(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12

ID   CAGLA1_12; SV 2; linear; genomic DNA; GRV; FUN; 1402899 BP.
XX
AC   CR380959_GR;
XX
DT   19-SEP-2006 (Rel. 106, Created)
DT   15-FEB-2011 (Rel. 128, Last updated, Version 20)
XX
DE   Candida glabrata (strain ATCC 2001 / NRRL Y-65 / CBS 138 / IFO 0622)
DE   chromosome M, complete sequence.
XX
KW   complete genome; genome reviews.
XX
OS   Candida glabrata (strain ATCC 2001 / NRRL Y-65 / CBS 138 / IFO 0622)
OC   Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina; Saccharomycetes;
OC   Saccharomycetales; Saccharomycetaceae; Nakaseomyces; mitosporic
OC   Nakaseomyces.
XX
RN   [1]
RX   PUBMED; 15229592.
RA   Dujon B., Sherman D., Fischer G., Durrens P., Casaregola S., Lafontaine
RA   I., de Montigny J., Marck C., Neuveglise C., Talla E., Goffard N.,
RA   Frangeul L., Aigle M., Anthouard V., Babour A., Barbe V., Barnay S.,
RA   Blanchin S., Beckerich J.-M., Beyne E., Bleykasten C., Boisrame A., Boyer
RA   J., Cattolico L., Confanioleri F., de Daruvar A., Despons L., Fabre E.,
RA   Fairhead C., Ferry-Dumazet H., Groppi A., Hantraye F., Hennequin C.,
RA   Jauniaux N., Joyet P., Kachouri R., Kerrest A., Koszul R., Lemaire M.,
RA   Lesur I., Ma L., Muller H., Nicaud J.-M., Nikolski M., Oztas S., Ozier-
RA   Kalogeropoulos O., Pellenz S., Potier S., Richard G.-F., Straub M.-L.,
RA   Suleau A., Swennen D., Tekaia F., Wesolowski-Louvel M., Westhof E., Wirth
RA   B., Zeniou-Meyer M., Zivanovic Y., Bolotin-Fukuhara M., Thierry A.,
RA   Bouchier C., Caudron B., Scarpelli C., Gaillardin C., Weissenbach J.,
RA   Wincker P., Souciet J.-L.
RT   "Genome evolution in yeasts.";
RL   Nature 430:35-44(2004).
XX
CC   This Genome Reviews entry was created from entry CR380959.2 in the
CC   EMBL/Genbank/DDBJ databases on 15 February 2011.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1402899
FT                   /organism="Candida glabrata"
FT                   /strain="ATCC 2001 = NRRL Y-65 = CBS 138 = IFO 0622"
FT                   /mol_type="genomic DNA"
FT                   /chromosome="Chromosome M"
FT                   /db_xref="taxon:284593"
FT   CDS_pept        complement(11636..14404)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17435637"
FT                   /locus_tag="CAGL0M00132g"
FT                   /product="Similarities with uniprot|P08640 Saccharomyces
FT                   cerevisiae YIR019c STA1"
FT                   /protein_id="CAG62326.1"
FT                   /db_xref="HOGENOM:HBG049284"
FT                   /db_xref="HOGENOM:HBG124057"
FT                   /db_xref="InterPro:IPR018871"
FT                   /db_xref="UniParc:UPI00003B6FE1"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FK94"
FT                   /transl_table=1
FT                   /translation="MYSKTTFTANILFCLLLLLRCCAAILEPDNSLQIFDSFLSNPSKY
FT                   PLGCSPKITNPKKGLSMELYSYPYRKKGSHPCWDPAYLDPNFPRVGYKKNKLIARVDGV
FT                   SGDINFNFHPKRQCTPIADYLPPNFNYNEPITTTNFTMLLYGYFKPKVTGLHTFDISAD
FT                   DLLFMNFGAGNAFDCCRRDSTADTFGNYVAWAIWGRRIVRNKLTVRLDKGIYYPLRLFF
FT                   NNRDYYGQMRLTFKTEHGSERITDFSDYFFSVDDTSEGCPGLITYESECADVKSSTVLE
FT                   TDYITIQAEKEVLPIIKTIYYVGIPCSSSQSIYGSSSSSSSSKRLDCPSGLFFDPLAEK
FT                   CVSISTPPLPPIPSSSSLPTSSQEYSSSSHRVPSSSHALIHSSSVVISTISSSIPSSMP
FT                   SSIPSSMPSSMPSSIPSSMPSSIPSSMPSSIPSSMPSSVIKPSTVSNHSSSIPSSIPSS
FT                   MPSSIPSSIPSSMPSSMPSSIPSSMPSSVIKPSTVSNHSSSMPSSIPSSMPSSMPSSVI
FT                   KPSTVSNHSSSMPSSIPSSIPSSMPSSVIKPSTVSNHSSSMPSSIPSSIPSSMPSSMPS
FT                   SIPSSMPSSVIKPSTVSNHSSSIPKSSTPTGDIPEPRILNITTTTTNHSSETPPFSSSD
FT                   SSSYIESSIISSSSSFELRSVSTPKLISSTMVPIFSKTKSSTRSHIYWNSSTIETSSSL
FT                   SPSPSPSPSPSPSPSPSPRPDPQPSPRPDPQPSPRPDPQPSPRPDPQPSPRPDPQPSPR
FT                   PDPQPSPRPDPQPSPRPDPQPSPRPDPQPSPRPDPQPSPRPDPQPSPRPDPQPSPRPDP
FT                   QPSPRPDPQPSPRPNPQPSPTPKLLSDFSSLHHSRSLNAIFRSATSRHDTYTTISAFFT
FT                   PRLSLQITTLVQQPTASDALNSLYLGGTYRLNVSYFLFPALLIFTIANILV"
FT   CDS_pept        22039..23691
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000261850" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17435638"
FT                   /locus_tag="CAGL0M00154g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /function="amino acid transmembrane transporter activity "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAG62327.1"
FT                   /db_xref="GO:0015171"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG492579"
FT                   /db_xref="HOGENOM:HBG522524"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniParc:UPI00003B6FE2"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FK93"
FT                   /transl_table=1
FT                   /translation="MSSSISDREAVKVDSGKQEIYEVSSSLDIDELRSDFDPEQNIRED
FT                   LTRALSPRHINMISIAGIIGTGLYLSTAKSLHNGGPASLFMNYTIIGGVVYLTMLCLGE
FT                   MSTFMPISGSFCSYARKFGSESFACALMWNYWFNDAVSVASDLTALQLVLDYWHTADHH
FT                   FPYWGASLIFWFFVLFLNVIHVRIYGEAEYWLAMLKVIAIVIFFIMSIIVNVGKNPQHE
FT                   YIGFKNWTHGEAPFVNGFKGFASLFVSACFAYGGTESITLTGGEASNPVRNTPKIVKTV
FT                   FWRILIFYVLSTFFIGMNIPYDYPGLSTKSVMTSPFTLVFQMAGTRGAGSFMNAVILTS
FT                   VISACNHALFAGSRIMYNMALDGYLPKKIVGRTNRYKAPYVAVLITWAVGGLCLGASFI
FT                   GAGTLWTWLQNIVGVSNQIAWLCIGITSIRFRKGLEVQGKTDLLQFKNWTYPFGPYFLV
FT                   IFTVFIILIQGWQAFDPWSVTDFFSVYLELFVFPFVYIIWWLWKRDWFVKYEDMDFVTD
FT                   RYIPTKEIVELNERLDNLKGWKKVRQIFSDYIA"
FT   CDS_pept        complement(24106..25221)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000276704" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19348448"
FT                   /locus_tag="CAGL0M00176g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /function="branched-chain-amino-acid transaminase activity "
FT                   /biological_process="branched chain family amino acid
FT                   metabolic process"
FT                   /protein_id="CAG62328.1"
FT                   /db_xref="GO:0004084"
FT                   /db_xref="GO:0009081"
FT                   /db_xref="HOGENOM:HBG424074"
FT                   /db_xref="HOGENOM:HBG617123"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR005786"
FT                   /db_xref="InterPro:IPR018300"
FT                   /db_xref="UniParc:UPI00003B6FE3"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FK92"
FT                   /transl_table=1
FT                   /translation="MDASRLKITKVSTPSERKPNDQLVFGKTFTDHMLTIEWTSENGWD
FT                   APEIKPYGKLCLDPSSIVFHYAFELFEGMKAYRTKDGKIAMFRPEKNMERMNKSAARIC
FT                   LPTFDGEELIKLIGKLIELDKHLIPEGEGYSLYIRPTLIGTSEGLGVKEPDRALLFVIC
FT                   SPVGPYYKTGFKAVRLDATDYATRAWPGGVGDKKLGANYAPCVLPQTQAAAKGFQQNLW
FT                   LFGPEHYVTEVGTMNAFFAFNCKETGKKELVTAPLDGTILEGVTRDSILTLARKYLDPN
FT                   EWEINERYFTIHEVQEKAHKGELLEAFGSGTAAIVSPIKEIGWKDTIINVPLIPGEQSG
FT                   PLTKQIASWMMDIQYGKVELDNWLRIVADIN"
FT   CDS_pept        complement(26473..27207)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000214596" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21044074"
FT                   /gene_name="MGM101"
FT                   /locus_tag="CAGL0M00198g"
FT                   /product="Mitochondrial genome maintenance protein MGM101 "
FT                   /function="DNA binding"
FT                   /biological_process="DNA repair"
FT                   /biological_process="mitochondrial genome maintenance "
FT                   /cellular_component="mitochondrial chromosome"
FT                   /protein_id="CAG62329.1"
FT                   /db_xref="GO:0000002"
FT                   /db_xref="GO:0000262"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0006281"
FT                   /db_xref="HOGENOM:HBG192030"
FT                   /db_xref="HOGENOM:HBG448424"
FT                   /db_xref="InterPro:IPR009446"
FT                   /db_xref="UniParc:UPI00003B6FE4"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FK91"
FT                   /transl_table=1
FT                   /translation="MQRLLKFSGHGSRALFLARRWNSNIASGTAGTFQTTAKPLRSVKP
FT                   TEAALALNGKFLESTNGNENGITSMGSIDWYTSWHGLGSKPFDATVQKALALPLEPTDI
FT                   EIKPDGLIYLPEIKYRRILNRAFGAGGWGLVPRSQTIVTSKLVTREYGLVCHGQLVSVS
FT                   RGEQDYFSETGIPTATEGCKSNALMRCCKDLGIGSELWDPVFIKRFKTEHCVEKFVTHI
FT                   ATSKKKKIWIRKDRSVEYPYKA"
FT   mat_peptide     complement(26476..27141)
FT                   /gene_name="MGM101"
FT                   /locus_tag="CAGL0M00198g"
FT                   /product="Mitochondrial genome maintenance protein MGM101 "
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FK91 "
FT   transit_peptide complement(27142..27207)
FT                   /gene_name="MGM101"
FT                   /locus_tag="CAGL0M00198g"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FK91 "
FT   CDS_pept        28137..30434
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000157526" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17435639"
FT                   /locus_tag="CAGL0M00220g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /function="mannosyltransferase activity"
FT                   /biological_process="protein O-linked glycosylation "
FT                   /cellular_component="membrane"
FT                   /protein_id="CAG62330.1"
FT                   /db_xref="GO:0000030"
FT                   /db_xref="GO:0006493"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG026546"
FT                   /db_xref="HOGENOM:HBG328830"
FT                   /db_xref="InterPro:IPR003342"
FT                   /db_xref="InterPro:IPR003608"
FT                   /db_xref="InterPro:IPR016093"
FT                   /db_xref="UniParc:UPI00003B6FE5"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FK90"
FT                   /transl_table=1
FT                   /translation="MAVTKRSPGTKKFGSSASKESSVDVDDVSLKYNKGVAATEQLAQN
FT                   WLLNPKPDSDNSYRLGFYLVTAIAFAVRFYKIYYPREVVFDEVHFGKFASYYLERTFFF
FT                   DVHPPLAKMMIAFIGWLCNYDGSFKFEEIGLSYDKHPAPFLAYRSFNALLGTLTVSIMF
FT                   ESMKELNFKAITCFLASMLVAIDNAHVTETRLILLDAILLISVAATVYSYIRFYKLQLK
FT                   EPFSWNWYIWLYLTGFSLSCVISTKYIGVMTYAAIGIPVVVNLWQLLDINAKLSIRMLI
FT                   KHIGRRLNGLILIPFIIYLFWFYVHFAILNVSGPGDVFMSSEFQDTLHDSEATKLSKEV
FT                   QFFDIVTFENQDTGAFLHSHLARYPLRYEDDRVSSQGQQVTCYTHEDVNNQWEILPVAD
FT                   KAKGDNIRFGDEFRLRHVGTDSYLLAHDVASPLYPTNEEITTVHKDDALGARANSTIFR
FT                   FQPINKKDEGHIIKSKNAVLRIIHKETVVALWSHNDELLPDWGFGQQEVNGNKKMTDSG
FT                   NAWTIDSIMNLDEKRSAYAPKEIKSMPFFNKWLELQKLMFEQNNKLTSEHPFASQPESW
FT                   PGSMSGVSFWTKNEERRQIYFIGNIIGFWFQVISFAVYVGIIIADQITRQRGYFALNKV
FT                   TREKLYGPLAYLFCGWACHYFPFFLMGRQKFLHHYLPAHLIAALFAAGLWETVFSRCKS
FT                   DDPYKDEEKPGVSFEKYPAIYTAAYITFNITVLAALVWCFVFFSPLIYATPLSAREVIK
FT                   RKWLDISLSFAK"
FT   CDS_pept        complement(30628..31665)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000264717" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17435640"
FT                   /locus_tag="CAGL0M00242g"
FT                   /product="Similar to uniprot|P47173 Saccharomyces
FT                   cerevisiae YJR142w"
FT                   /function="hydrolase activity"
FT                   /protein_id="CAG62331.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG098963"
FT                   /db_xref="HOGENOM:HBG738523"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniParc:UPI00003B6FE6"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FK89"
FT                   /transl_table=1
FT                   /translation="MVKVETDSATGRQILVRTTEDNREGFSFVEVIDRVDSLPSDFELN
FT                   EQFRKNVFYMTTHDGVKVGFVNRGILEEIQRVANEELLELFEIKEAENILQFKYNLDFD
FT                   SRNTRLDELGLKLRDKSKLQGVKGWRNEKYAVWVGKKPYVLVERALSGVLGIITYGVHV
FT                   NGYMFDEHTQEIKFWIPRRSKDKPTWPYLLDNVIAGGLGYPYGIEETLYKESIEEANLD
FT                   KESIQKNIRAGGVVSYFYFPKGNIRDNFYNESSAIVGEVEYIYDLRFDSNMKPSPNDGE
FT                   VDSFNLLDLQQTIDALVNNEFKPNCGLIMLEFLIRYGYINAENEPNYLKIINRMHRSFP
FT                   FPTLN"
FT   CDS_pept        complement(32100..33173)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19348449"
FT                   /locus_tag="CAGL0M00264g"
FT                   /product="Similar to uniprot|P47172 Saccharomyces
FT                   cerevisiae YJR141w"
FT                   /protein_id="CAG62332.1"
FT                   /db_xref="HOGENOM:HBG124183"
FT                   /db_xref="InterPro:IPR019193"
FT                   /db_xref="UniParc:UPI00003B6FE7"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FK88"
FT                   /transl_table=1
FT                   /translation="MKYLVEELENVGVTLIAVEALNNVSYSISTNRSTLELRVINDSYK
FT                   TSIRLKGLNLDNLYDEKNGHIHLSETSCGYVRLKRKTQALTNRISLVDLPDDKWNIERF
FT                   KKMQGFQIACNNCKLVVLDSEVNIKKISEMPSEFWAEFMDYWHCHKPTIGESKTDAKPY
FT                   DYYKELKPRLNEVLVGNTYFQTIGSTIDRKVVVQTDGSVDCSNCRSTLGYKEGSEILVL
FT                   EKQNLQLQDTFKELSEDYPGYLVVLARILSLLKFNSTRYFALKTGGQKPIFIWVLAYDC
FT                   SVAYTGNELVQRAYKLLYKDSWDRPPSSMEDIQLSDDLLDSFLQQLTKIHELIPENLKM
FT                   FNGWKVSYMSIEDTNPI"
FT   CDS_pept        33549..38396
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000112902" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17435641"
FT                   /gene_name="HIR3"
FT                   /locus_tag="CAGL0M00286g"
FT                   /product="Histone transcription regulator 3 homolog "
FT                   /biological_process="chromosome segregation"
FT                   /biological_process="regulation of transcription "
FT                   /biological_process="transcription"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG62333.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006350"
FT                   /db_xref="GO:0007059"
FT                   /db_xref="GO:0045449"
FT                   /db_xref="HOGENOM:HBG058121"
FT                   /db_xref="HOGENOM:HBG202270"
FT                   /db_xref="UniParc:UPI00003B6FE8"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FK87"
FT                   /transl_table=1
FT                   /translation="MSSFSFLNQSPDIEQLEAEEHTRETQIELCFQLFQDALERLKDDK
FT                   FGDANDLFEKLMSQEVIKPDKWGLYAYSSSIVDNLRYLAYRNRGFFYYKFLMNQYSESM
FT                   SSEDVVDNILKIVENLLESLRHSEADYNVIEVLVQIFESFKSKRLQKLLLENEFMNNDS
FT                   HLLFSGRKRTNILPQLKVLISQYINLLKDLHASSVLEKKIICNGQAKNTSHLPRTNVKF
FT                   KNILEQLNKLRTEDDELIKSLDIHDIELDNYDWTSLLRSLRETLPTVKSLALFGRNSDP
FT                   YAETETPIEAVKVIVKEEVVIDKIHDNSNNENEVTEEKEITDNKVVTTNGNNRKRSITE
FT                   IETKHAQRSSKRFRDRDSSAADSETPMTFEPMFYSYTKILSLLGCKAPYDYEAIYPDLM
FT                   EVKANDIIYADFLACLKEWSHWHTDCLSSQNEKEIKTKKVESSTDVSLSHFKTLLNSKN
FT                   FQKSDDHIPEISQTSLRRFLDKVNRQQCHFHELRFKLIWFLFDNQNGDRLLTSTRWTKQ
FT                   MYRDVEWITLSIEKNIFSFIQSDIAKYRHVALSIFETLINSLVELCEEINSKLSLGQKA
FT                   NDQKTQKVKIEKKITKWNSIIAQVETTDRDWTVRYLWAYYTLIQCTSDIQNCLLSNILE
FT                   KVHQILMKDNSSTVYLYPNADFISSFDLSFVDTQLKKLKMIKKLVNVDKHSESDKSEDN
FT                   NSQFIMLENVLLSTISENHAVGGDDDDMIDFFMSAPFMLKFKLWELIYMKYVKKNDIEK
FT                   TTLIYGIMLKLLVDTLECKTYRTLGPKKRQERLLIMMSCLKDITHNCIEVLKNNAWLQK
FT                   KLSWYDDTTSQLVFIFFILFPMLPVNTPNKLSGTQTFFQKATKSSKTIKSIFVDILTLL
FT                   LFHLNIGLKSKISSEPELENSIIDLVSTTHISISFYNFCDYASGNFLQIAENLICQFTN
FT                   EEAFTQLKQIMWCKYHYQLSGDSSIVSQHKTKAMEMSKMVSLPLGIYLVKLQYQDKHPY
