSLINGVSTKSDVSPTSGQNTKKKQEKSEESSKDASKINPLPKNPQFNSSRRKFAM
FT                   LQTYLRRIQPILAEFEEMKTKFGDINPTKRQSRRSQRREINYKIENSDDEYAMEDSE"
FT   CDS_pept        complement(1030055..1031395)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000233016" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17446751"
FT                   /locus_tag="CAGL0K10604g"
FT                   /product="Strain CBS138 chromosome K complete sequence "
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="CAG61641.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG537393"
FT                   /db_xref="HOGENOM:HBG755340"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="InterPro:IPR020636"
FT                   /db_xref="InterPro:IPR020651"
FT                   /db_xref="UniParc:UPI00003B6D4B"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FM66"
FT                   /transl_table=1
FT                   /translation="MEELCDIPNESLEALKIEACTTTTTRVCDLEVEENKFNVVVEDEE
FT                   KIICESEEVVQDMDHKKAGYLFQRTLGAGSFGVVKRAKQLHSDEDVAVKILLKRALEKN
FT                   GGLEPIYDELNIIQHLDHPNIVKFKDWFETESKFYIVTQLASGGELFDRIMHDGKYTEE
FT                   DAVNIVVQILKAVEYLHSQNIIHRDLKPENLLYLDKSKDSRIVLADFGIARQLENDDDV
FT                   IYRPAGSLGYVAPEVFTSDGHGKPSDIWSVGVITYTLLCGYSPFKAESVDGFLDEVTSD
FT                   ENPVKFQRPYWDGISELAKNFILRILDLDPACRPSATELLNDPWIQSKCSLRTDLYHNM
FT                   RKNLSAKKKLQKAVELIKLNQRIKKLRQLYLLANETDSDLEEEERSSSASLSSLPSSQS
FT                   SLSLSNEYGSKSKREQDEFISSLRQQTLAQIIKVATVNKDTVRKFEK"
FT   CDS_pept        complement(1032533..1034623)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000160890" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17446752"
FT                   /locus_tag="CAGL0K10626g"
FT                   /product="Similar to uniprot|P23337 Saccharomyces
FT                   cerevisiae YFR015c GSY1"
FT                   /function="glycogen (starch) synthase activity "
FT                   /biological_process="glycogen biosynthetic process "
FT                   /protein_id="CAG61642.1"
FT                   /db_xref="GO:0004373"
FT                   /db_xref="GO:0005978"
FT                   /db_xref="HOGENOM:HBG083100"
FT                   /db_xref="HOGENOM:HBG330297"
FT                   /db_xref="InterPro:IPR008631"
FT                   /db_xref="UniParc:UPI00003B6D4C"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FM65"
FT                   /transl_table=1
FT                   /translation="MPRDLQNHLLFEVATEVANKVGGIYSVLKSKAPVTVAQYQDNYTL
FT                   IGPLNKGTYQGEVEELDWEDPSIFSEELQPVQQALKYMREKGVYFVYARWLIEGAPRVI
FT                   LFDLDSVRYKLNEWKADLWSLVGIPSPENDWETNDAILLGYTVVWFLGELTQLDHKHAI
FT                   IGHFHEWLAGVALPLCRKKRIDVVTIFTTHATLLGRYLCAAGDVDFYNHLQYFDVDQEA
FT                   GKRGIYHRYCIERAAAHTADVFTTVSQITALEAEHLLKRKPDGILPNGLNVVKFQAVHE