FT                   INSAKIASKQILDNIVETFGDLSSQDNYIIMRNLHAFNGYLRSNITSKLFQSCFEGKDK
FT                   VDLKNPNDEFQKAMDAGVFYVSGIQALNLYKIRKRSVQARPSELDAIITMFKNDILYNT
FT                   KRFESWYLLGKCYSYIVEDDLLWTADKISSSEKKAVIATTQKRAILCYAMSLTLFFENE
FT                   TTRTVDEQIVIVECLESLANELMIAVYKPMEALCFDTNLSSLVVSSSNPATSSEIEKSS
FT                   VAPIYSITDSSIEDTMIKCLTLANRYQESLLEAGKLDRLNWFNFYSIAIVYSTEKLDRK
FT                   GDMIDNMSKACELANKYTSVKDSVVEPHVALIHMLYKLYIEGKVTMEDTLSTLKRDKFF
FT                   EGFDDDFWILDVSLTQDYQKREFFSKLIELLKYVISKDKKKWQHEPYFYIAEILFMEMK
FT                   DVEKSREWMDNIISIRSVNKNLVNIWKPDYERPGKHFVFTHNYVMFYLELLKYDKDAQS
FT                   IGLLTKKLRRFSSGMAYIGKANDVATSYFIECVTKKYLLHDKVYTESYMGNINYNDFVK
FT                   YSQEIVDNSKAADIAEDILEVLKIAYQLKKGTNSVVYDTVCLSLFFQYIYEPYRKEHPE
FT                   TEPQLVSDSENKSNIRKKVSKKDAFDKIRALVDKLP"
FT   CDS_pept        complement(38758..39072)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19348450"
FT                   /locus_tag="CAGL0M00308g"
FT                   /product="Similarity"
FT                   /protein_id="CAG62334.1"
FT                   /db_xref="HOGENOM:HBG124026"
FT                   /db_xref="UniParc:UPI00003B6FE9"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FK86"
FT                   /transl_table=1
FT                   /translation="MSTKPIVNEFERTEVRDEITLERDERPGEKSFVIGLTPRSLFSHC
FT                   VKFHALLATFSSMCDIPITFSAANLEIQLSSSPQQTVNYKPNALKSKNQLPKTHLWLEP
FT                   "
FT   CDS_pept        39196..40284
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000024037" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20195207"
FT                   /locus_tag="CAGL0M00330g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /function="NADP or NADPH binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="cellular amino acid metabolic process "
FT                   /protein_id="CAG62335.1"
FT                   /db_xref="GO:0006520"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0050661"
FT                   /db_xref="HOGENOM:HBG252503"
FT                   /db_xref="HOGENOM:HBG477935"
FT                   /db_xref="InterPro:IPR001342"
FT                   /db_xref="InterPro:IPR005106"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR019811"
FT                   /db_xref="InterPro:IPR022697"
FT                   /db_xref="UniParc:UPI00003B6FEA"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FK85"
FT                   /transl_table=1
FT                   /translation="MSNKSVNVAIIGTGVVGSSFLDQIVAMKSNITYNIIYVAELSKAL
FT                   ISEDYSPLALGSDWAKAVNGANQGPLALEKLVDFLKKSPIPVILVDNTSSAAIASFYPT
FT                   FVENGISIATPNKKAFSSDLATWDSLFSGKPTNGLVYHEATVGAGLPILGFLREIIQTG
FT                   DEIEKIEGIFSGTLSYIFNEFSTTTTNDVKFSDVVKVAKQLGYTEPDPRDDLNGLDVAR
FT                   KVTIVARISGVKVESPTSFPVQSLIPKPLESVESVDEFLQKLPEYDDELTQLKKEAAEE
FT                   NKVLRFIGKVDVATGKPSVGIEKYDHSHPFASLKGSDNVISIKTKRYTNPVVIQGAGAG
FT                   AAVTAAGILGDVIKAAQRLVGA"
FT   CDS_pept        complement(40767..46181)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000093241" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17435642"
FT                   /gene_name="IML1"
FT                   /locus_tag="CAGL0M00352g"
FT                   /product="Vacuolar membrane-associated protein IML1 "
FT                   /cellular_component="vacuolar membrane"
FT                   /protein_id="CAG62336.1"
FT                   /db_xref="GO:0005774"
FT                   /db_xref="HOGENOM:HBG058122"
FT                   /db_xref="HOGENOM:HBG395415"
FT                   /db_xref="InterPro:IPR000591"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR022046"
FT                   /db_xref="UniParc:UPI00003B6FEB"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FK84"
FT                   /transl_table=1
FT                   /translation="MFSALRSKNQSNKRSNDDSINSRKDVNELSLGAGGTSTSTNTNHN
FT                   DSPSIKNKNKNKNKNKTENENIYKLTISSGRSRGTASNTTNANTLVLNAGVAIVGKAPI
FT                   ASSQNEIQTISGQSLQSGIDTNLMTAGFGRSAGIDSTTTVSHDANSVKSRLQRLPTITT
FT                   SYKEINNGNKPVQVEPQDDSHYTSSLLVDTDPRSNNQPQSISSNAVANVEINRTLQLDL
FT                   VYHESRVSEKLVMLDLKKLPHIKEGQLCELRTYRKRKSTSARSNKNSRDKKLYFIAHDF
FT                   DEETRKRCHKFGNISVALGQLQLLLDLPPRSRVWIKPKRKEDTAADLIELHIKDILVNR
FT                   GDMWCMSSELVDTCVFTGQRIMFLDSIRTTVNGIYKNGKKVLSGYINDNTKIVFRSESS
FT                   RLLFIIQITNEMWSFDESGEQMFQKMINSFFPKIFNKWKDIETHHSITIAFAISMDMST
FT                   SSYKDLKPGQRIKNTTDYYRIVVDQVSVIYWVEIMESLRKEFMEITRELLSRKSDDKKD
FT                   NELSVIKGRFAPVIKSNILELINFAATTIVDPFRQLDLRHTSTHVMIISPGKGLYDVDY
FT                   DLLQLSCKKLLSLELTMDLICLSNPPLHVVPLFRYIDYENKLHHCIPPWLNIFFWNDKT
FT                   KDTNKWTPRCQIYDLQMMGLTDTELVQELELDYLNPSDDINDLQTFLKDYDRDIFLPIS
FT                   TANFKAENISSDPDEEDLKELKKINDKTTTIHKSSTSRNTLTKSQRTNSEENNSIRSRK
FT                   GDTIIKDPQFVGKISNSSRNNPPYDLSDKSTFEKQFKPKTTFHPSAMIKKTPENMKKLT
FT                   NPVFQQQYFDIQTDNGLTGNSKNLLIKNTKYLTPIIDEPQTPLVTGNLYRTRFESQSND
FT                   NELNENSKLPERGGGTDERRNVSAADTLKDVTKKSSIKDFTQRIFTKFLATTKQSNFNS
FT                   DGINSSAITEDAVLISDDTDGKTNNNNDFAVYPSSVADGDVSGDNQHRLNNKDSFTSIL
FT                   KPIPRPQLGVKIFKSDINNLSSNENVNSETKQNLLGTRNTINRKQFTASPHFTSSTKNS
FT                   VSNHSRFIKFDSMDDWIEILEDSIPSYSFLGDDLLPTRWRDVWPKNVFRKYSKWKSFTS
FT                   PAELPITLKRFPSKYELENNFMLRNHSVTQNWEQEQYKLTTKDLLRNMIYLRLLVGFQI
FT                   CTSSTIEEVESARKGDRDVFAIHKYLRGDLTGTFKIYMLMGSEIHRLHYDNSGTINVER
FT                   YIEKSERNVFDQVPSYTSFVKTRYDSNYRKTDVDPIHTKRSEFNWNLLDQLLAGYSDPY
FT                   LYDEWHGFRSKYVILPAEIPSNTFSMVVNGKNETLTTEEIRVEGLRKLIASITRLKLLS
FT                   VEESKIQKDRKTEIQPEVIFYTGSLFDFLNEQQAQLDSSTLNFKDSIFGDVTKKLNKNI
FT                   DLKNLAQELQMGENKLNLVTRKWHWKRHANCFVGSEMVNWLIRNFSDIDTRSTAISYGQ
FT                   KLMNDGLFIHVLDKHSFLDGNYFYQISPEFIINMNTVERTNSKNSNTSDNNTLKKTTSR
FT                   NSTESNLTPLSMRNKVSTMDDDSTQLANTTSANSYKEKKTVVLSNSMLINVDPSSKSYK
FT                   EELCTVHFDRVHNPEHCFHIRLEWLTTTPKLIDNMLGNWARICEKYGLKLIEIPWNELC
FT                   TIPSVDPFHTFVQLHLVINPWEDPEFNDPELFAVSKFYYHIHLLKMSGFLLDNRASRFF
FT                   QRDDADFEIMYSWGKPQFKYAQYIHTTGAYIAEMRENGNIFLAPNNVYMSRVNRANVIS
FT                   KTRSSPTFTVDSRKVVIEFSRTCYSYAKLRAVFLDAKEKWLSNKTVED"
FT   CDS_pept        49330..53538
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000167149" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20195208"
FT                   /locus_tag="CAGL0M00374g"
FT                   /product="Similar to uniprot|P47169 Saccharomyces
FT                   cerevisiae YJR137c ECM17"
FT                   /function="FMN binding"
FT                   /function="heme binding"
FT                   /function="iron-sulfur cluster binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAG62337.1"
FT                   /db_xref="GO:0010181"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0020037"
FT                   /db_xref="GO:0051536"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG460127"
FT                   /db_xref="HOGENOM:HBG626671"
FT                   /db_xref="InterPro:IPR001094"
FT                   /db_xref="InterPro:IPR005117"
FT                   /db_xref="InterPro:IPR006066"
FT                   /db_xref="InterPro:IPR006067"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="UniParc:UPI00003B6FEC"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FK83"
FT                   /transl_table=1
FT                   /translation="MTAGTAGLDTGRPLYYVGAQKDNTPRDESLVSYVFKGETDYIKLL
FT                   ASTDPLSRVIDNNKGGVVLLDQVTLLESLPHLYSIGKKDSTSNITEGSVITIIVDLNLE
FT                   DYSIIPAVSDLHLPIHIGLESINLEQNGIHFINFNRINGTQTANNIFTSGAASPKNLII
FT                   NLSQYYNELVKSVPEDVAIFNITEYKKNLLPEILANVPSSITRINLLQGSSTASENQEY
FT                   EDGFEPFLLDFFADFEVLVQNNIQQLLLTKIGNKVDDFNSVSAKIISNLESAKPVKNLF
FT                   VGEVVDISKDVTEDYSNSIKNILKLEDAYIKVLKQLLGNNLSIINEYSNSTINTLSPEF
FT                   GYGRYLQEKEIQNKLVELARKSLDPQLFHSQESDEFVKKLSKWVSFKSSSLDQNLLEEA
FT                   NKIGSDIFEYLKTDAHSQTAIKLLEVAENDEKYFQFKSSWLIGSDAWSYDLGNSGVHQV
FT                   LTSSDNINMLIIDSEPYEQRKASTQRKKDVGLYAMNFHNVYVASVAVYSSYTQLLTAFI
FT                   EANKFNGPSIVLAYLPYKSEKDTPLDVLKETKSGVESGYWPLYRYDPSKEEADEQSAFQ
FT                   LDSSVIRKQLEAFLERENKLTLLTKRNPALARTLAQSASDVVTQKQNKRAEAALESLLN
FT                   GLSGPPLHIYFASDGGNASNLAKRLHGRASARGLKSTVLSMDDLILDELPGEENVVFIT
FT                   STGGQGEFPQDGKSFWDALKGSTDLDLSNLNVSVFGLGDSQYWPRKEDKKYYNKPAQDL
FT                   YRRLEFLGAKILAPLGLGDDQGDDGYQTGYSEWEPKLWEALGVANVEVEDEPKPITNED
FT                   IKLNSDFLRGTIASDLKDESTGTVQYSNEQLMKFHGIYTQDDRDIREVRKSEGLEPYYY
FT                   FMARARLPGGKCTPHQWLGLDKLSEDSGNGTLKLTTRATFQIHGVLKKNLKHTLRGMNA
FT                   VLIDTLAAAGDVNRNVMVTALPAQAKIHKQISTMAAEISEHFLPKTTAYHEIWLDGPEE
FT                   QDYEDDWNERFNNRKEGPRKKKTLVSGNALVDIEPIYGPTYMPRKFKFNLTVPPYNDVD
FT                   VFSSDIGLIAIVDKEKNSIEGYNIYVGGGMGTTHGNKKTYPRVASSFGYVKNEDVLPAL
FT                   EALLIIQRDYGNREDRKQARVKYTVDRLGVQGYKEKAEEIWGKKFEPERSYEITSNIDY
FT                   FGWVKDENGLNHFTAYIENGRVIDTPDLPQKTGLRVLAQYMEKNNTGHFRLTGNQHLVV
FT                   SDITDEHLDAVKEILAKYTLDNADFSGLRLSSSACVGLPTCGLAFAESERYLPDVITQL
FT                   EDTLEEYGLRHDSIIMRMTGCPNGCSRPWLAELALVGKAPHTYNLYLGGGYYGQRVNKL
FT                   YRANLNDEEIVDVIKPLFKRYAAERNEGEYFGDFVIRAGIVKPTLEGRLFHEDISEDAF
FT                   "
FT   CDS_pept        53938..55200
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20195209"
FT                   /locus_tag="CAGL0M00396g"
FT                   /product="Similar to uniprot|P47168 Saccharomyces
FT                   cerevisiae YJR136c"
FT                   /protein_id="CAG62338.1"
FT                   /db_xref="HOGENOM:HBG124037"
FT                   /db_xref="InterPro:IPR018870"
FT                   /db_xref="UniParc:UPI00003B6FED"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FK82"
FT                   /transl_table=1
FT                   /translation="MKCGNLIIVADGVIDDKDIINLACDEVLDTDDDLIHNDALDWRNI
FT                   ILNLSFRCYSVNDEDYLLAEKSNLVISRYFSRASRDKILEITSFLITKIQPLLINKKNA
FT                   VIDKQSKGLNPKLGFSFGDDEVYEIWKKNGGIRSIPLCLTILSHLPIDKISTNLWWISP
FT                   FILNLLDATSDLQNLRLPGVKLLHVMLEKVFIDQYSNKWLKFKDTGLFQEYERILINFC
FT                   FYLPPSYDSQNTLLIWRQVFPAIYSLYKAQYIEDEYQLRLHILKFISEVILQNCLPRCG
FT                   CKYDQLTSFLIHFMIEMIRTLGEKSTIYIQRVIYDIGQYLIKDPFFTAFDKLIFETIEL
FT                   VEAIIGYCNTTRVLEHKYDILGIILLIYGKLKNEESMSDKIRKQLQHTIKMLKDRGCNF
FT                   SYEIKHLKSVKGIDYTELFAV"
FT   CDS_pept        complement(55412..55675)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000115758" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21044075"
FT                   /gene_name="TIM8"
FT                   /locus_tag="CAGL0M00418g"
FT                   /product="Mitochondrial import inner membrane translocase
FT                   subunit TIM8"
FT                   /function="metal ion binding"
FT                   /biological_process="protein import into mitochondrial
FT                   inner membrane"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="mitochondrial inner membrane "
FT                   /cellular_component="mitochondrial intermembrane space
FT                   protein transporter complex"
FT                   /protein_id="CAG62339.1"
FT                   /db_xref="GO:0005743"
FT                   /db_xref="GO:0042719"
FT                   /db_xref="GO:0045039"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG163129"
FT                   /db_xref="HOGENOM:HBG603145"
FT                   /db_xref="InterPro:IPR004217"
FT                   /db_xref="UniParc:UPI00003B6FEE"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FK81"
FT                   /transl_table=1
FT                   /translation="MSNLNPGELGDLTDASKKEIAAYLDAENSKQKVRTSINQFTDICF
FT                   KKCISRVDNGNLSSQEEECLASCVNRFLDTNIRVVRGLQNSQ"
FT   CDS_pept        56009..56707
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17435643"
FT                   /locus_tag="CAGL0M00440g"
FT                   /product="Similar to uniprot|P47167 Saccharomyces
FT                   cerevisiae YJR135c MCM22"
FT                   /protein_id="CAG62340.1"
FT                   /db_xref="HOGENOM:HBG124044"
FT                   /db_xref="UniParc:UPI00003B6FEF"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FK80"
FT                   /transl_table=1
FT                   /translation="MTNKSEIIDEYTAVLEREIENKRYFLKESHDALRDLIESKAERLN
FT                   GAGSVQGRRSAINKDVWQKFMEKPMYLPERQDPIGLNLVSARLREKTESMGPWLEVEKE
FT                   IVHVEETYLNSLRQLNAAMQDTIAEFRKNPPKPREELVSKDYSLSSLKTQHESLHKELK
FT                   EFVTRYLEPNAPENTSAEEMLQLISTLVQGKTLDKDQFKNSQSLFRLLMKGMLLENTDT
FT                   NSYKLIDLVS"
FT   CDS_pept        57126..58961
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21044076"
FT                   /locus_tag="CAGL0M00462g"
FT                   /product="Similar to uniprot|P47166 Saccharomyces
FT                   cerevisiae YJR134c SGM1"
FT                   /protein_id="CAG62341.1"
FT                   /db_xref="HOGENOM:HBG058125"
FT                   /db_xref="InterPro:IPR022091"
FT                   /db_xref="InterPro:IPR022092"
FT                   /db_xref="UniParc:UPI00003B6FF0"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FK79"
FT                   /transl_table=1
FT                   /translation="MNESKRLTLEERLNLAAQKRRKPKKIVPGGNAEDSGLHTNPSSKE
FT                   SLVEDHEIELNTWIPEDISSISRDDLIKALEPHFIEYKTKQKNASTTTTGDSSVFKLIK
FT                   GKDEEIAQLTKKLEDRRKQDTANEKLLSKLTADNEKLNKNNDNLSKKLNESNQEISNLQ
FT                   QKYSLSEKMLEESTKNSHDVQVLESSNKQLRQSIIDKEKTIQDLYAKIEKLEDEILKGK
FT                   DTFKIEKENINKANRENITALESQIEQLRIELENCNVITNENEDSQSKYQLIKEQFESS
FT                   KANWSSIESVLNSKISTLEDTIEKEKDHRANLLTQLETKTQRLLTLEKQQDQESSENIT
FT                   LKKTCITLESKVATLERDLQNLKDDYNLLESKYNTQRSQYRKSSESRLNNSSRSINEEV
FT                   SESWNDFGSGLNSLKITESNGALDTLMGQSSNIGDLTASDFTNNHELDPIDRDISFEKN
FT                   LDAIEETSFPEDADELDQRNSRGVSMRRHSTRNSTQMQSNAQLVTKLGHEIGRLETEIQ
FT                   SHREKIERLQKEKQLANDEILKLIDKNNGLSSIKLEKEELEKQVRDLQEKLDTSLQILG
FT                   EKTERVEELQNDVLDLKDMLHEQVKQMVDLQERLR"
FT   CDS_pept        complement(59097..59723)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000170387" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17435644"
FT                   /locus_tag="CAGL0M00484g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /biological_process="nucleoside metabolic process "
FT                   /protein_id="CAG62342.1"
FT                   /db_xref="GO:0009116"
FT                   /db_xref="HOGENOM:HBG327482"
FT                   /db_xref="HOGENOM:HBG507301"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="UniParc:UPI00003B6FF1"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FK78"
FT                   /transl_table=1
FT                   /translation="MSEEKIYISYNNIHKLCQKIAKQILEREERPDVIIAITGGGMIPA
FT                   RIIRSFLKVQGQKNIPIQAIGLSLYEDLGLGNTADVIGKEVIRTQWLDFGALDQHFDSL
FT                   IGKKVLIVDEVDDTRTTLHYAVTELQKEVEEQQKRLNRLNEDTIFSIFVLHNKDKKKRA
FT                   QLPAEMMDSGRYLAALTVPDKWLCYPWEAQDIEEHTILAKQQGND"
FT   CDS_pept        complement(60245..63385)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248078" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17435645"
FT                   /locus_tag="CAGL0M00506g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /function="binding"
FT                   /function="protein transporter activity"
FT                   /biological_process="intracellular protein transport "
FT                   /protein_id="CAG62343.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0006886"
FT                   /db_xref="GO:0008565"
FT                   /db_xref="HOGENOM:HBG059555"
FT                   /db_xref="HOGENOM:HBG397193"
FT                   /db_xref="InterPro:IPR001494"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI00003B6FF2"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FK77"
FT                   /transl_table=1
FT                   /translation="MDPNTLLQCFAGTLNQDAGIRHAAEEQLKEASKVQGFLGASLEII
FT                   ASSEVPDNIKLSASLYFKNKITYGWSSNNYSGKNELLMFEVDNDEKPVIMDMLIQTLIA
FT                   CAKQSSNCVRILKPALTVIISAEYPAKKWESLLPKSLELLSSDDINVTHIGLICLSELF
FT                   RTYRWKENDSRQDLEMLILQYFPELLKYGKDVLFNEGKNMENPKIGEMLKLILKTYKFV
FT                   IYHDLPFVLQRPESFIPWAEFLVQIVQQPLPESIKNMDPDLRRTNSWVKCKKWAYANLY
FT                   RLFQRYASTSLTKKFEYNDFKKIYQEDFLPHFLQLLFQQIEQWNNRQTWLSDEALYYIL
FT                   NFIEQCVIQKSTWDLVGGYYENILQHIIYPLLRPNEETLEIFETDPQEYIHRNMELWDE
FT                   NYTPDLAALSLLTSAVHKRGKSTRGITLEFVTGNLNRNVGDFNNITLENAVEVESSLRI
FT                   ISSIIDILTSKNSPYAGQLEPFLKNMVLPFFKSPYGFLRSRVCEICSKLGYIDLQDPEL
FT                   NAIIFEGVMTCFNEERDCVPVNLMAALALQAFIQNPFFQEHLSQSVVPTMQKLLMLSNE
FT                   FEMDTLSGVMQEFVEQFAEQLQPFGVELMKSLVQQFLKLAIDLHEVSNIDPNSFLKADD
FT                   VPDETDKQMAAIGVLSTTISILLSFENSVDIVKNLEQSFYPAAEFILNNDMEDFYHEIC
FT                   EFFENSTFLMRTISPIAWKVLELIGECNRREESTVSVYLEDFMLVLNNFLIYGKDELRK
FT                   NEFYCKILFEVYEKAANREDADLDELQIIFELSQKLTLSLEQKLPDPIRVKFLNDAISA
FT                   IISEKDSLKKSIVFGVTSFNVIISNMIVTPVIVLNALASQNCIELFFEVWVSHYIPNYI
FT                   RTYDIKLSVLALMSILCSVSEEEILKFNLGNLLFQVYPLVLKMMARYPAALKLLEEKRK
FT                   EFSSLDFNDNEAWDDHFDFNEGGDEDNNEANIEDVIEMLRGDHNDLKFVDGLADGEDFD
FT                   DLEEDPLAGSILDDINIYELVKSSTSGLEQSNPAKFSTIMNSLSDEDKSMHTQIMNI"
FT   CDS_pept        complement(63827..65470)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000181987" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18500621"
FT                   /locus_tag="CAGL0M00528g"
FT                   /product="Similar to uniprot|P32906 Saccharomyces
FT                   cerevisiae YJR131w MNS1 alpha1 2-mannosidase "
FT                   /function="calcium ion binding"
FT                   /function="mannosyl-oligosaccharide 1,2-alpha-mannosidase
FT                   activity"
FT                   /cellular_component="membrane"
FT                   /protein_id="CAG62344.1"
FT                   /db_xref="GO:0004571"
FT                   /db_xref="GO:0005509"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG517351"
FT                   /db_xref="HOGENOM:HBG559734"
FT                   /db_xref="InterPro:IPR001382"
FT                   /db_xref="UniParc:UPI00003B6FF3"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FK76"
FT                   /transl_table=1
FT                   /translation="MAYILSAVVLCVSLALWFYNLQTSGFDGDAAAMRNKVEEVFLESW
FT                   RDYSQYGWGYDVYSPTSHHRHNMLGEERPMGWIIVDSLDTLMVMYNSSANYKDEFREHI
FT                   NAATEWIDRELNFDYDNSVSLFETTIRLLGGLLSAYHLSTELDLPQRYSNIYLDKAQDL
FT                   GRRLAVALEVNKDGVPFQTVNLKHGITAMDGGGYTTTPTAEFTTLQMEFKYLAYLTDNS
FT                   TLWQLSEKLYAPLYLNNNLMNQFNGLVPILTNSQNGRFSTATIRLGSMGDSFYEYLLKQ
FT                   YQLTGEEIYRQLYLVSLDGIAKHLLGRTTPSNLLFIGEREQGLNGPFSTKMDHLVCFIG
FT                   GVLGMGATNGLHLEQARKASFWNSERESEWLLAKELTKTCYEMYHQVPTGLAPEIVVFN
FT                   DGKARPGHDWWKSKKGDFWIKPNDAHNRQRPEAVESIMFLYQLSGNEMYREWGYEIFQN
FT                   FIQNTCVDCDDPKSRKYVNLGDVTKPGSLGDNMETFWLSETLKYMYYLFNDNVDLTSMV
FT                   FTTEAHIFPRLSHATLLKKGFETNWHKSKK"
FT   CDS_pept        66078..67787
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000193384" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17436684"
FT                   /locus_tag="CAGL0M00550g"
FT                   /product="Similar to uniprot|P47164 Saccharomyces
FT                   cerevisiae YJR130c STR2"
FT                   /function="catalytic activity"
FT                   /function="pyridoxal phosphate binding"
FT                   /biological_process="cellular amino acid metabolic process "
FT                   /protein_id="CAG62345.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0006520"
FT                   /db_xref="GO:0030170"
FT                   /db_xref="HOGENOM:HBG262693"
FT                   /db_xref="HOGENOM:HBG634482"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniParc:UPI00003B6FF4"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FK75"
FT                   /transl_table=1
FT                   /translation="MISEILGESIPKNTEHAVSVCLPLWADVVGYEEGDARVLDSLTTG
FT                   YPRFFIHASVKRLCNLISEQYARAGESCLCFPSYLVAKRCREYITVKSKQLDKDADIGK
FT                   IRILQLAMPQDDTDHTGIFDCKIAALFFKSELFPLAKQYWQHSGEIVSSRLADYVTERL
FT                   YPNAIHIDEATKDNKTFIETRFGRNLDSSFINRAKDILRNRIAHKVVETDHNQDVATNV
FT                   FLFPSGMASIFTAHRLLLNYDHIRVSNIKHNGVDKSDDIIGYGEPYLKTVMFGFPYTDT
FT                   LSILKKFNHTYFLGLGDESAMKDLIGILESGEQILAVFLEAPSNPLLKMCDMSKLKQLS
FT                   QQYGFFIVVDETVSGFVNIDILSYCDIVCSSLTKIFSGDSNVIAGSLVVNPASKLHDFA
FT                   IDFLNDPKRNEDLLWCEDSVYLERNSRDFIDRAQKINKIAEDLVSTVLLEEEGQLLEKI
FT                   YYPSLTSPESKLNYDSVKCNNGGYGGLISIVFKREDQAKVFYDNLSLNKGPSLGTNFTL
FT                   VCPYAILAHYAELDEVAKYGVVKNLVRISVGLESLETLQTIFRKAFDAAKDV"
FT   CDS_pept        68018..69001
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17436685"
FT                   /locus_tag="CAGL0M00572g"
FT                   /product="Similar to uniprot|P47163 Saccharomyces
FT                   cerevisiae YJR129c"
FT                   /protein_id="CAG62346.1"
FT                   /db_xref="HOGENOM:HBG124060"
FT                   /db_xref="InterPro:IPR019410"
FT                   /db_xref="UniParc:UPI00003B6FF5"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FK74"
FT                   /transl_table=1
FT                   /translation="MDKSGELLLRRCPVERLVDELQEGKLLRLCDEENGFRKVLMEEVK
FT                   PVNNNYCKKVLREIVDRLDRTAGQLPEDVYESWEWAYEVYFDMLNDVQDELAMDEADND
FT                   VIMYKFSEQYKVNIAETPRTIANGSTGNRTWEAAVYLGLYLIDQCASNVVAAPSRILEL
FT                   GSGTGLVSLLYQQLYPFDKLTMTDGDWDVVRKRIPGNLSLNDLKPGLEVKQLVWGPRDA
FT                   NSGDNQWDYDLILGSDLTYDDRILEPLCQALQWLLKTDGSNEALLGATVRNEATTALFE
FT                   KYMREYKLQYEVITETTDEDFERLEEITFTRPIAPIRIYRINNAKI"
FT   CDS_pept        70659..73721
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20195504"
FT                   /locus_tag="CAGL0M00594g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /function="nucleic acid binding"
FT                   /function="zinc ion binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAG62347.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG124065"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="UniParc:UPI00003B6FF6"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FK73"
FT                   /transl_table=1
FT                   /translation="MMTNGQDQHCLIPKKSRAVKTDKPRPFLCPICSRGFVRQEHLKRH
FT                   QNSHTHEKPFLCLICGKCFARKDLVLRHLQKLHRDYKTEQLDKTIGRGKWDEKILNTPD
FT                   VWNNDIVKVKGNKASILPTVDYTMHRQDLVLKSNDGNDSQTGISSQNSITFNNMSVSVG
FT                   SSGVLEYESTSKRSTPGNHSSDSTPTDSSISRLRTEGSYTNTNNADGTLNPVPYHDLDL
FT                   SSSSSLSFATPSYQNTRTSNNPVPIGGGTPLDVNWLNSVLESDNKINELASKSLSPSAT
FT                   LGQKSDKHNNIADFKLSLPESKKNRRYSYPNNLNDTTAKQSNDKNYTGSPLNPNGRMHS
FT                   NGHNNPPSASNATITLNTSAGIENHTINDKDLFRPDLNHNPSLSSLFKTEDPTSSEQPV
FT                   IDIISQLSSEYTSPNDLSFVNLNQPNLGFFTQEWRDLILQKYSLLDNNFPTIKELNEYI
FT                   EQYQKEFHPYFAFLHLHSVQPSLSRISLFLSVAAIGAFYSYNSTHSNLLANLAYGEINQ
FT                   LIKSVKLDSSPLWLVQTMLVLGFYAIFNNDISLVQSASDQFVMIVKIVKSAKINQPLET
FT                   MVVPPTNLFPNPVTKTLTSDQIDAAYRYFITAQSRIHICHSMLFLSNIFPAMSGLEACF
FT                   LSSDVLCGVPCPYEDLYTSKSPGEWYNNVLKNSIEIANSSQLVNLSNGMVSFQTCLEYL
FT                   TTGNHVLYENIKLSLYTLLSLLVSIHEKILLERHKAKTEKDVQYNDTQWKLKQGPLIDS
FT                   VIRKWEILYMKNGGILLPTENNVAKITGSHVMRNNVSFYLFAKLKRCIDLNHVIQKIWM
FT                   RDWTTMNTALEEVIYDKESLQEATDYAISLLRSWASTFTILDDESMQAMKTPMFSMACI
FT                   FSSILIIAEYLRSVERWAKTFNAGDPNAKTMNPTDKILWLKAGRLLKMFQKKLMSSDAK
FT                   KYSEFAGVQKHEMLDITEVDESVLQRAIGLEAKVDETIQMILAASLASKALYIGVRVIG
FT                   DTPIWPISVLFAQGLQSRAVYCVMKDEGVFT"
FT   CDS_pept        74369..76687
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000211921" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17436686"
FT                   /locus_tag="CAGL0M00616g"
FT                   /product="Similar to uniprot|P47161 Saccharomyces
FT                   cerevisiae YJR126c"
FT                   /function="peptidase activity"
FT                   /biological_process="proteolysis"
FT                   /protein_id="CAG62348.1"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="GO:0008233"
FT                   /db_xref="HOGENOM:HBG192051"
FT                   /db_xref="HOGENOM:HBG713441"
FT                   /db_xref="InterPro:IPR007365"
FT                   /db_xref="InterPro:IPR007484"
FT                   /db_xref="UniParc:UPI00003B6FF7"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FK72"
FT                   /transl_table=1
FT                   /translation="MSAIDDSQSDLRPFPVDSNDGSSQPDGYGSIEQDERAFRRPRSDT
FT                   MSTIRSGIEIVRENMDRWKFLYLILASLFIYLSFIAAFAPRTSLARDLRRFHSARMTQS
FT                   EVYRIFLDTLLYENKAEQHHDAISKTNGTSYIKNYLIDLGFEIKNDSYYAWVNTPVKQQ
FT                   VRVIQDDEVIYQAKLKEDLTGVSHNAFHGYSKDGKLTARFVYCNYCTIEDYTKLVNDKI
FT                   DIEGKVHICKYGINAPGNKLKNAELYGSTGVLIFTDINEIPNMPVNYGTINSSETNSYD
FT                   DAIQRDTVRFGSDIFGDPTTPGYAALYPDTERMNPNDYMPSIPSLPISYRDASKLLDML
FT                   HAKGSFWVSNDGVNSAKLFSGPSDPNTEVQLVNRQEYGVQQIDNIIVEIPGILSENDIL
FT                   IGAHRDGFPIGNGTSSMSSHSGIAVLLEFARGISKLRKKGWKPLRTIKFVLWDGLHNSQ
FT                   LGSSSFGTRYATSLKRDSLLYVNLDNAIAGQYFNVKANPMLISAITEASKNIDYKKNED
FT                   WSLFQEWYNTSNAKVDSLEGVNDYSVFQFYLGIPVVNFSFNSRTSNQPQFPINTGYDNK
FT                   EWLIRYVDPEFLLHNTLSRFLGMFVLMVSETELSYYNPHPFFKHLNIQFDKVKRFAEKT
FT                   FSRNEKLLYKLDSLGKLIKDIADYDSKYYERRNKEVADGVSSELPIWAFVRKYRVFLSL
FT                   IRANKKLREIGKVFLTNNGIEGRPLMKSSLFAPNLENSTEIMMFPGLLEATKQKDVQKA
FT                   MKSLIVLEAQFLNVRYLLL"
FT   CDS_pept        complement(76881..78077)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000216214" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17436687"
FT                   /gene_name="FPR4"
FT                   /locus_tag="CAGL0M00638g"
FT                   /product="FK506-binding protein 4 "
FT                   /EC_number="5.2.1.8"
FT                   /function="peptidyl-prolyl cis-trans isomerase activity "
FT                   /biological_process="protein folding"
FT                   /cellular_component="nucleolus"
FT                   /protein_id="CAG62349.1"
FT                   /db_xref="GO:0003755"
FT                   /db_xref="GO:0005730"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="HOGENOM:HBG396046"
FT                   /db_xref="HOGENOM:HBG434444"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="UniParc:UPI00003B6FF8"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FK71"
FT                   /transl_table=1
FT                   /translation="MSDMLPLAMYALNVEPYTHTPAVLLDTPVTVRITMAAIDPEPFDE
FT                   DKKPSTLRIIRRNPVYLDAGEVDEEKLIEELEGDEAAEDGDEASDDDKEEEDEDEDVDE
FT                   DDEDDDEDDDGEDEYEECVVVTLSPETRCQQAIDITIAPEEDVQFLVTGSYTISLTGNY
FT                   VKHPFDEPLEDLYSDEDSEEYSDDELDQEIEEDDELDHDEASSEESDEDQEFYDAISEG
FT                   DEDIDEQLAKLEETSDVEAHLEDLIAKDNKKKRKQEQLDEQPETKKSKKTKDEKNTKAT
FT                   ENEKKNKAQVLEGGVIIEDRKIGEGPKAKKGSKVGMRYIGKLKNGKVFDKNTSGKPFYF
FT                   KLHRGEVIKGWDIGVTGMAIGGERRIVIPAPYAYGKQTLPGIPANSELTFDVKLVSLK"
FT   CDS_pept        78392..79429
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000199065" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17436688"
FT                   /locus_tag="CAGL0M00660g"
FT                   /product="Similar to uniprot|P32366 Saccharomyces
FT                   cerevisiae YLR447c VMA6"
FT                   /function="hydrogen ion transmembrane transporter activity "
FT                   /biological_process="ATP synthesis coupled proton transport"
FT                   /cellular_component="proton-transporting V-type ATPase, V0
FT                   domain"
FT                   /protein_id="CAG62350.1"
FT                   /db_xref="GO:0015078"
FT                   /db_xref="GO:0015986"
FT                   /db_xref="GO:0033179"
FT                   /db_xref="HOGENOM:HBG020908"
FT                   /db_xref="HOGENOM:HBG317755"
FT                   /db_xref="InterPro:IPR002843"
FT                   /db_xref="InterPro:IPR016727"
FT                   /db_xref="UniParc:UPI00003B6FF9"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FK70"
FT                   /transl_table=1
FT                   /translation="MEGLYFNVDNGFLEGLIRGYRNGLLTNNQYINLTQCDNLDDLKLQ
FT                   LSSTDYGNFLSQVSNDALTTSVMQEKASEKLYKEFGYIRDQSSGLTRKFIDYITYSYMI
FT                   DNVALMITGTIHERDKSEILSRCHPLGWFDTLPTLSVATDLESLYETVLVDTPLAPFFR
FT                   DCFDAADELDDLNIEIIRNKLYKAYLEDFYKFVSEEIDEPSREIMQTLLGFEADRRSIN
FT                   IALNSLQSPDLDPALKKQLLPEIGKLYPVATEQLANAKDFESIRAVLGQVPDYRNALES
FT                   GSLEDHFYKLEMDLCRDAFTQQFTISTIWAWMKSREQEVRNITWIAECIAQNQRERINN
FT                   YISVY"
FT   CDS_pept        complement(79782..81101)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000142328" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17436689"
FT                   /locus_tag="CAGL0M00682g"
FT                   /product="Similar to uniprot|Q06204 Saccharomyces
FT                   cerevisiae YLR446w"
FT                   /function="ATP binding"
FT                   /function="kinase activity"
FT                   /function="phosphotransferase activity, alcohol group as
FT                   acceptor"
FT                   /biological_process="glycolysis"
FT                   /protein_id="CAG62351.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006096"
FT                   /db_xref="GO:0016301"
FT                   /db_xref="GO:0016773"
FT                   /db_xref="HOGENOM:HBG059104"
FT                   /db_xref="HOGENOM:HBG202599"
FT                   /db_xref="InterPro:IPR001312"
FT                   /db_xref="InterPro:IPR022672"
FT                   /db_xref="UniParc:UPI00003B6FFA"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FK69"
FT                   /transl_table=1
FT                   /translation="MRPIGTMTIANPEKILEEVKSQLGVRQSLATITEKFQEELDFMLK
FT                   NCKKSMLPFPQVCCRGWSEYNEPMDMLAIDFGGSVLKFAVINMPQCQMELKYELEIKSK
FT                   VVDFKFFDNIVEWICNRIPINNERSLPRKFIVAITFSFPVNANNEIVAMGKGFRMSPEL
FT                   KGISILDILKQSFDRLEKEYSSSFTFEISNVINDSLAVHMTSKYLQSDNNDKISLILGT
FT                   GVNSCFEVQYEDLPQFKKDILTQFSDDYREKVLINSEMGFLGRYSKSIEFGNFDTNIDD
FT                   KMPLESITSGKWIPQILHNIIRYYNLLPMVGDEEIKYDGRLICEILSDGECPSEYLLSL
FT                   WDYEVYQIIRQITKLLINRAAIYLVAAIIAIRKFVSPEIYFTKGGIDIDYVGSFLNYCQ
FT                   YYQERIHLHSKGMVKLQFLNDSNLYGCAITAYSNIFENRI"
FT   CDS_pept        81930..82796
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21044340"