FT                   FQNLHALKKEKINDFVRAHFHGNFDFDLDNTLYFFIAGRYEYKNKGADMFVEALARLNY
FT                   RLKMAGSKKTVVAFIIMPAQNNSFTVEALRSQAVVKSLENTVNEVTSLIGKRIFEHAMK
FT                   FPHNGITNEIPNNLEELLKPSDKVLLKKRVLALRRPYGELPPIVTHNMADDANDPILNQ
FT                   IRHVQLFNNHSDRVKVIFHPEFLNANNPILGLDYDEFVRGCHLGVFPSYYEPWGYTPAE
FT                   CTVMGVPSITTNLSGFGAYMEDLIETNQAKDYGIYIVDRRYKAPDESVEQLVDYMEEFV
FT                   NKTRRQRINQRNRTERLSDLLDWKRMGLEYVKARQLGLRRAYPDQFKEIVGEDVNDSSM
FT                   EALAGGKKLKIARPLSVPGSPRDAAKSPSTVFMTPGDLGTIQDANNVDDYFHLSVNDNE
FT                   EE"
FT   CDS_pept        complement(1036025..1039063)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21046840"
FT                   /locus_tag="CAGL0K10648g"
FT                   /product="Similar to uniprot|P43597 Saccharomyces
FT                   cerevisiae YFR016c"
FT                   /function="electron carrier activity"
FT                   /function="protein disulfide oxidoreductase activity "
FT                   /biological_process="cell redox homeostasis"
FT                   /protein_id="CAG61643.1"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0015035"
FT                   /db_xref="GO:0045454"
FT                   /db_xref="HOGENOM:HBG123836"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="UniParc:UPI00003B6D4D"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FM64"
FT                   /transl_table=1
FT                   /translation="MSDVETSKMDTSNNGGKEMDLDQMINATEQLLSEAPKTTTKKKKN
FT                   KKKKKKKVTTTDSKPVVDTVADPEQQIPTEDKPGKDIDESVSETGDTIPEKIDAQKVSD
FT                   LDSSSGNLAIERKPKKKGSKQSRPVSLSKLERDSIKRKSSDLDSILVGIEEYLQTDEDI
FT                   NVNVVDGSAVPNGRDSSSDTSKASKNLKKKPVVKGMKRSNTAKQSLSSKIVESSAESAS
FT                   DANKVVGTHVEETNAYEPIDKEAKPLTEKTADEKNESISNELATEKEQSPSTAVLSDDL
FT                   KKNQDNVQGEKQSIEKGSKADADILIKPETNSKLVKDAVIANESDADKKSISDTTIKEI
FT                   GESNAEIKEKQTTQSRSEKEIISLTAEENNNKVTISDTIPDLNDDTMKAASPNIDEIKS
FT                   VQQESYDSKSKETKSEPEEQEEDMNKGQLEPENKVSSSPSSSKKQALKEPALESETEQE
FT                   HEGNLLPTGNKTDVLEENLETVSAVKPSLADVNKDLPLKEGVNHGKTVDVQELHTTSKP
FT                   IEELSQAESPKKTSLDAMKKEDKLKDSRKTESTIEAHLDNRINEKSEAEEVGDDGPVDK
FT                   KSEDLKDTPEKSLSTEAVTQSPKVHNVNEVSKVNEEEDKAAESLTVDKAGAENSHKPSN
FT                   LKVLEAKDTLSDTMNETKQDETMDKEPKSTAKLIKLNDEVDEEASTLADDVSDLTEEKL
FT                   KVKDNVMHTTAEIPNNDAQTDSDLPKEKEDLNEFNEDKNNEDPVKKGDGDVLSKIMTEN
FT                   NETPEKRVVISILDDLPSRHDNGNEKETHDTVPKIDLESKLKEALDEIETSDVSVPTVD
FT                   PKKDVKETADEIEGLDLGDQEEKEPEEHKHSADVQSPSDNVTAKNSGGIQDILDETDKL
FT                   LEELNFVDDSEINALLDSFDKPASKKKAVVKETPQNTIKASDIIKANEELPVYIYTSLA
FT                   GGGFHMIPRTNRLSTILTANRIKFEYRDLGTDDEARKVWKTYGRGRTLPGVVRGRDDII
FT                   GNWEEIEEVNENYGLRD