FT                   /locus_tag="CAGL0M00704g"
FT                   /product="Similarity"
FT                   /protein_id="CAG62352.1"
FT                   /db_xref="HOGENOM:HBG124079"
FT                   /db_xref="UniParc:UPI00003B6FFB"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FK68"
FT                   /transl_table=1
FT                   /translation="MQTEVIIRNKVAVYKLIGLCQKYRDDVQNLHKCMLRLNSLFYKMT
FT                   TEEIESQSKKNNDSSTTLIASATSDKCSNLNYNRCDEGLSACQVSPVENNLDEASPQDN
FT                   DLLLRPKTYSAVMLDTAAISDDVRPLMESIRKDTPKKFHFYKNYGFHLGTLQDESRIIA
FT                   QKLHYELKHISLKIIIPMKLFDKQCTHYLKHCPCGNKIVTPYEVKQVDKFIEYIPKFWH
FT                   YWFLSYYSIFYRIHFLLYLQSCQLLLQKSRNTVINKSELSSISLLNDYREKAESIVRQM
FT                   ESFNFTS"
FT   CDS_pept        join(complement(83279..83656),complement(82968..83162))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17436690"
FT                   /locus_tag="CAGL0M00726g"
FT                   /product="Similar to uniprot|Q06201 Saccharomyces
FT                   cerevisiae YLR445w"
FT                   /protein_id="CAG62353.2"
FT                   /db_xref="HOGENOM:HBG124081"
FT                   /db_xref="UniParc:UPI00017BD8CF"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FK67"
FT                   /transl_table=1
FT                   /translation="MGTKQSDTEVEGETIVKQDALTTKHPDVEFHPMLKQTIEMWCKSG
FT                   IRDTYDNKCFKRDVLSRISEITSIMSQIAEESNGGNSDKCRINDGVYRLDWESVYEVGA
FT                   SIMDQYSATVDELLADLDKLYRKQYLWQDSAVLLDSFKGATIIGRLEKWTKLKEAQLEY
FT                   KQNELVRSAGEIKRALKRLSTENVYGS"
FT   CDS_pept        complement(84109..85422)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000112320" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18500871"
FT                   /locus_tag="CAGL0M00748g"
FT                   /product="Similar to uniprot|Q06200 Saccharomyces
FT                   cerevisiae YLR443w ECM7"
FT                   /protein_id="CAG62354.1"
FT                   /db_xref="HOGENOM:HBG124083"
FT                   /db_xref="HOGENOM:HBG202597"
FT                   /db_xref="InterPro:IPR009571"
FT                   /db_xref="UniParc:UPI00003B6FFD"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FK66"
FT                   /transl_table=1
FT                   /translation="MLHVARLLMRPFTNLNSLEILVQWLRLISSGMVILLSGLVCLAPF
FT                   TFPKSMYMSKLDAFSADITQGLFDVLRLNMETASLTSINNGVGLTTSELVILTEYTAQQ
FT                   VRSSPQYIVVSLYGRCDCTFTTEQMMDSKGRLYQVQNSTTMCDCIDTGSDYIFDYREVL
FT                   SNLGLGIILDYAYSKDGSRMGLSTSYSKYINSLRSRKVTVTNLLYAIFVIELVKFCVTF
FT                   WYYYIKGRFLNIFLEQFLVHTLSIFSLTVFICGLTSVISLAWLNYTVQARIKSELQSFG
FT                   FSYHLGASWFTCLWMLAFFVSLSCFVWSGLEWCIAENYDPRTSDLKDGFLDRAEESQYE
FT                   NPFDDENVITGEDSNSASSRSGGKLSSSHTEDTGIHGSTSYNNMTRLDSSRIIKNFKNK
FT                   QFDDTEEQFELQSITLRSSTDSDSSIQRVIQPSSTMHF"
FT   CDS_pept        86290..89556
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19348719"
FT                   /locus_tag="CAGL0M00770g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /function="DNA binding"
FT                   /protein_id="CAG62355.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="HOGENOM:HBG124085"
FT                   /db_xref="InterPro:IPR001025"
FT                   /db_xref="UniParc:UPI00003B6FFE"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FK65"
FT                   /transl_table=1
FT                   /translation="MAELIKDLEGWQIIIKDQDGNVMDERDRKVRRKRNVSTDLFIFRE
FT                   KDALTFGRGQNVVVHDEVSDSYAVYLIHEIRQNTLNHALEILCFTYLRWFELEPRDYYK
FT                   EFKPEYLSMTNQQITEKFLEEIDRDEIYLTAEITPIWLKDFIDIAEVYNAKKWAQVRQS
FT                   VNKERNFLVRYVCEPVAENFVPVDIDNIMDQMRKRSARDFETMLKNLTVNGFVHSSSKK
FT                   RQKIKAEDTDNTVTKKNLLHNQKQKEPESHELKYQKVQLEDSPQPHHKKPQSRIDDHYS
FT                   VVSDMPHGRIVNTGVKPTTKKSSTSSQTQTDHTQKRKLQSDGGKSGPSNMKSTVGNGSS
FT                   NDNIQKKRKTEDSSKTPSNLHTTMTGVSRSTGVTSDAGKVVDKEIIKNPTSVPSQGGNR
FT                   TKGNDMSKKEPYSKAIAAANQLKAGRTNQKSNQTAKKPSTTSSNEREEKIPAYLSGRFQ
FT                   PSEVIDSVQSGTLNDLMTQVRKRGGVSEALKYKAKNHVDGTGQDLYATAKSFTSNLRRT
FT                   LLGSENSAQSQQQNASDIEKRKPYNVIDDFKNNSSAKILEHVKRGNTVSELLCHQPIDK
FT                   TPEKSNDEKLKPLLTALSDLTTNKQFVQLRNIVGLTAQSKNSGSIFEKLRKCTTSESLI
FT                   QCMSDSITSDIILSMRNKEFVTIYGSLFNAIINGRNKSLYLTGDDEYTIKYVFNKVAHE
FT                   LLLSATFEEIPQFKLASVPSSYDNFYQGLWQNISGDILSDTEAAIALDSYFSVMQPVQR
FT                   FPILIYIENMDEFFNNSETIYKDLINWFLNPLSKITLICNGTVVNNEIGNPLKDIFLHV
FT                   NFPSVSEEQDCSVANISKVINQINSSYFYFNADLQAATFCEFYKHYTKNWQKINFRINE
FT                   PEVGISVKNIQNALTLKGFDSIINVHKHIYQCLRNVVNRYIDSTAKKTTVDIQANQLSV
FT                   SAGSANTHYDLMEPLYGRIMSSLAELTFVDKLVLFCTVLCRLRKSSVEKIDLNEVYNVI
FT                   VDVLHHNCDNSPMISNLLLTYSTIKNRNDKGSAIKLFLSSLMWLDVFTRLYRTGFVTLH
FT                   VDQEDRNQIKVALAGFEVDSILAELKRDSSMSWIQSCLTE"
FT   CDS_pept        complement(90755..91057)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17436691"
FT                   /locus_tag="CAGL0M00792g"
FT                   /product="Similarity"
FT                   /protein_id="CAG62356.1"
FT                   /db_xref="HOGENOM:HBG124088"
FT                   /db_xref="UniParc:UPI00003B6FFF"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FK64"
FT                   /transl_table=1
FT                   /translation="MSSQAFALCRKRFFHCLSQLRCTIFQNLTACGSVGPRRSSGNPGS
FT                   LPSWDGHCSQWLPQDHRWGPLPSEPKTMPRFEPNLSLTSAWPQPKLSPGSKVRLQ"
FT   CDS_pept        91268..92035
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000105220" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17436692"
FT                   /gene_name="RPS1"
FT                   /locus_tag="CAGL0M00814g"
FT                   /product="40S ribosomal protein S1 "
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="CAG62357.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG211272"
FT                   /db_xref="HOGENOM:HBG402643"
FT                   /db_xref="InterPro:IPR001593"
FT                   /db_xref="InterPro:IPR018281"
FT                   /db_xref="UniParc:UPI00003B7000"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FK63"
FT                   /transl_table=1
FT                   /translation="MAVGKNKRLSKGKKGLKKKVVDPFTRKEWYDIKAPSTFENRNVGK
FT                   TLVNKSTGLKSASDALKGRVVEVCLADLQGSEDHSFRKVKLRVDDVQGKNLLTNFHGMD
FT                   FTADKLRSMVRKWQTLIEANVTVKTSDEYIIRVFAIAFTRKQSNQVKRTAYAQSSHIRA
FT                   IRKVISDILTREVSNSTLAQFTSKLIPEVINKEIENATKDIFPLQNVHIRKVKLLKQPK
FT                   FDLGSLMALHGEGSAEEKGKKVSGFKDEVLETV"
FT   mat_peptide     91271..92032
FT                   /gene_name="RPS1"
FT                   /locus_tag="CAGL0M00814g"
FT                   /product="40S ribosomal protein S1 "
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FK63 "
FT   CDS_pept        93206..95191
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20195505"
FT                   /locus_tag="CAGL0M00836g"
FT                   /product="Similar to uniprot|Q12745 Saccharomyces
FT                   cerevisiae YLR440c"
FT                   /protein_id="CAG62358.1"
FT                   /db_xref="HOGENOM:HBG124097"
FT                   /db_xref="InterPro:IPR013244"
FT                   /db_xref="UniParc:UPI00003B7001"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FK62"
FT                   /transl_table=1
FT                   /translation="MIEKKLAILASVYCSKADIKQLKRIIPYFKNQKALIFQFVQALWP
FT                   ELQDPLDLKFLFDVDTFNGDEDHAANSLNDILVQCLEQDSSLIPLVETNPDVVLERYDQ
FT                   LIKYVTRDSQIDFNIPPSHSSWIKNRIIHCNNYDKNLILYYQPLWSQLELTSEFNEWVN
FT                   GVLLPLNNIPANNRIHIEELIKMDSAKRITFLLGCMPSSTSDLGFFSNIFLPMLRYYKE
FT                   TDLDYYTSHYVNPQTYKLENNNEITILSKIYEISGSVEVGAKVLGILYENGQNYFKSHP
FT                   NKFTDSELRVLLTKIGTEDSSLHLKLLDLIRDIDDLEHFNSFKTLFDIQEGTEAQQYDL
FT                   FTIYSRSFRIDNISELEKDFLFNKLSLRQKLEIIIESLIEKNNLSEVKKLLDEDPTPEN
FT                   NELLIKNFWKFFYRSENIHDEAFKIAETILSMIPSNFNGSAKRHQLEYLLKNSRDLSQH
FT                   SINLHPHGFKPNYLLNYKDEPMAIISNLLELNPKLYKMTDKTQDILSNLNSCFDKKTTE
FT                   VAKSKLLALHIDHALVNRDFMFAYQLCKEWFAICKDAGNDEGIGKQWLTIFQVGKFIDP
FT                   EWPDNEAPTEILILQMEILSELLQYSPIDQIEIIATQWSALEVELSIRDLSTDTSISND
FT                   SNSLQFIQNSLNEVSHTMAAFLGRNR"
FT   CDS_pept        complement(95426..96373)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000094497" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17436693"
FT                   /gene_name="MRPL4"
FT                   /locus_tag="CAGL0M00858g"
FT                   /product="54S ribosomal protein L4, mitochondrial "
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="mitochondrial ribosome"
FT                   /protein_id="CAG62359.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005761"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG059094"
FT                   /db_xref="HOGENOM:HBG398135"
FT                   /db_xref="InterPro:IPR010729"
FT                   /db_xref="UniParc:UPI00003B7002"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FK61"
FT                   /transl_table=1
FT                   /translation="MLRRQFHSGCVQLARTRYTKPKPKNTETRAKEQIRLPTQQTHHSN
FT                   ELRIQPPIPPSTKNIVVPDDHPLWQFFSDKKFMRRPEDLDTTSRAWSIPELRRKSFEDL
FT                   HSLWYTCLKERNILARENHLLKNAAKNNRNDYEDISEKIRTTMWRIRHVLSERDWAFKR
FT                   ARETFAQNKELQDNLVDDFKKEFLELDSSEDEQAFEMLTRFQEALFGIHEVIEDNVVDR
FT                   KFVDGLKLVATLKLQRFQSRNDSINAILEESDGQINDVGEAFVVFTADNNLKAVEEACD
FT                   AIKELRQGENGVSRFDELPTVRGYLKRLVSATTV"
FT   CDS_pept        96799..97056
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000223550" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19348720"
FT                   /locus_tag="CAGL0M00874g"
FT                   /product="Similar to uniprot|P57743 Saccharomyces
FT                   cerevisiae YLR438ca LSM3"
FT                   /protein_id="CAR58072.1"
FT                   /db_xref="HOGENOM:HBG749684"
FT                   /db_xref="InterPro:IPR001163"
FT                   /db_xref="InterPro:IPR006649"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="UniParc:UPI00017BD8D0"
FT                   /db_xref="UniProtKB/TrEMBL:B4UN56"
FT                   /transl_table=1
FT                   /translation="MSLSTPLDLLKLNLDERVYVKLRGARAMEGVLQAFDSHCNIVLSD
FT                   AVETIYELVDGELKSQERASEMIFVRGDSVTLITAVSEEE"
FT   CDS_pept        complement(97304..98599)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000020206" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17436694"
FT                   /locus_tag="CAGL0M00880g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /function="pyridoxal phosphate binding"
FT                   /function="transaminase activity"
FT                   /protein_id="CAG62360.1"
FT                   /db_xref="GO:0008483"
FT                   /db_xref="GO:0030170"
FT                   /db_xref="HOGENOM:HBG408326"
FT                   /db_xref="HOGENOM:HBG725944"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR010164"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniParc:UPI00003B7003"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FK60"
FT                   /transl_table=1
FT                   /translation="MNFNISSKETVELEQKYSAHNYHPLPVVFHKASGAHVWDPEGKEY
FT                   LDFLSAYSAVNQGHCHPKIVKALVDQASTLTLSSRAFSNDVFAVFAKYVTEYFGYEMVL
FT                   PMNTGAEAVETALKLARRWGYEVKKIPDNEAIVLGAQGNFHGRTFGAISLSTDEEDSRK
FT                   HFGPFLTNTTAKNPSKGQAIRYGHIEDLEQAFESHGDKIAAVILEPIQGEAGIVVPPKG
FT                   YLLDVQNLCKKYNSLFICDEIQTGIGRTGKLLCFEHTEGVKPDVVLLGKAISGGVLPVS
FT                   CVLSSREIMSCFTPGSHGSTFGGNPMASRVAIAALDVIKEEKLVERAQKLGDLLQDELR
FT                   KLQAQSDGMISEVRGVGLLTAIVIDSQKAQGRTAWDLCLLMKDKGVLAKPTHDHIIRLA
FT                   PPLVISEEDLLKGVQAMKEALVELPSAPISGH"
FT   CDS_pept        99946..100296
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21044341"
FT                   /gene_name="DIF1"
FT                   /locus_tag="CAGL0M00902g"
FT                   /product="Damage-regulated import facilitator 1 "
FT                   /cellular_component="cytoplasm"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG62361.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="HOGENOM:HBG124107"
FT                   /db_xref="InterPro:IPR013900"
FT                   /db_xref="UniParc:UPI00003B7004"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FK59"
FT                   /transl_table=1
FT                   /translation="MDNKRHQTSIGSELSEAQNRLSTVGMRIRQRIDRGYAYSGKNVSG
FT                   MDDQVPIRDVASTIVPQFRTQVLYEQQQQPQQMHRPAMNGPAPMLVNQRTESSNLDCMQ
FT                   EEMLSNGKRRVF"
FT   CDS_pept        102735..106646
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000142326" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17436695"
FT                   /locus_tag="CAGL0M00924g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /protein_id="CAG62362.1"
FT                   /db_xref="HOGENOM:HBG124110"
FT                   /db_xref="UniParc:UPI00003B7005"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FK58"
FT                   /transl_table=1
FT                   /translation="MGNTDSKLNSLYKEHLLKLARPEITSIDNSQNGVICLFNPEYSLR
FT                   EIIDLYNNRGNITPDKSLKHTSDNHSTSIEDNLFTDYYKNFLKFDFQKIDNFNDLISKD
FT                   ELRTIYKNNKENYLNLIRFVILKIILIPSIFGNTQNKSSFNKLFKQLLTCIKILTKLVP
FT                   VYLENIVNGEKDILWDTSPDALFGEHIPDTDLIPVSMTSALKTSLDMPTADLASPHMER
FT                   PLGAALLDSCLNLLFIEDFTVSSSSDTSQKTGDLTMILWENGINTYDTSYYTQFVHLDA
FT                   NRLQIIELLLALVSIDIYLPVNSDGFKAKDKIKNKYLDYMKYEAREHSVICLTASIINL
FT                   FCRHSAYYKQEGTNPYKIIPKENSRENPKYSNRNSFDTNPGSSNNINSQWLPELRSKLV
FT                   ISSLQFLNVMICPEESNTKVTKKRMVNTAVSYLATLQREFDLKLILTSVIRIFKLPIDA
FT                   AIDEDSNLFTFPTASSRKKHQNLSNHSRTSSSSNIKRSTSNSSATSRYDSNPNTVTGSP
FT                   KLANMRENNTSSYSSLPPLPPILCQSLVFLINVIKINKLVKNQFADKFASKFVVFAVYY
FT                   LKYYNDNPEYSLTVIPVINMLALYLTSKPLVLLKMLDPFNSNYYTNKIPNAFKLTSGNI
FT                   NNLTYRDFTVIQLCNIADYEVKNNIQPNPIIYETLYNLIPIDPKWLASDTSGADDEELT
FT                   LLSRKKSINSSGNGLKSCERLSYNASLAVLHLISKMSSRNYLTTYSTPRIASMVTSIPA
FT                   YVLSPGFKLDLLAILLRAVSLYVVSNTDEAMNLIFAFARHKSVILQLSEVMNSIAKNFS
FT                   PTNTQISTTDKNIRLRDFYRLHDLSYNNINFRKAFNNDEGFHRSSSPNLIKSNNGKNND
FT                   NNDSDNDSMDMNSSAYLVLTKPIAREYSSDDLRNNNLTTREHAGSNNNNNINSSNDKTL
FT                   QVLEYVDFINDPIISLANESDYFKMRPKWPVGISMKSKVKSSMKKDFVRSWQGNDSMVL
FT                   LVKIVKVLLYDFPEIATINNSEYYVLLKKMEESKDHFLSMIKDNIPIYMRTGSSIQHQK
FT                   LSIDDESKFSTIWFYTLCWSDIFNTHSSPYNKSLINELEEVEETNDIIPTISNNGSNIF
FT                   ADPGSPVLERWNSNSSNLSRTNSNSSSLMGYFFQQPQSASSNRSSVDHTSRFIESKNAS
FT                   APTKKASAPQNSSFSLFKFSWTGFNKNGNSDDCDVIKEEEETTVSQTSTRNGVNQQIFV
FT                   SALDMSLLKSNIWVDTKVRMFIVEREEKEEFSLLDMTSTFFKKLKFNNSAAMSNWESNN
FT                   IPGSTPLASVPFAARNPMF"
FT   CDS_pept        complement(106985..107617)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000182935" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21044342"
FT                   /locus_tag="CAGL0M00946g"
FT                   /product="Similar to uniprot|Q06672 Saccharomyces
FT                   cerevisiae YLR435w"
FT                   /protein_id="CAG62363.1"
FT                   /db_xref="HOGENOM:HBG034966"
FT                   /db_xref="HOGENOM:HBG735086"
FT                   /db_xref="InterPro:IPR019398"
FT                   /db_xref="UniParc:UPI00003B7006"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FK57"
FT                   /transl_table=1
FT                   /translation="MEFDETVYVEAPQGQGNLMFSDEKQQARFELGCSMMVYKWDALDI
FT                   AVDNQWGGPESAEKRDWITGIIVDLFKNEKIVDAALLEETLLYAMVDEFDTNVEDDSAL
FT                   PIATGIIQVYKDCAAQNYQIVEQLYLEWQSKEKNKPQRVIKVTGDDESSSDEDDEDEEY
FT                   MNGATGEDTHMHYEEIDVDMENDKSRSEPIVDDDGFELVQKKGKRRN"
FT   CDS_pept        107989..109311
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17436696"
FT                   /gene_name="ATG23"
FT                   /locus_tag="CAGL0M00968g"
FT                   /product="Autophagy-related protein 23 "
FT                   /biological_process="autophagy"
FT                   /biological_process="protein transport"
FT                   /cellular_component="cytoplasm"
FT                   /cellular_component="membrane"
FT                   /protein_id="CAG62364.1"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006914"
FT                   /db_xref="GO:0015031"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG124118"
FT                   /db_xref="UniParc:UPI00003B7007"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FK56"
FT                   /transl_table=1
FT                   /translation="MLNDILVEVAEKTQLLESLIIPHERALTESDYSDQLENIRAEISA
FT                   TLNSLSNLNDLLISHDGPLRTEISSLMASKSKLKKINMKELTLLNEQETLETLRNDSSN
FT                   LESSRPGFTTQQQQSITIASSYRHELQKYLDLVDVEKTSLNTNKLADNSKISKEDVENS
FT                   DFNFNLKRYEKQQSILHSALTVNEIEIKKLETLLKEFRKDNNFIRDELKLINSNLKSHE
FT                   DLISDELKQIDESRYAIMQSIGYSGRNEQQSSILDSIVKLSIKKPDIRTLIQERIEEYS
FT                   NLLNFIDMKLNGLDQMLQEYKSRKSEWAEKSILWSQCLALISELEVTVRDQLSSAHTVG
FT                   SEISPDQIKAQIKKFLTKLNKLLDESDLEDVVYSLVRNEVNSLNVALDEMNQMPQIKND
FT                   ISDRESIHNPSFKLISKSPPKTGFSSENVSYKLNNTNIKKD"
FT   CDS_pept        complement(109609..115548)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000246755" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17436697"
FT                   /locus_tag="CAGL0M00990g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /protein_id="CAG62365.1"
FT                   /db_xref="HOGENOM:HBG059089"
FT                   /db_xref="HOGENOM:HBG396727"
FT                   /db_xref="UniParc:UPI00003B7008"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FK55"
FT                   /transl_table=1
FT                   /translation="MSLPIAQLYEKAGQFVPLIEKVYNGSNVGISESKLLGDVLHFIAE
FT                   LKDQHIFCDPQFEPIAVFCLTIFSFNDQSTIDWLKSRFNSILASCNKCVLAFARGKSRM
FT                   LRHFAIQRNVPHEHVAKFNNLICSWRLDTIRVPIEKLSNLPIGSQVENDFSCAFYECMT
FT                   DPNLMRMDRAFRALFDKSFSVLLSSQDSLLNGKTPNDGDILLAGTIFCWCEGNKDENDW
FT                   ARKVLRNLIQSKTTFNMKTIGDDVLDEIQTHFLFLQNPGNWNEVIVSQFWTRFIPIFTM
FT                   LDREIIEEYFGIPKNQESLKRSFKYPIESLVKLWCNHMTKLYSDKPVDFLLRALHMFLD
FT                   KLGQDFWQLIEPYTFHSILDSLFEQPVFLARLMRLQKEPIIENREELIFSFSGSLTDLL
FT                   AWTLPFYNALSPSKRIQMVKKVSISFLKIVAHQPNLESISKACLVTSSCTLLSSVLFIT
FT                   DDERAKLYSVNDFENVLLTKVDSRLLLDNSLIQNVLLKSITEPASFYPGLGNSATSVAA
FT                   STMGVLTTCIDFDLLTLCQRTYKLYFGTAVNEFPLPLSLLENMVGSIQLGSFHNGPLLT
FT                   KLLLTSLKNVYGIVIITKSNLNTTQHNKTVENVWNLVINLVENFNDLLPNQLMEILGDK
FT                   DAMVGFWSCIFSSNEKLYQAATNILYNTFDVDGRLEGVQALFKQNVSSHLNSINFILSK
FT                   LIKCEYFELCPRTVKVLMDIISAFIDPTNGVLSNPEISNSSETKDEMFSFWNLVWSFLD
FT                   SIYRCTLKWATKYNYSLLENFTKDTLDLSNALVGSFREFKDVLGENVNLFHVVLKAFKN
FT                   MLYWLRLSDEILLESCVKLITSTSDLAQERKMKFDDELVELMAKYGSKYRKFSNKLSLQ
FT                   QSNEIISRAQTLNPTLTSKIMDEASAYNKMKEQAKQTIVISDSEETGTGKSPAELKSEY
FT                   LQRKALGLAAHTKSKVTQSKITSFGTVQAGAALSLKTKPQPKPLSKMEMARRQLLQNRV
FT                   IHPPSQPAFHTKAPSKSQTAEDDTSSDESDIDMETARELFAVAKSKSKGIETLDISGKP
FT                   IKINSAAERAKMEEEYMRKRLNVDLNPLYEQLLQWDYTKISEYPDDKGADAYRDIKDEF
FT                   KSANDYKNVMKPLLLLESWQGMCSARDRDENTPFSIVIGNRTSISDFYEIYASISKKML
FT                   QDSNITESDLIVLAYFPNIAPGQKVRYEEFKKAQFTCLAKVKTLKKTKGGNVDMSLRVH
FT                   RNHSFAKYLTHRAEINAVKVMQMTTIEREYSTLEALQYYDLVNQILSAKLSPPSNTFEQ
FT                   QIMKVQQEYFLNESQARAIVNTVISSGFSLIQGPPGTGKTKTILGIVGYFLSLRNATPT
FT                   GTIQAPTDKKSTTLDQMLKKPKILICAPSNAAVDEICLRLKSGIKTKGQTVRPAIIRLG
FT                   RTDVVNAELKDVTLEEIVDKKLGDKSYEFTNNPDIEKKFQSLLSERRQLRDKLNAENGS
FT                   PDSSMSTNDIANLQMKIRELTKSINELGREKDEMREKNAINYRNRDLDRRNAQAQVLAS
FT                   CDIICSTLSGSAHDVLATLGMKFETVVIDEACQCTELSAIIPLRYGSKRCIMVGDPNQL
FT                   PPTVLSGAASNFKYNQSLFVRMEKNSKPFLLDVQYRMHPAISKFPSAEFYDGRLMDGPD
FT                   MESLNKRIWHEQEPFKPYKFFDITSGQQVQNVKTMSYTNKEEIEVAIEMVDKLFRLYDN
FT                   KIDFSNKIGVISPYKEQIQRMRREFMRYFGGSITKFVDFNTIDGFQGQEKEIIIISCVR
FT                   ADDSQSGVGFLKDFRRMNVALTRARTSIWILGHQKSLRKSKLWSHLIDDAEGRGCLQQA
FT                   YSGFLNSSNSRAQDTLNKYKESKSKEKKKHPIPAAADKKDADISNRNISEATDISDGED
FT                   DYDPVTAFKPIEKIAIKRRADNQDKSPFIEKKRIKKPKIQANDENPSGTKKKSSIFGSK
FT                   ENNQVPSKPAVPYIKDKASKKDKKEDKKKSKKSRHISFSDSIETIP"
FT   tRNA            join(116503..116540,116560..116605)
FT                   /gene_name="tRNA-Ser (GCT)"
FT   CDS_pept        117010..117579
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000183747" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17436698"
FT                   /locus_tag="CAGL0M01056g"
FT                   /product="Similar to uniprot|Q05498 Saccharomyces
FT                   cerevisiae YDR339c"
FT                   /protein_id="CAG62366.1"
FT                   /db_xref="EMBL:AAL02316.1"
FT                   /db_xref="HOGENOM:HBG296796"
FT                   /db_xref="HOGENOM:HBG499799"
FT                   /db_xref="InterPro:IPR006596"
FT                   /db_xref="InterPro:IPR006984"
FT                   /db_xref="UniParc:UPI000006AF37"
FT                   /db_xref="UniProtKB/TrEMBL:Q96UM4"
FT                   /transl_table=1
FT                   /translation="MGKAKKTRKFALVKRTLNAKKDQRLKGNQEKQKSQEDPELTRNIP
FT                   QVSSALFFQYNEAIKPPYQVLIDTNFINFSIQKKIDIVKGMMDCLLAKCNPLITDCVIA
FT                   ELEKLGPKYRIALKLARDPRIKRLTCTHKGTYADDCIVNRVLQHKCYIVATNDAGLKQR
FT                   VRKIPGIPLMSVGGHAYVIEKLPDVF"
FT   CDS_pept        118018..120105
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000177026" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19348721"
FT                   /locus_tag="CAGL0M01078g"
FT                   /product="Similar to uniprot|Q05497 Saccharomyces
FT                   cerevisiae YDR338c"
FT                   /function="antiporter activity"
FT                   /function="drug transmembrane transporter activity "
FT                   /cellular_component="membrane"
FT                   /protein_id="CAG62367.1"
FT                   /db_xref="GO:0015238"
FT                   /db_xref="GO:0015297"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG334116"
FT                   /db_xref="HOGENOM:HBG398292"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniParc:UPI00003B7009"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FK53"
FT                   /transl_table=1
FT                   /translation="MVGILSKTLSEVHPTLLTNGMGITNTHRRISLGFFPPNRKNPLVR
FT                   KYRRKRANLNTNDQRSFQSLVDDFGSSVHEPSQFLNYINEDEEDLYYNDIEEGGELSRT
FT                   VSLPSLVSETPDLSPPDTDWIIQEHERRYSSVYNSDNENDLADEPVSIGGSMTNRELEY
FT                   DEFMNRIKAQKQVYDSIASHKYRRRPSLISVSSRGTVPTIYQEINGTDGADVCLPEKIT
FT                   FREEAKVLSSFSFPLIFTFLLEQIFPMVCSLTVGHLGKNQLAAVSLASMTSNITLAVFE
FT                   GIATSLDTLCPQAYGAGRYYSVGIHFQRCVLFSFIIFLPFALFWFFSEPILFLVVPEKE
FT                   LIALTSQFLRVLIFGAPAYILFENLKRFLQAQGIFDAGIYVLTICAPLNIFVSYTLVWN
FT                   KYIGIGFIGSAVAVVINFWLMFILLLLYTIYIDGKKCWGGFSKKAFTHWKDLGHLAFSG
FT                   IIMLEAEELSYEILTLFSAYFGTSYLAAQSAVSTMAALLYMVPFAIGISASTRIANFIG
FT                   AKRVDLAHNASEVGLVFSFGAGLTNCCVLFFGRNIIAHVFSRDDEVIDLMTGLLRLVAV
FT                   VQIFDSLNAVAGSCLRGQGMQSLGSIVNLLGYYLFGIPLALILGWVFNMKLYGLWIGIG
FT                   CAMLLIGLIEAYNVLYPNWDYILNYAEILKETEEDDDDDSYFTDSDDNDEEPTERSPLL
FT                   D"
FT   CDS_pept        complement(120294..121178)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000248865" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21044343"
FT                   /locus_tag="CAGL0M01100g"
FT                   /product="Similar to uniprot|P21771 Saccharomyces
FT                   cerevisiae YDR337w MRPS28"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="CAG62368.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG190303"
FT                   /db_xref="HOGENOM:HBG397843"
FT                   /db_xref="InterPro:IPR000589"
FT                   /db_xref="InterPro:IPR005290"
FT                   /db_xref="InterPro:IPR009068"
FT                   /db_xref="UniParc:UPI00003B700A"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FK52"
FT                   /transl_table=1
FT                   /translation="MVFARTLIRNIEGVGLKVNPLRYYHATPVTQGAKAVKFLKAQKRR
FT                   QKNEARQASIKSQSEMVDPVLGRKDTPFINRINAEIKEPTVLSSDYNYDEVEKFLVSVE
FT                   ATKQEHRDLSPLNPEFATTETTESLSLRHEALFRILNIRNANRKDTMQIAIRLAREEFQ
FT                   RFPGDTGSSEVQAACLTVRIQNLANHIKNHKKDYANTRMLRMLVQQRQSLLRYLKRDNP
FT                   ERYYWTIEKLGLNDAAITQEFNLDRRYMQDFKFFGDKILVKESKKVAQQIRKDERKQKK
FT                   ASSSSTVEQQPVL"
FT   CDS_pept        complement(121796..122782)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000065937" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21044344"
FT                   /locus_tag="CAGL0M01122g"
FT                   /product="Similar to uniprot|Q05473 Saccharomyces
FT                   cerevisiae YDR336w"
FT                   /function="GTP binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAG62369.1"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="HOGENOM:HBG124132"
FT                   /db_xref="HOGENOM:HBG203258"
FT                   /db_xref="InterPro:IPR002917"
FT                   /db_xref="UniParc:UPI00003B700B"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FK51"
FT                   /transl_table=1
FT                   /translation="MSSGKISGRNAINIVKNVKVKPTSDSLISGSNKVNVKRSGLLSKP
FT                   HKKHASSDKSHSWINLNKYMNNSYAYPSASQLNAINHFFNRAECKYEWSVADFGNIPSE
FT                   QMKSVYGHNSGMNHEGGKLYNGKTRYPFQLLNPLPEIAFLGKTNVGKSTILNNLITSFK
FT                   QKDLDVHARMSNRAGFTKTLNCYNVGNKFRIIDTPGYGFHSAIEQGNVTLDYLSNRKEL
FT                   KRCFLLISAKKEISEHDRYLMDLMTESGIPFELIFSKMDKVTDVDEFVQWIDSSGLRNL
FT                   PTLPKLIFTNSMVSKFIKKRYGVDLLRYSIFEACNLDSSVKPERIKY"
FT   CDS_pept        complement(123429..127094)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248154" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17436699"
FT                   /locus_tag="CAGL0M01144g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /function="binding"
FT                   /function="protein transporter activity"
FT                   /biological_process="intracellular protein transport "
FT                   /protein_id="CAG62370.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0006886"
FT                   /db_xref="GO:0008565"
FT                   /db_xref="HOGENOM:HBG058987"
FT                   /db_xref="HOGENOM:HBG397066"
FT                   /db_xref="InterPro:IPR001494"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI00003B700C"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FK50"
FT                   /transl_table=1
FT                   /translation="MNVGANQVVEALNVIYSPKSNNGQRLEAQKFLDSVRTLEESPLWG
FT                   FEIALNNSDNNILKYFGLNLLEYNIKKNWNSYNNEKRQQLKKWIIELNYNVSTVDTRYI
FT                   KEKLASLWVEIAKRIWGEALKETNPSNDQLLDSWVDLDRDLHQLWNINESSREVTLIIF
FT                   RILFEDVFLLDDMTVLKRMTIIQPLCVMIVCPMDIFITKYKFSEKWTLFKADSDGWFSI
FT                   WIPELRTALLNKNSEYIIRLLETLKTCLNWPLSEVIIKNDILTTLLDCLATDIRKAQSM
FT                   ALDSIHILLTRPYGNDEHYQTIIDKVFDSMDLLARVYEDLLFNPEEEVDETRYPIVKKF
FT                   VDMTSCLYVSIPKIKDTNNQIEKYFKLVMQTTYNPSLIVSGLTLDLWCSCLRNDDYIPL
FT                   IQKYAIKDLLNFAADALVYYEQIDGHISRNYVDIDFQSNSEFQSYCSTYRKRIRDIIRL
FT                   ISCVEIDMTYEWLNNRLNVYFSSPAGQQVLTSSFLDHKSEPYLGALSQYMIVECFINGC
FT                   IRWKIWYPSGPDYNQKLDSILQKLEILSNQLIALNMKEPLLLKKQIQNFALFLTMLRDN
FT                   VLFTLLEKIITSATMDYPEVNLDDRSEQSDAVRDLRYACGIELNRMALLMPESLKSIYP
FT                   DLEAVIAKIMPNLSYHEKISFKSFLLIIVLKSSLDNKEQRFSELVDVELMAWSEKTTEV
FT                   GLSDLHWFMERLGIVQIAEYFQKRGINENSDLLTIPIDDEGRALKAELTKRWQTLFPVR
FT                   ATRMFIHYSMQSIKGDEEFKRLQDLWRPRIIPVLPYILRLLFQLQSYHDAENWKNLPVI
FT                   VQTFVKCTTVERFWEAGASSKSKDEFIDEHMKAMQTLRDFADSVGHIIRYTREYTLLVL
FT                   SAISSLGSIFFELDDVPDMLINSIAIFKPGNNEISPGVSTHGWKHILNIAIRPMLKNCP
FT                   DDCAPKFMSAFLPKLFEMLDHLLYQRWSVRMDVMDVNPAPVDNDQMTEDILEENLLRQL
FT                   TTVVVRIVIDCVGQASVSSQSARSNLTSHQLRMRKIIFNDINILAPFLKLVNHLMAYKD
FT                   NKCSFNSILVMKGCINEVAAKDETVDVFFTTELMKNLLINVLCNSAFKDFFNEALYVFT
FT                   TLFLTLCKESTSARQFFYELSGGYDIDSLHSNLKKVDDYKSQRALMVEFIDWTKMTLGK
FT                   DDFDEEQAMQENRKQEKREAILQKANERLIKKNKESGDMLDDPNTEDGAVGNLFS"
FT   CDS_pept        131016..131990
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000106048" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17436700"
FT                   /locus_tag="CAGL0M01166g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /biological_process="thiamine biosynthetic process "
FT                   /protein_id="CAG62371.1"
FT                   /db_xref="GO:0009228"
FT                   /db_xref="HOGENOM:HBG056531"
FT                   /db_xref="HOGENOM:HBG325902"
FT                   /db_xref="InterPro:IPR002922"
FT                   /db_xref="UniParc:UPI00003B700D"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FK49"
FT                   /transl_table=1
FT                   /translation="MSATATTTTTSQLQLNSTSIEHALSDVVKTDDWSDFQFRPIREST
FT                   VSRAMTSRYFKDLDKFAVSDVVIIGCGSSGLSAAYVIAKNRPDLKIAILEANVAPGGGA
FT                   WLGGQLFSAMIMRKPADLFLKELEIPYEDEGDYVVVKHAALFTSTVLSKVLQFPNVKLF
FT                   NATAVEDLVTRPAGPNGEVSVAGVVTNWTLVTMAHDLQSCMDPNVIELSGYKEDGTRDP
FT                   SKKHGVVLSTTGHDGPFGAFSAKRIVSIDKNKKLAGMKGLDMNNAEAGVVKNSGSYNGV
FT                   GSMYFAGMEVAELEGCNRMGPTFGAMAVSGIKAGEEILKHFAE"
FT   CDS_pept        complement(132330..136682)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000186095" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19348722"
FT                   /gene_name="SWR1"
FT                   /locus_tag="CAGL0M01188g"
FT                   /product="Helicase SWR1"
FT                   /EC_number="3.6.4.12"
FT                   /function="ATP binding"
FT                   /function="DNA binding"
FT                   /function="helicase activity"
FT                   /biological_process="chromatin modification"
FT                   /biological_process="regulation of transcription "
FT                   /biological_process="transcription"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG62372.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0004386"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006350"
FT                   /db_xref="GO:0016568"
FT                   /db_xref="GO:0045449"
FT                   /db_xref="HOGENOM:HBG058847"
FT                   /db_xref="HOGENOM:HBG396531"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR006562"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014012"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="UniParc:UPI00003B700E"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FK48"
FT                   /transl_table=1
FT                   /translation="MSKNNKLNGKDNRQSKIEKLSELKLRHDQLTNELYHLHEYISLVE
FT                   YDPFYIPNSENYERLLEEKDVTWGSIFQEKKQLHNESSGKKVRRSVRHLRDSGSSTINE
FT                   LDTMSENDINLLKEVDILAKQKLQDLKLQFSNSHIKKKGNTKRAKIVKQVPNHQDKSES
FT                   PQISERDVKTVVKDLKPNHRGSEIKPEIMESSDVKNEIENCDFNEKQLKLYKDDDIASE
FT                   SDFYFTTSSEDELPNKRRGTIKRRKRINLYVNPPKAVITNPDNIANSHYPTLHEYLDSF
FT                   KILEDDMTNEEYNTFIKEQQRFAKMIKKGIETGALKYDPVTETVQPSARKVPNMFSHAK
FT                   VDPIQYMYKEQNLHIHQEHLINQGLFSSKLVQNRKKQRIAGAKKIAQMIEQHFKHIAGA
FT                   EDRRLKENEKQRKAIARNIIQSVKKRWNLAEKAYRILKKDEEEQLKRIQGKEHLSKMLE
FT                   KSSKLLGAQLKQHPNEDDIENSTSDDFSSTGDSDNLSSSSDEESDDEINDLSEDQKNNI
FT                   NELKTSSTSAFSSPEISSPSKNPDLGLNSLLTNDFENESNSSDTNEEFIMGDSDTSHSD
FT                   DENLTDDSEDSNDGEHDTTSDNEKSDLFPADTTNDPLAVQDVPTPSLLRGTLRTYQKQG
FT                   LNWLASLYNNNTNGILADEMGLGKTIQTISLLSYLACEKHNWGPHLIVVPTSVLLNWEM
FT                   EFKRFAPGFKVLTYYGNPQQRKEKRKGWNKPDAFHVCIVSYQLIVQDQHSFKRKKWQYM
FT                   VLDEAHNIKNFRSTRWQALLNFNTQRRILLTGTPLQNNIAELWSLLYFLMPQTVIDGQK
FT                   VSGFADLDAFQQWFGRPVDKLIETGGTYEQDNETKRTVEKLHQVLRPYLLRRLKADVEK
FT                   QIPGKYEHIVYCKLSKRQRFLYDDFMSRAQTKATLASGNFMSIVNCLMQLRKVCNHPDL
FT                   FEVRPIKTSFLFGESVIARYSERANSITRRIHFHDKDTLVDLQNINLQFTNNDLEKTSY
FT                   HTNTINKLACINEFVEEVQKLRKQNAEEERQKSRHLKINTQNISNFYEEFMQQKLDEQE
FT                   NKINFIGYLNSQRCSRKTVYGMNLIRLLEMPHVSNNCIDDPNYDDLIKPLQTRLLDGRT
FT                   TIEKFAVLTPGAVTSNIGELTLGMDEFVTPNSKSGIIPYEELVQLDNPFHQVQTKLTIA
FT                   FPDKSLLQYDCGKLQKLAILLQQLKDGGHRALIFTQMTKVLDILEQFLNYHGYLYMRLD
FT                   GATKIEDRQILTERFNSDPKITVFILSSRSGGLGINLTGADTVIFYDSDWNPAMDKQCQ
FT                   DRCHRIGQTRDVHIYRFVSEHTIESNILKKANQKRQLDDVIIQKGEFTTDYFSKLSVKD
FT                   LFGSDVVGDLPVIDTKPLLGSDSEAIKDPKKLEKLLAQAEDEDDVKAANSALREVNVDD
FT                   EDFDESSTNKTGGNILNGDDIDEDVDEYEGTNHVEEYMLRFIANGFYF"
FT   CDS_pept        complement(137725..138729)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000094409" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17436701"
FT                   /gene_name="IPI1"
FT                   /locus_tag="CAGL0M01210g"
FT                   /product="Pre-rRNA-processing protein IPI1 "
FT                   /function="binding"
FT                   /biological_process="rRNA processing"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG62373.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006364"
FT                   /db_xref="HOGENOM:HBG058844"
FT                   /db_xref="HOGENOM:HBG397966"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI00003B700F"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FK47"
FT                   /transl_table=1
FT                   /translation="MTKSKKQKQKKKDFLKKKLKVGKPTGKPSNSTDTSFTARTLSVRS
FT                   QLVNNAGDDLRKRLPLLKHHNDKVRKETLGIYIKAIPKIISTQLMTPLISQTSQLICDD
FT                   SKDVREQLLELFDEVGKHDEQVLKLHCRSLVLYINMGMTHILPRVQADSTKFLGCLLKY
FT                   CGQEFCDQAWNKLMAGIFRVLSWETQHSKNSNQAAGAMQTSKRDNKFQAAHLSTLYALL
FT                   ECGCKEPTVETTDEDTTSNIQNFEEVQYMTPSFPQAYGYLKLFDKQLKSSSSNKDNSSV
FT                   SSSDALDVESRIRNVENVYLPTMKKQIEQIIQEGGEAGKNANNIKKLISEIFS"
FT   CDS_pept        139130..141289
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248670" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18500872"
FT                   /locus_tag="CAGL0M01232g"
FT                   /product="Similar to uniprot|Q05468 Saccharomyces
FT                   cerevisiae YDR333c"
FT                   /protein_id="CAG62374.1"
FT                   /db_xref="HOGENOM:HBG058843"
FT                   /db_xref="HOGENOM:HBG203256"
FT                   /db_xref="InterPro:IPR006994"
FT                   /db_xref="UniParc:UPI00003B7010"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FK46"
FT                   /transl_table=1
FT                   /translation="MSSRALRKQQNDAELLESILNSNATTKRTTQQQKPKANMATTNIF
FT                   SLMDDYNSDDSEDVKDDAEEFELHKDVADEENEAIAAPKIQLASKKSRKKANKGRKNKK
FT                   KDNKPVNEPQSDTKDDIGNDEELDKIIREFQKSYINTTNLHHDDDIDGDEFVTASESES
FT                   YDEGTRSSTKKTSNHNLFTDPGFSNFNIRGLKACERFFNTDIRKLDPHTEYKLLFDDIS
FT                   AKSLEDIDSVSSVSISPQQLKQIQRLKRMVKNWGGRDRRTVPNGPGNSPHRLRLTKVRD
FT                   DWIPTQRGEFKMALMTKSEVMDWQLWMSPLDWKDVVEERVGSLHKFISFYKFESVTPDI
FT                   TRKSLSEFYVSVILHPDHEALISLISSRYPYLVPGLLQVALIAIRQGDRSNTNGLLQRA
FT                   LFVFDRALKTTVQFDGVKCQLPYIYFMNRQFYLTIFRYIQALGQRGAVGTASEWTKVLW
FT                   SLSPLEDPLGCRYFIDHYLLLNEEYQYIIDVAKSPLFTTYKQWYTLGFSLAVTLSLIRL
FT                   GKLKEARQEIEKNAKINTACLMTLFLEHLKGDVSQVQTTIEPTERDILEFKSYVTRFQH
FT                   HWKSTEEVNFLHDELSRIFTNSIDLDSDLDNAATNDDVESPFYIDGIPVNLLRFAILSE
FT                   ESSLMAAIPKRIWSNYEIYEFDVLPPIPTTKESRDVIENIKSLINESELISSQAEALQN
FT                   EEILRRIQQLSLQEYMEGNPQELDI"
FT   CDS_pept        complement(141519..143315)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17436702"
FT                   /locus_tag="CAGL0M01254g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG62375.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="HOGENOM:HBG124146"
FT                   /db_xref="InterPro:IPR003120"
FT                   /db_xref="UniParc:UPI00003B7011"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FK45"
FT                   /transl_table=1
FT                   /translation="MSPFIKGRQRRTEEILKGDLKHHNDDGLVKSVIDDLEDAISAIED
FT                   LKFFLATAPLNWHENQVIRRYYLNNSQGFISCVFWNSLYYMTGTDIVKACMYRMEKFGR
FT                   KVIERKKFEEGLFSDLRNLKCGLDATLEQPKSKFLKFLFRNLCLKTQKKQKVFFWFSIP
FT                   HDKLFADALERDLKREFNGQNPTTIAIQEPALSFNYDQDSKLSLQEQLSRHISTKKCNT
FT                   ITKSGDKDISKNKITNAVVDNQNEEQKEANDISSLEEVSNSVNIGDPLSRSNHSSSYAY
FT                   SKFQSCNTSHAQSAISSPLSPTNNLPASMDTDYSSDLKELTSDSPNFDNDDNFMNIKIE
FT                   YPDENISNGFLATSLNPDQSFLYYDDRNMEIDKNSSIDTNKIVTAQFSPFLVSASLDPQ
FT                   YLLPHVQRTPFQDIKSAAKDGAFTTQKINPSVGNNLHFPYPEVTSPGLVDSITLSELLD
FT                   ENCNNASFELNNERVKISSQELSIWNMLPHNSTSHMTPVFHSLLSAGIKGTHLPAYSPF
FT                   LTTTPWGSLSSPFSSAKSNKSSQRRQSQFDTRTLGKRRKTKTCSKYSSPNGIARNTKPN
FT                   KVLKNSINKMIDTLRSNTKNVS"
FT   CDS_pept        complement(144593..146641)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000180925" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20195506"
FT                   /locus_tag="CAGL0M01276g"
FT                   /product="Similar to uniprot|Q06683 Saccharomyces
FT                   cerevisiae YDR332w"
FT                   /function="ATP binding"
FT                   /function="DNA binding"
FT                   /function="helicase activity"
FT                   /protein_id="CAG62376.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0004386"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="HOGENOM:HBG058842"
FT                   /db_xref="HOGENOM:HBG395851"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="UniParc:UPI00003B7012"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FK44"
FT                   /transl_table=1
FT                   /translation="MLRILKQSFRNNAPSLKWYSTTATPILRDYQNDAIKSCLDAIALG
FT                   KKRIGVSLATGGGKTVIFSSLINLLRQRNRGNACRFRTLILVHRRELAEQAVRTTSRIN
FT                   EDLNIQLEMGNQNCDVSNSDVIVASVQSIIRRLHKYREGDIDLIIIDEAHHAAADSYKK
FT                   VLKHFRCDTANTRIPVIGFSATFERYDKKSLKESFDELVYHRGIIEMIDDNWLCESKFT
FT                   TVRLEVDLSKIPTSTLTSDFQTGALSRLLNTQTVNSIIYNSYLEKRKENNIKSSLLFGV
FT                   DINHIECLERYFNERGIKAKAVSSKTSVEDRQKAIRDIKSGELEVLLNCGIFTEGTDIP
FT                   NIDCILLCRPTKSRTLLVQMIGRGLRLHHSKEYCHIIDFVGSTKAGVVSVPSLLGIESC
FT                   EDTFDNATLEELRKIKLEEETRMAEYQQMQTQAELQKRAHEEMLRNQLNKMEQTLLEVS
FT                   HGDALDLNLISYANFKEYHEKLQAGIAVDLNKINQIEEELSFIHKSKYAWVRITKNCWA
FT                   FDLSNGHHIRLYRSSDKPGGTRYTLKLYREIPKLYRDEVNSSIRYVPTILEKDQDLSQI
FT                   TLKLEQVIKKYEDLGNSNSLGRIIKYARWRSQEASPKQKILVEKIIQKQLTKLKNSNDS
FT                   MNIDPFSISSYIKNLTKGSASKLLFATSIAPTFPVQGLLKNLKNTSK"
FT   CDS_pept        complement(147015..148187)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000204398" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17436703"
FT                   /locus_tag="CAGL0M01298g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /function="cysteine-type endopeptidase activity "
FT                   /biological_process="proteolysis"
FT                   /protein_id="CAG62377.1"
FT                   /db_xref="GO:0004197"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="HOGENOM:HBG351228"
FT                   /db_xref="HOGENOM:HBG561734"
FT                   /db_xref="InterPro:IPR001096"
FT                   /db_xref="UniParc:UPI00003B7013"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FK43"
FT                   /transl_table=1
FT                   /translation="MRIVLPCLLWLVTLACGVVNAEHTNNWAVLVSTSRFWFNYRHMAN
FT                   VLSMYRTVRRLGIPDSQIILMLSDDVACNSRNLFPGSVFNNKDHAIDLYGESVEVDYRG
FT                   YEVTVENFIRLLTDRWTEDQPKSKRLQTDENSNIFIYLTGHGGDDFLKFQDAEEIASED
FT                   IADAFAQMYEKKRYNEIFFMIDTCQANTMYSKFYSPNVLAVGSSELDESSYSHHSDVEI
FT                   GVAVIDRFTYYSLEFLEQIDKTSNLTLKDLFDSYTFEKVHSHVGVRSDLFKRNVSDVLI
FT                   TDFFANVQNVIPDDNSGKTSGNNEDIIDLAIQKSQLASKKDKSSQTPKPKEPASSIYFR
FT                   TASSLNKNITDAKNNSNEGLMTVLLIILVMLGLYTTFKRTSKKETAKFSL"
FT   CDS_pept        complement(148547..150079)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000180231" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19348723"
FT                   /locus_tag="CAGL0M01320g"
FT                   /product="Similar to uniprot|Q06682 Saccharomyces
FT                   cerevisiae YDR330w"
FT                   /protein_id="CAG62378.1"
FT                   /db_xref="HOGENOM:HBG058840"
FT                   /db_xref="HOGENOM:HBG395858"
FT                   /db_xref="InterPro:IPR001012"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="UniParc:UPI00003B7014"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FK42"
FT                   /transl_table=1
FT                   /translation="MEEDKINNFLVITAVEDADVARQFLDMAGGDVDTAISLYFEHGVS
FT                   GLPSGGADAGAGTSGASSSVAHAESDSALAERLQQEAYQEPQTDVRPPDEARHETLAET
FT                   HVFPTTYGGIGGSFGSLRHHSGNVAQDMFDNSTPQGIFNQRMDFDYSDDSSSEGSSSSS
FT                   LSEFNSNSDDDDEYEYVEEDVVEVDDDGNITERKELVRRLKNPITKEARLAMLFRPPFD
FT                   IMSKVNLDRAKLKARKKKRWIMINIQDSGVFQCQALNRDIWSNKRVKRLIKKNFIFLQY
FT                   QFESRNAEPYVHFYGLKSKEELPHIAILDPLTGERLKQWDSTVPRLESFLDEVEKFLKD
FT                   FSLEPGSKNPLIKQPTPDLDPTTLSEEQQMELAIRQSLGAGEQEVSPSNNERNTDEVSE
FT                   TEIADAKEEEKPSTGSLFDQIEPINHEEPQNEPGKTTRIQIRTGDGRRMVRRFNLTDTV
FT                   RNIYEVIKAKLDGFADCQFILSNHQRENLIEKLSLTIAEAELGNSSLLVEKE"
FT   CDS_pept        150584..152002
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000001061" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17436704"
FT                   /locus_tag="CAGL0M01342g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /biological_process="peroxisome organization"
FT                   /cellular_component="integral to peroxisomal membrane "
FT                   /protein_id="CAG62379.1"
FT                   /db_xref="GO:0005779"
FT                   /db_xref="GO:0007031"
FT                   /db_xref="HOGENOM:HBG203255"
FT                   /db_xref="HOGENOM:HBG540659"
FT                   /db_xref="InterPro:IPR006966"
FT                   /db_xref="UniParc:UPI00003B7015"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FK41"
FT                   /transl_table=1
FT                   /translation="MVQGRAPVSRRVQRYRGGLFIAAASVGTLVAVGSLAVYIVKQWLY
FT                   RQQLRIAEEHFVKEQIKRRFDQTQSDSLATLYELVQVSSMVYDQKDLNLDEIMLALRDK
FT                   KLQKQSQTGSAARAADTTSNSSVTGVTSALNDKVSEKASSIRSSKTDDIRNMTKGELWN
FT                   QLKIRSISKLVTVTYTTSCLLLMTRLQLNILTRKEYLETVVKTTMQKNNDAGNSSGFFS
FT                   WVASKIWGSPSNGEEKRKSAQDMYGELVQAEKAGKHMSKGKVEYINEQAFLSIFWWLIN
FT                   RGWSKIHEIVEREVRSEFGHLDPKDALTIDDFSERLTKVYYRVNKTLFLVNEEKEKPLL
FT                   DIMIPRTPQELKNVLEQAMDLESLQLLEQDDSILRQLCKEMEKYMKSEATSIVMEQAIN
FT                   ESFDYAITEIDASIKKRNQEETQMALFALSCKECCDKMLKTNMMTMDNDYLTVLDGIAV
FT                   LDDLSAMVYSNFGL"
FT   CDS_pept        153430..153969
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000172184" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18500873"
FT                   /gene_name="CBF3d"
FT                   /locus_tag="CAGL0M01364g"
FT                   /product="Centromere binding factor 3d "
FT                   /biological_process="ubiquitin-dependent protein catabolic
FT                   process"
FT                   /protein_id="CAG62380.1"
FT                   /db_xref="EMBL:AAD56717.1"
FT                   /db_xref="GO:0006511"
FT                   /db_xref="HOGENOM:HBG360223"
FT                   /db_xref="HOGENOM:HBG622018"
FT                   /db_xref="HSSP:1NEX"
FT                   /db_xref="InterPro:IPR001232"
FT                   /db_xref="InterPro:IPR011333"
FT                   /db_xref="InterPro:IPR016072"
FT                   /db_xref="InterPro:IPR016073"
FT                   /db_xref="InterPro:IPR016897"
FT                   /db_xref="UniParc:UPI000006A355"
FT                   /db_xref="UniProtKB/TrEMBL:Q9UVW8"
FT                   /transl_table=1
FT                   /translation="MDKKGKYVVLVSGEGEKFTVEKKIAQRSLLLKNYLNDMHESSLDD
FT                   EDEEQDEDEDEDDEIVMPVPNVRSSVLQKVIEWAEHHRDSNFPDEDDDDSRKSAPVDAW
FT                   DREFLKVDQEMLYEIILAANYLNIKPLLDAGCKVVAEMIRGRSPEEIRRTFNIVNDFTP
FT                   EEEAAIRRENEWAEDR"
FT   CDS_pept        155052..159335
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000001060" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17436705"
FT                   /locus_tag="CAGL0M01386g"
FT                   /product="Similar to uniprot|Q06681 Saccharomyces
FT                   cerevisiae YDR326c"
FT                   /protein_id="CAG62381.1"
FT                   /db_xref="HOGENOM:HBG203763"
FT                   /db_xref="HOGENOM:HBG253191"
FT                   /db_xref="InterPro:IPR004182"
FT                   /db_xref="UniParc:UPI00003B7016"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FK39"
FT                   /transl_table=1
FT                   /translation="MVDKKKKRSFSETGIFKLFKSKSRSKSSKSKSNLKGKNGHSSQRN
FT                   SRSKHKERTLSRPSVSDRKRLETESGDRTVSESHLLSSKLRKLGNHNHNHIHNNGNIEY
FT                   PEIRSIRSGGSRSFNDRYNDYNDYDDDDDDDDNNDNGNRDGLDNGHTDTMSDATEDGID
FT                   ISFKPRRSLQNSTAGLNRINTLQGYFNIPVTIDSHHTNSHNNNSGTRTNPISRKTSEFF
FT                   NSKNPSKTGTQSNLQETNHTQGILDTIVSFAQNAVGRVPKIVVNDPSAEEIVDSGDKDK
FT                   TTATNTLKANIPGITSNISSLSSVTTNRNGTSTSGRIPLKTEDDLLNGGEQHNDTVLHS
FT                   PLNEENRSSSFLKHLDYLLSPRTSDPLKEKSTPLADLAVDNKSENSVPKHDAKLPVANK
FT                   EQQRYSYNTVEEENKTMNSQGTNYTDKGLDPTKIKFQSHVGNHEPAIATFGRGNLTLDV
FT                   LIDHSNSDETIDNSESRVSFKNNNPNHPGMPIFNENYRNSSYIDVQRHLGLNKGNEIGR
FT                   GRSRTLPTNDASAVLDQKIEGDSKRNSRITTLSNDEIVGDNDRKPRSLSRKFLNRRSFS
FT                   PSIGSKVLPSMAFRNSMNKTRNSNDKMDTSKPRSSGVFSATVNSTQDTEYTKPFSLVGI
FT                   EYSSEKKNIEFHNIFKDAGVTPQERLILDHSCALSRDILLQGRMYISDQHIGFNSNILG
FT                   FVSTVFIPFKEIVQIEKKTTAGIFPNGIVIDTLHSKYIFASFISRDATFNLITDVWNQI
FT                   ILGRRYSDDTDQSDYSSRLNDLSDSNSLYNQLKDIDDDGGDDAALSDIDSTDMTSSEEV
FT                   EDIIGSGIGIKKTKGQIKSLSLGPSQHEPTSSGYKPTNNEKLVTEFLVEAPLGTVVNLL
FT                   YGENTKYITDILASMKSTDISPIPKLLGTSSRKFNYVKPLPGNIGPSKTKCFITETLDH
FT                   YDLEKYVKVSQVSDTPDVPSGNVFSARSVFLFTWDKDNNTKVVVYGCVDWKGKSWLKSF
FT                   IEKGTMDGILEVAKTTHHEIKTILNNQSSSEQSVEDNGDSAEEVIEESNLPKMGPLSHQ
FT                   PTEPPFSKESEDTVIEENVNFQAPLGTIFQILFGDDTSYIKKMIEKQNNFNLSEIPPFN
FT                   NKMREFTYTKRLANSFGPKQTRCFITEKIEHMDLNSYILVRQIVKSPDVPSGNNFAVHT
FT                   RTYLTWGNDNSTNMLVVTNVEWSGKSLLKGTIEKGSIEGQRVTTKQVIEELRDIIANAG
FT                   SSRKKLKKRSKTITSLKKVTSQPLEKKPDTVAQNMDSSANLLDQFVSFVMELDFTSLKG
FT                   IGFIIITVFLFFLLLRGLFFSNAKSATKIIRPGVIIIDGEEYSYVPNSKTIYNAYEKKI
FT                   GKFDYSFKSDDNNPVMESEFLIWDWLDDRTNGNSNNLSFRKQYKRGFKPVKTHKLQQLK
FT                   ESIKIAENELNEMKRLLNEEEELLL"
FT   CDS_pept        complement(159500..162646)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000001059" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17436706"
FT                   /locus_tag="CAGL0M01408g"
FT                   /product="Similar to uniprot|Q06680 Saccharomyces
FT                   cerevisiae YDR325w YCG1 Yeast Condensin G "
FT                   /function="binding"
FT                   /protein_id="CAG62382.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG058834"
FT                   /db_xref="HOGENOM:HBG396594"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI00003B7017"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FK38"
FT                   /transl_table=1
FT                   /translation="MTEVTTDGSDINSKIFGSIANVFQAAQLSYAGHRKHVAVLKKIQT
FT                   KAIAQGYEDAFNYWFNRLILAILPLKKTEVVGDRIIKLVASFIASLDKEIELAKAQGKP
FT                   LPNNAESAFTKFVDHFIRNILRGIESKDKNVRFRVVQLLAVIMDNIGEIDESLYELLTW
FT                   SLNKRIYDKDPNVRIQAVFCLTKFQAEDVGRENEPSNDLIAIEINESTKTLMSLIQNDP
FT                   SAEVRRAAMLNLISLPATLPYILERARDVNQINRRLVYSRILKAAGKECFTKIDTKILD
FT                   QLIKWGLEDREESVRAACKKLIHHDWLGLVDGDLIRLLEHLNVKDSTTCDKVLVCIFEK
FT                   HPEIIQKIKFSHDIWSNFTIEVAFLFRCFYLYCIQYNINEVLYDNFPEASRLAEYLQSY
FT                   INKAFKDNQSQSITDNDKKHLEFIIEQILMAADKYDYSDEIGRRSMLTVVRNFLGIKSL
FT                   SVTSIKIGIDVLKTLSINEKDFITMVIEMINDIRDEDIDMQEKEEKAAKRKSKKSKKLQ
FT                   KKKDKQSSTEVLVNKKNDDLGDAQSAKKDTTLETSTFDYADDDESSNEEESDNEDENEN
FT                   DGDDDDLDSFHSAVEGLVNGDSNTMNEADIMRKMLYEKEARPDTLILCLTRSGYMLELV
FT                   SSSIQENILIASLIDTLITPAVRNSEPTVRELGIKNLGLCCLLDAQLATENIYILGMCV
FT                   SKGNESLKMIALQVLFDIFALHGNVVVDGEGKVDSISLHKIFYKVLKNTELPSCQKIAA
FT                   EGLCKLFLADIFTDDDLFETLVLSYYTPANSANEELIQAFAFCLPVYCYSHINHQNRMA
FT                   RIGADILLRLCVLWDEFRYSDEYNDEKMTMLKPNIIFQQLIDWTDPRKIINRDEKDANA
FT                   DSSQIRFLLDVLKIVPQIEKSEIKRLLLNNINLVHLHHTQEYSTLKQLEDNIIDILEND
FT                   AIDQNQRNSLTRFKLSLQDVIEKTESKLDEHSDADTSTEQYSMILESSQVYSKPPTRND
FT                   EENCSDEDNAAALPSELNTKKRKRSESVENRDDTTNRTNRTDTSREGLTGENSDIMMSD
FT                   "
FT   CDS_pept        164428..166683
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000246731" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17436707"
FT                   /locus_tag="CAGL0M01430g"
FT                   /product="Similar to uniprot|Q06679 Saccharomyces
FT                   cerevisiae YDR324c"
FT                   /protein_id="CAG62383.1"
FT                   /db_xref="HOGENOM:HBG021931"
FT                   /db_xref="HOGENOM:HBG396588"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="UniParc:UPI00003B7018"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FK37"
FT                   /transl_table=1
FT                   /translation="MTMLVHRSRFVDFTPSNITALAFSHKSSAELTPSDLRLAVGRADG
FT                   NIEVWNPRHDWFQEMIIEGGQDRTIEGLCWCNVAGEPLRLFSIGGSTIITEWDLNTGLP
FT                   MKNYDCNAGVIWSIAINAAGDKLAVGCDNGTVVIVNIAGGPGIIEHDSILMRQEARVLS
FT                   LAWNGNDYVIGGCSDGRIRIWAAHEKDESRGRIINTMRVDKSKKESTLVWSVLYLPSKN
FT                   TIVSGDSTGSIKFWNFQYATLSQSFKSHSADILCLTTDAKESTIFSAGVDRKIFQYSLD
FT                   HSKKWLISSNRLLHGNDIRAMCAYQSKGADFLVSGGVDKTLFINPISSFADGRYRKMPF
FT                   VVPYNKNVLINNTQRLIVMWDGSVVKIWTMGTEVENEKNYKLVCKLVLKDEQKIHTCAM
FT                   SPDGQVLLVGRATTTKIFHLQPMENKLKVTKLSNDFLFTIGTKAAKFINNSKVVICNTD
FT                   DELLMLDLEEEDDEKPEYFELDEPQNTKSSLKIPYMNKINRIDANESAVVVSRYCGIVT
FT                   VINLKTKKSQNLLHLMNFVTSIYIHEQRKTVIVVTAENKIYELSLASIFREDTEDKEGD
FT                   EQADVTNEENSVFTAWSKRNTENIPKQLKDMRQKCLGVFASDEDSNKIWLWGSTWICRI
FT                   DMSKNLPVITRKKTKKHGRDGLTITDDSNYMNNNLEDEDEDVDMDIDEDLEILKGGKVK
FT                   SISNQKDPLTSEVFYFNDKYRHLLMADLLSSSELVVVERPPIFLKDQKAFQQPKLVF"
FT   CDS_pept        167313..168917
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000001058" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17436708"
FT                   /locus_tag="CAGL0M01452g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /function="zinc ion binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAG62384.1"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG060085"
FT                   /db_xref="HOGENOM:HBG203254"
FT                   /db_xref="InterPro:IPR000306"
FT                   /db_xref="InterPro:IPR011011"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="InterPro:IPR017455"
FT                   /db_xref="InterPro:IPR021565"
FT                   /db_xref="UniParc:UPI00003B7019"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FK36"
FT                   /transl_table=1
FT                   /translation="MQSSDVRPNDTQQEYSKLIQEENTKSSCPICFKECANLNELNKHL
FT                   DKDHNFGNENSNGDHVKKHQNKKKSSGIRTSHHEVYNEGMSKCAYCRKKLTKSNGVSNC
FT                   YHCGKLYCRSHLLWQMKLDKRARYDPQHGKFYPCCFKCTSSRPGYNDYGLTVSKTSEFS
FT                   RLRSSKMEDKQLRSLQLETRLLKLIDGYISISRKYGNNLFSTVVRNSELSKYERSIVHW
FT                   KDDSNVHTCNICTSEFGLVRLSRKHHCRLCGNIVCDTDGYEEEVINTRRRKTTMKKCSY
FT                   QIKLRNLKSSTDDLHYNSQLRPDEEYIAELQVRLCSTCIDNLLLKRKFKRDLTKPMPPL
FT                   LSRYETLHNIADVIRTILPPFQDALQKIDNERTKKVSDEKELADLSKLRVKLLRSFANY
FT                   NSVNKQLCSIKPSNFSEERVKNSLLVESSYFINENILPLRSLPAVLSGEDYVMSKSEPE
FT                   VKKLSELMSSDLSIKEIKQGREELMVLEEQIFQIESLVETAKRQRKFDEVATLATNLNE
FT                   LNQRATELREKLGQEGF"
FT   CDS_pept        170175..170609
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000178641" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21044345"
FT                   /locus_tag="CAGL0M01474g"
FT                   /product="Similar to uniprot|Q92317 Saccharomyces
FT                   cerevisiae YDR397c YNC2beta"
FT                   /function="sequence-specific DNA binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAG62385.1"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0043565"
FT                   /db_xref="HOGENOM:HBG435328"
FT                   /db_xref="HOGENOM:HBG748799"
FT                   /db_xref="InterPro:IPR003958"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="UniParc:UPI00003B701A"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FK35"
FT                   /transl_table=1
FT                   /translation="MIGDGDDVTLPKATVQKIISEVLDSDLMFNRDAREIIIKSGIEFI
FT                   MILSSMASEMAESDAKKTIAPEHVIKALKELEYNEFIPLLEQILIEFKGTQKIKEKKNS
FT                   KFKKSGLTEEELLQQQEELFRKSRSRLHQNSVSGSATDST"
FT   CDS_pept        complement(171045..173900)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093618" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18500874"
FT                   /locus_tag="CAGL0M01496g"
FT                   /product="Similar to uniprot|Q04175 Saccharomyces
FT                   cerevisiae YDR395w SXM1"
FT                   /function="binding"
FT                   /function="protein transporter activity"
FT                   /biological_process="intracellular protein transport "
FT                   /protein_id="CAG62386.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0006886"
FT                   /db_xref="GO:0008565"
FT                   /db_xref="HOGENOM:HBG059555"
FT                   /db_xref="HOGENOM:HBG396152"
FT                   /db_xref="InterPro:IPR001494"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI00003B701B"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FK34"
FT                   /transl_table=1
FT                   /translation="MLDERAILTCIGHTLISDAKVIKQAEDQLYEYQKQPGFTSFLLNV
FT                   VTDNSIAMNVRLSAAIYMKNKIQRSWNTTKYTEGLTKEEQASVKEQLVQTLIKFSESSH
FT                   LRPHLTESIRGILNADNSWDLTATVKELLTSGKQEYLYPGLLLVFEVAIVHRWDMSDNR
FT                   EVIDNFIIEIFPIVENITSQLVNQTDYRSNELLYLVLKSFKYSCLNNLPKYFADLDKLN
FT                   AWIQLHLFICQKPLPAEVLELDPSDRSLDKRVKVNKWGFGNLTRFLYRYSRSTKVITPE
FT                   FVNYVFTKIVPEIIQEYFKFIESWSNKSLWLGEASLYYMVQFLEKCMITNELFPLLEPH
FT                   LNVVLQHLIFPCLCATEESVELLYEDPEEYTRRYFDLNKDGSMADFASSDFVYMLGTVR
FT                   PDKLNEVLVFINEVFTNFSQHKGDKEWSFKQEGAMRMISTLFSLFQNPQDLEGMFSNYI
FT                   VNFLADDSHHFLVARALETVASYPYDINDMGTLSKLFEQTYGHFLNSDCLPIQVEAADA
FT                   LKSLVVLNPNIHGHISSQVPGIMEKLLKLSKEFEIDILSEVMESFVENFADELTPFAKD
FT                   LAVNLAEQFLNLGRSIVESTNGAYSTGDQDQETQACALLATMTTMVMSMNKVSLVEQFA
FT                   PVVKFVIVHAQISFITEIVDLMDSLALSSKALFNQFTPEIWEMFHDVMDSFQTYALDYF
FT                   ESYLVFFETIVLQGFPQDQTFVEPFLSLLSVKLESEIDYDVEGVMNLLTCFALSMKETP
FT                   FLEKALSRAMDEEFGLDDKQVIKMVLAYLFVKPIETLQVMESSGVTLNILKRWFDLKFK
FT                   SVFAIKLQILAIMSILKLPELPSCVSGYLKEFSNKLVTLVEQLPVAIRNREALNKGEEL
FT                   SGGADGTDLLDPQEEDEYLEEYDDDLKESILDQVNAFQEVSVFLTSLQSENPQRYQDII
FT                   SGMSDDKKESLQVILEFVSNN"
FT   CDS_pept        complement(174378..175595)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17436709"
FT                   /gene_name="SHE9"
FT                   /locus_tag="CAGL0M01518g"
FT                   /product="Sensitive to high expression protein 9 homolog,
FT                   mitochondrial"
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="mitochondrial inner membrane "
FT                   /protein_id="CAG62387.1"
FT                   /db_xref="GO:0005743"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG252679"
FT                   /db_xref="InterPro:IPR008839"
FT                   /db_xref="UniParc:UPI00003B701C"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FK33"
FT                   /transl_table=1
FT                   /translation="MYSYRYLRPVSRSGRAILIQRQAYLRNITFTHFRCEENKSSASKR
FT                   PTGNALNTKLNELNGSLNNLWNKFLEGRGVFQHHAKNIRKSIQEANKKIAEQEKESKDA
FT                   KINYKKDELTNEEIKDLPSERELHRKKWSRKLEFYLDSLQETLFTATKALNDVTGYSSI
FT                   QKLKNSINLINEKLDATRKARTDLKLQYTKAIESRTLSQKQLNELLQRKSSWSPSDLEN
FT                   FTKLYKDDAINQQTEKELKEKVRDIEKKEEQLTDDLYRAILTRYHEEQIWSDKIRRTST
FT                   WGTFILMGFNLVLFIIFQLLLEPWKRRRLTGSFEGKVRHALELHSQEQETKIRDFLEEI
FT                   KTKESNNIANEQKTITKLSFWDKLRNTFQNSTGLSLTQFNMLELTVTAINSFLVGILFT
FT                   LLLHAL"
FT   CDS_pept        complement(175916..176896)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000205281" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20195507"
FT                   /locus_tag="CAGL0M01540g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /function="DNA binding"
FT                   /function="RNA polymerase II transcription factor activity "
FT                   /biological_process="transcription from RNA polymerase II
FT                   promoter"
FT                   /protein_id="CAG62388.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003702"
FT                   /db_xref="GO:0006366"
FT                   /db_xref="HOGENOM:HBG051057"
FT                   /db_xref="HOGENOM:HBG333601"
FT                   /db_xref="InterPro:IPR003195"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="UniParc:UPI00003B701D"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FK32"
FT                   /transl_table=1
FT                   /translation="MDKHKYRVEIQQMMFVSGETTEPPLETTSLIEDIVRGQVVEILMQ
FT                   ANKTAQSRGVKSILPEDVIFLIRHDKAKVNRLRSYLSWKDLRKNAKDQDSNAPAGGGAE
FT                   EEDLGKKAGDKDEKDSSANMKVKKSQIKLPWELQFMFNEQPLENNEDADDIDEDEREAN
FT                   IATLKRLKMNDDRTRNMTREEYVHWSDCRQASFTFRKSKRFKDWSGITQLTDGKPHDDV
FT                   IDILGFLTFEIVCSLTETALKIKKREQILQNQKQQSQNIHQDVSLDKSAITRKKRLFDN
FT                   LDDEVNPLKPNHVEEAWRVLQMIDKKHRALTNFRGGRLSSRPIIL"
FT   CDS_pept        177667..178320
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000074706" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18500875"
FT                   /locus_tag="CAGL0M01562g"
FT                   /product="Similar to uniprot|Q04170 Saccharomyces
FT                   cerevisiae YDR391c"
FT                   /protein_id="CAG62389.1"
FT                   /db_xref="HOGENOM:HBG124177"
FT                   /db_xref="HOGENOM:HBG203280"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniParc:UPI00003B701E"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FK31"
FT                   /transl_table=1
FT                   /translation="MSEVKLNITRDVVRASETLYKAFDDSHAFDYITKKFFNLPVDEYV
FT                   SKDRINAITHYYVACYHDSNGEVVEANDYDAVAVFSLPNQHLPKSLTNDPHFNQVFFHD
FT                   LKSRLAEVIPEDIHYYYLFMIGKDLTRKDTKGSVRKIFEEYKKRADAENCAIVLEAIAE
FT                   HARSVYEYFGFKNYKTFHYGVGEVNEQGQPDPNGKGFTGYLMIYHKDGDKVLRE"
FT   tRNA            178619..178690
FT                   /gene_name="tRNA-Gly (CCC)"
FT   CDS_pept        178971..180869
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000216514" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17436710"
FT                   /locus_tag="CAGL0M01606g"
FT                   /product="Similar to uniprot|P52488 Saccharomyces
FT                   cerevisiae YDR390c UBA2 E1-like"
FT                   /function="ATP binding"
FT                   /function="small protein activating enzyme activity "
FT                   /biological_process="protein modification process "
FT                   /protein_id="CAG62390.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006464"
FT                   /db_xref="GO:0008641"
FT                   /db_xref="HOGENOM:HBG326381"
FT                   /db_xref="HOGENOM:HBG517846"
FT                   /db_xref="InterPro:IPR000127"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR009036"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR018074"
FT                   /db_xref="InterPro:IPR019572"
FT                   /db_xref="UniParc:UPI00003B701F"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FK30"
FT                   /transl_table=1
FT                   /translation="MAVRESNLVKILGDEGYQKLRSTKCLLVGAGGIGSELLKDLVLME
FT                   VGEIHVVDLDTIDLSNLNRQFLFRQKDIKKPKSAIAVNAVQSFSNSKLVPYQDNIMDTN
FT                   VFPLHWFQQFDIIFNALDNLAARRYVNKMTQFLSIPLLESGTSGFDGYIQPIIPGKTEC
FT                   FDCTKKETPKTFPVCTIRSTPSLPVHCIVWAKNFLFGQLFSSSANDIANEQMNEQDWGT
FT                   DDVEEINRIKNETNELKELQNIIISGDKSRIRDIISKLFIQDIEKLLLIENLWKTRAKP
FT                   VALTPKQLQESEQLGDVNHLNLNEIWDLETQIAKFTQITSKLMDRYNTESAIDFDKDDQ
FT                   DTLEFVATAANIRAHIFHIPVKSVFDIKQIAGNIIPAIATTNAIIAGLSSLMSLRVLNL
FT                   LKYAKVDKPTDINMAFTAKASNLAQNRYLSNPKLVSPNKKCAVCSKVIRGVFKVTKNQM
FT                   EKHSFMDFINALTSTSKLSDDISILDATTQRLLYDYDFEDLAEKKLVDLSLKNGSVLLI
FT                   TDEEEEAGLTKQIMEYYIEISDESEDKIEQLSLPQIIPQFSIPSETADENGGGDMLQND
FT                   SLMTSNDQTTPIVVSESDAVENGNNKRPLTEELEYQSIKSRKLNPIEDDDELVILD"
FT   CDS_pept        complement(181274..183079)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000789" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17436711"
FT                   /locus_tag="CAGL0M01628g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /biological_process="signal transduction"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAG62391.1"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0007165"
FT                   /db_xref="HOGENOM:HBG124178"
FT                   /db_xref="HOGENOM:HBG203279"
FT                   /db_xref="InterPro:IPR000198"
FT                   /db_xref="InterPro:IPR008936"
FT                   /db_xref="UniParc:UPI00003B7020"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FK29"
FT                   /transl_table=1
FT                   /translation="MPNKHSISPSRHMPFWKNFVNNPKSVSSENLSTPSRPVYQRGHSY
FT                   NHTAPKTGSPIKNEVGAAERQDFRDYRDQFLSGRNGFSGRVFGVSLEESLSVASAEVIV
FT                   QSELVSFGRIPIVVAKCGAYLKSNGLSTSGVFRIAGNSKRIKELQYIFSTPPDYGAKFS
FT                   NWEPYTVHDVASLLRRYLNNLEEPLIPLALYEKFRAPLMNRPRILKYMLNNEVSHPNAN
FT                   KENTLTMKLTESTKQDTDDRANDGDNENEDEQHITEEEAKRKQLRRKKKLSRCIRAAIK
FT                   EYEELFTDLLSDSKQLTIYLLDLLSLFARQSQLNLMSGSNLAAIFQPSILSHPQHDLDP
FT                   KEYELSRLVVEFLIEYTYKLLPHLLKSTKDDQQKKISESVHQKSTTESTTNRDKTSSPL
FT                   PNIQIQTETTTIKGTPDNSKTTSTATSQQNNIHSKPEAKSPALQVPKYQRPHSRSIGSA
FT                   PMVPDVIASNKRRSRLFPWLHKPGILSDTGDTATDGEGDDLLNDDENVDPHLSSPVHSS
FT                   NHRQHLLSIPKVQRSVSGRSITSNSSGRPLSLILNRSEDNLPKNGSSSTEKFERPRSPI
FT                   AYSQESIESKAKKRESWFARLTSRN"
FT   CDS_pept        complement(184085..185485)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000199510" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19348724"
FT                   /locus_tag="CAGL0M01650g"
FT                   /product="Similar to uniprot|P39743 Saccharomyces
FT                   cerevisiae YDR388w RVS167"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAG62392.1"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="HOGENOM:HBG053638"
FT                   /db_xref="HOGENOM:HBG334000"
FT                   /db_xref="InterPro:IPR001452"
FT                   /db_xref="InterPro:IPR004148"
FT                   /db_xref="UniParc:UPI00003B7021"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FK28"
FT                   /transl_table=1
FT                   /translation="MSFKGFTKVVTRAPQSFRQKFKMGEQTEDPVYEDAERRFKELEQE
FT                   TKKLSEESKRYSSAVNGMLNHQIGFAKAMEEIFLPISGKMSDPNATIPEDNPEGIEASE
FT                   QYRALVAELQQTLKPDLALVEEKVVKPCQELLKIITYIRKMATKRNHKKLDLDRHLNTY
FT                   TKYEKKSEKPDAKPKVEEKMYKAQVDMETAQQEYDYYNDMLKEQLPILFSLEAQFVQPL
FT                   FVSFYYMQLNIFYTLYNKFQDMKIPYFDLNSDIIEAFIAKRGNIEEQTDSLTITHFKIG
FT                   YSKTKLEMTRRRYGKDTDSASPTPGAYGAVGSTTPGYGQMQSPNATGYGGMQSPPATGY
FT                   GVQQPAMGPGAVGAVGAVGAVGAGAVGAGAMGYQQQAAPPAYTAMGAGAAVPQPPQQPM
FT                   AAPAPAGAPVETVTALYDYQAQAAGDLSFPAGAVIEVVQRTPDVNEWWTGRYNGQQGVF
FT                   PGNYVQLN"
FT   CDS_pept        186088..187731
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000202868" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17436712"
FT                   /locus_tag="CAGL0M01672g"
FT                   /product="Similar to uniprot|Q04162 Saccharomyces
FT                   cerevisiae YDR387c"
FT                   /function="substrate-specific transmembrane transporter
FT                   activity"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAG62393.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0022891"
FT                   /db_xref="HOGENOM:HBG534647"
FT                   /db_xref="HOGENOM:HBG744444"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI00003B7022"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FK27"
FT                   /transl_table=1
FT                   /translation="MVDENSNNENGLDQEEEIDVYSDLYSTYTQVTSLTTNDVDNTTYP
FT                   MTWKTVALFGSSTVGGLLFGYDTGVISGVLLSLKPQDLGRATISDWDKELITSITCLGC
FT                   FVGSLLGSPLADKYGRRITLAIFCVLFIVAALWMALASNLVLLVFGRFVVGIAVGTAAQ
FT                   CTPVYLCEISPAKIRGQILALNSIAVTGGQFLSYIFAYELYDVNGSWRILFGLSAVPAI
FT                   IFLSMLDFIPESPRWLVSMSKYDSAKAALRMIYPTASPGQINLKFNELVINLSKLKHYQ
FT                   DEQTSLMVPLSVRSSRVTINSADYGSVANLRSLHSLMNEPSGTNHSNKTVHHRMEPRTK
FT                   RALLIGCVLMFFQQITGFNAFMYYAPLIFSKLNSHNPLLPAMSIAFTNFLFTFLAVYLV
FT                   DLVGRRSMLLNTIWIMTVGLLLSTIGFQHENVVVLLFAVSIFVAAYASAMGTIPWSSVE
FT                   FLPLNRRSFGASCISCTNWLTNFVITASYLSVMNKIGTEDTMLFFALFSVMAWFFVYFW
FT                   YPEVKGLSLEEIGKVFENGIDVHYVYRNYY"
FT   CDS_pept        complement(187841..190675)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000040280" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17436713"
FT                   /locus_tag="CAGL0M01694g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /function="ATP binding"
FT                   /function="formate-tetrahydrofolate ligase activity "
FT                   /function="methenyltetrahydrofolate cyclohydrolase activity"
FT                   /function="methylenetetrahydrofolate dehydrogenase (NADP+)
FT                   activity"
FT                   /biological_process="folic acid-containing compound
FT                   biosynthetic process"
FT                   /biological_process="one-carbon metabolic process "
FT                   /protein_id="CAG62394.1"
FT                   /db_xref="GO:0004329"
FT                   /db_xref="GO:0004477"
FT                   /db_xref="GO:0004488"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006730"
FT                   /db_xref="GO:0009396"
FT                   /db_xref="HOGENOM:HBG181856"
FT                   /db_xref="HOGENOM:HBG677721"
FT                   /db_xref="InterPro:IPR000559"
FT                   /db_xref="InterPro:IPR000672"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR020628"
FT                   /db_xref="InterPro:IPR020630"
FT                   /db_xref="InterPro:IPR020631"
FT                   /db_xref="InterPro:IPR020867"
FT                   /db_xref="UniParc:UPI00003B7023"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FK26"
FT                   /transl_table=1
FT                   /translation="MLKFLRTNRYYHLLSGTKLSQKIIEQCRNEIDTIRKNHKFLPTLK
FT                   ILQVGNRLDSSAYVNMKLKKSEQSGVKCIVEKLPESITEFELLSKIEAINNDTSIHGLL
FT                   IQLPLPKHLDETTITSSVSVDKDVDGFHIYNAGELTKKNGHPKFIPCTPNGCIELLKEH
FT                   NITIAGKNAVVIGRSSIVGTPITSLLKNLDATVTQCHSKTVNLPEIVKTADIVIAACGQ
FT                   ANMIKGEWLKEGAVVIDVGINHVPDNTKKSGHRLVGDVDFDSASKKASYITPVPGGVGQ
FT                   MTVAMLVSNVVLAAKRSLANFEKVPEIKPLPLKLEKPVPSDFEISKSQEPKHIDNLAKE
FT                   LGIFQDELELHGHYKGKISTSILDRLESKKNGRYVLVAGITPTPLGEGKSTTTMGLVQA
FT                   LTGHLGKPSIANVRQPSMGPTFGVKGGAAGGGYAQVIPMDQFNLHLTGDIHAVGVANNL
FT                   LAAAIDTRMLHESTIKNDAKFYDKLVPKKNGIRSFSPAMTRRLERLGINKTNPDELTAE
FT                   EINKFVRLNINPDTINIKRVVDVNDRMLRKITIGQAATEKGRTRETGFDITVASELMAI
FT                   LALSTSLQDMKRRVSKLVVASDINGKPVTVDDIGCSGAIVALMTDTIKPNLMQTLEGSP
FT                   VLVHAGPFANISIGASSVMADKIALKLMGTCLDSQEPGYVVTEAGFDFSMGGERFFNIK
FT                   CRSSGLVPDTVVLVATVRAIKSHGGAPDVKPGQALPQEYIEENIEFVKKGVANLVKQIE
FT                   NVKKFGVPVVVAINKFSTDTENETKAIEESCKAAGANNVVVSNHWEEGGKGAIDLANAV
FT                   VQSCEEPKSFQFLYDTDLPIKEKLETIVKEMYGGAGIELSEKAQKQIALYTEQGFDKLP
FT                   ICIAKTQYSLSHDPKLKGVPQDFIVPIRDIRASIGAGYLYALAAEIQTIPGLSVHAGYL
FT                   NVEVDDKGNINGLF"
FT   CDS_pept        complement(192389..193696)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17436714"
FT                   /locus_tag="CAGL0M01716g"
FT                   /product="Similar to uniprot|P18412 Saccharomyces
FT                   cerevisiae YBR083w TEC1"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG62395.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="HOGENOM:HBG124179"
FT                   /db_xref="InterPro:IPR000818"
FT                   /db_xref="UniParc:UPI00003B7024"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FK25"
FT                   /transl_table=1
FT                   /translation="MTVSNDSSVSDRYNMNNSTSTSNVSSSNSTGSSNSSGHTQTTGSD
FT                   NKWPMDIESAFVEALGLIIKNGTSKIKIRDRNYGRNELISMYIWYRIGKYRTKKQISSH
FT                   IQVWKKSLLTKKKTGTLTNSNEIYVLDLIENGPQQTDESTRYFYTFFESIISTIMGNYP
FT                   AFAITHRPVLCPPNSTLPLPLPTGQQWFYAPQEGYYYQNQNSNSINYAGHQMTPNNGGN
FT                   QNQMDYMANDRNNIEINNMKLKSGSGMPMNTFNQRQQNVQQLPYPMISTQQGQNSHQFL
FT                   YHNGSNVDHKVPMSNTGNSANFNGNISSPQFNNSSNTPGVNNMHSNGSGFGMLYQYQQY
FT                   PNQSYYMQQSSLPIPPSIVQNSYTNNNTTNITTTPMSLPNVMSQFGQNGQSKTTNNLPP
FT                   PIRQPDILNKENKPLVKNEEINPYNEKKEVQGIQSN"
FT   CDS_pept        197743..201900
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000246697" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18500876"
FT                   /locus_tag="CAGL0M01738g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /protein_id="CAG62396.1"
FT                   /db_xref="HOGENOM:HBG059117"
FT                   /db_xref="HOGENOM:HBG398254"
FT                   /db_xref="InterPro:IPR001487"
FT                   /db_xref="InterPro:IPR006565"
FT                   /db_xref="InterPro:IPR018359"
FT                   /db_xref="UniParc:UPI00003B7025"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FK24"
FT                   /transl_table=1
FT                   /translation="MTIGNIYDLNFLLKLTNKLFENHTFDSYLTNQQLIVLNHILKHNE
FT                   LNSEIWPDFMSGNLRLKVKIDQTVEDKANQEQLQTTDGVAGSPKSTHIKKEDDFETNTI
FT                   NDDDEFTRSYDDEDLSKLDLDALKEQIDGAYFVGNLSLKVRYVLSQFGIENNLTDYLEE
FT                   GIDNTDKVESYGGESPTNANTEDNLFTSTDANEDGEDDDYDFDEDDEPNKEAESNDNAT
FT                   EEVVESDRTFKDSTTQCLTLEITISKNTLATYLNPNDIEEKILENSDKFFHSLENDRET
FT                   MLKKLKLQRSDQKITTDSDTIDLNGNNSDDNKGSIDDDDDDATIRVPKRQRNRDVTGDD
FT                   DDEEDDDDESKKDKEGNSPKKLKTLPTGLGIENLSLKHLLSRIQSNKNKLNISDYELKH
FT                   LLTEVRKNRSKWTSDERIGQEELYEACERVVMELRNYTEHSTPFLNKVSKKDAPNYHLV
FT                   IKKSMDLNTVLKKLKALQYNSKQEFVDDIMLIWKNCLTYNSDPSHFLRAHAIAMQKKSL
FT                   QLIPLIPNITIRNRADVERELEELEKDKDYKDNDDKEDAEEEVAGSGRKGLTMGAHKLA
FT                   KDSSATNNATNTDTNEETTKVINKMDIEVQKGEGEEKEGEVMPESDQSLSQDKGNDKII
FT                   ETETNFSKDDDKHLTPQSHNNTEEETKDQSEKMASESKTEIEEDSKINESSEENAGDKI
FT                   YSNASKTEQPQVTTVIEGETEDKGETEDKGEAEVPADEEEDDEEDDEDEEAQTFVVEKD
FT                   DDKDDVELSVWKSITANIRADICLKRSEYFKTGQLNSELDALLKDPERMKPFFQLYKEF
FT                   KDQKELEMFRLKMEQNSIMKNGFGTALVKQEDYSSIGGATNPSENQEGNDAYGKTYEGM
FT                   DLDSSTLLKEYDTMNYLPEFAYGGQDQQMLDQNEEDAVNRILELGMTKKSALLDNVGKG
FT                   LTPKVNSNISLIQEIRHICHKISLIRMLQNPYSTQFNKANPGQILNAHQYRYEKVNDDI
FT                   DIDPISQLHNHDYKHDKNVMWKVMHKNVSKIAMSNGFETTQPTAIDILTEIAGNYLSNL
FT                   TRSLKIHKETNSVNRMKPEEMLEAVLLENGINKPDDLYSYMESEFEKKTKKLKDVKAKL
FT                   ENFLKDLLRPTLQDLSERNFEDESQSFVTGDFASNLNGEDFFGFRELGLEQEFGILSNS
FT                   VPISLLSFQFQATDSETKEQVMKLQAEEIKDIVYEKVSKKDLQSDRFSPIVLSLLTQSY
FT                   EKTKSAIPKINKVVTAEAEKDNDDVTEEEPKTKPLEDNDDLLVMEDDELPVKTKMGSRL
FT                   RLPPTGKISTTYKKRPLADAFILPEEDPIDEINVNNDSDQVKVEDVPENNGTPMDNDRE
FT                   LDLQISENPLFDSPDIDNNSFGLNLEDNDIAVSNSSLNLKLG"
FT   CDS_pept        203616..208115
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000162078" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19348725"
FT                   /locus_tag="CAGL0M01760g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /function="ATP binding"
FT                   /function="ATPase activity, coupled to transmembrane
FT                   movement of substances"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAG62397.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0042626"
FT                   /db_xref="HOGENOM:HBG059517"
FT                   /db_xref="HOGENOM:HBG323792"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005285"
FT                   /db_xref="InterPro:IPR010929"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="UniParc:UPI00003B7026"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FK23"
FT                   /transl_table=1
FT                   /translation="MSLASDKKDADVASTTTTAQDDDNLSTYHGFDHHVQDQVRQLART
FT                   LTQQSSLHQKKEHTLPEEGINPIFTNTEADDYNPRLDPTSDEFSSAEWVQNMSNISNSD
FT                   PDYYKPYSLGCYWKDLVATGESADIEYQANFLNGPYKGLKTVYNTVVPSTASSKDKNFK
FT                   ILKSMEGAVNPGELLVVLGRPGSGCTTLLKSISSNTHGFNIAKESTISYSGMTPNDIRK
FT                   HFRGEVVYNAEADIHLPHLTVYQTLLTVARLKTPQNRLKGIDRETYARHLTEVAMATFG
FT                   LSHTRNTKVGNDLVRGVSGGERKRVSIAEVSICGSKFQCWDNATRGLDSATALEFIRAL
FT                   KVQASISNAAATVAIYQCSQDAYDLFDKVCVLYDGYQIYFGPAGKAKEYFQKMGYVSPE
FT                   RQTTADFLTAVTSPSERIINQDYINRGIFVPQTPKEMWEYWRASEDHADLIKEIDSKLS
FT                   DNYDANLAEIKDAHVARQSKRARPSSPYTVSYGMQIKYLLIRNFWRIKQSSGVTLFMVI
FT                   GNSSMAFILGSMFYKVMKHNTTSTFYFRGAAMFFAVLFNAFSSLLEIFSLFEARPITEK
FT                   HRTYSLYHPSADAFASILSEVPAKLITAVCFNIIYYFLVNFRRNGGVFFFYFLINIVAV
FT                   FAMSHLFRCVGSVSKTLSAAMVPASMLLLGLSMYSGFAIPRTKILGWSKWIWYINPLAY
FT                   LFESLMINEFHDRKFPCSQYIPSGSVYNNVPADSRICSSVGAIRGNDYVLGDDFLRESY
FT                   SYLHKHKWRGFGIGLAYVIFFLVLYLILCEYNEGAKQKGEILVFPQNIVRRMKKERKLK
FT                   NVSSDNDVEIGDVSDISDKKILADSSDESEESGANIGLSQSEAIFHWRNLCYDVQIKKE
FT                   TRRILNNVDGWVKPGTLTALMGASGAGKTTLLDCLAERVTMGVITGEVSVDGKQRDDSF
FT                   ARSIGYCQQQDLHLKTSTVRESLRFSAYLRQPADVSIEEKNQYVEDVIKILEMEQYADA
FT                   VVGVPGEGLNVEQRKRLTIGVELAAKPKLLVFLDEPTSGLDSQTAWSICQLMKKLANHG
FT                   QAILCTIHQPSAILMQEFDRLLFLQRGGKTVYFGDLGDGCKTMIDYFESHGSHKCPPDA
FT                   NPAEWMLEVVGAAPGSHANQDYHEVWRNSDEYQKVQEELEWMSNELPKKNTNNSETVHK
FT                   EFATGVLYQCKLVSLRLFQQYWRSPDYLWSKFFLTIFNNIFIGFTFFKADRSLQGLQNQ
FT                   MLAVFMFTVIFNPLLQQYLPSFVQQRDLYEARERPSRTFSWKAFIVSQILVEIPWNILA
FT                   GTVAFVIYYYAIGFYSNASVAHQLHERGALFWLFSCAFYVYIGSLALFCISFNQVAEAA
FT                   ANMASLMFTLSLSFCGVLVTPNGMPRFWIFMYRVSPLTYLIDGMLSTGVANVAIKCSNY
FT                   ELLRFSPAANLTCGEYLGPYLQTVKTGYIVDPSATDTCELCPYSHTNDFLSSVSSKYSR
FT                   RWRNWGIFICYIAFNYIAGIFLYWLARVPKKSGKLAKK"
FT   CDS_pept        208704..210980
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000198544" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17436715"
FT                   /locus_tag="CAGL0M01782g"
FT                   /product="Similar to uniprot|P18759 Saccharomyces
FT                   cerevisiae YBR080c SEC18"
FT                   /function="ATP binding"
FT                   /function="nucleoside-triphosphatase activity"
FT                   /protein_id="CAG62398.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0017111"
FT                   /db_xref="HOGENOM:HBG038904"
FT                   /db_xref="HOGENOM:HBG318848"
FT                   /db_xref="InterPro:IPR003338"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR004201"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="UniParc:UPI00003B7027"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FK22"
FT                   /transl_table=1
FT                   /translation="MFKLPGFGKASISHSPPDMSNVNIRPVTLCVTNCPNNTYALANVA
FT                   AVNPADLPDNIYIIVDNLFVFTTRHSNDVPAGTIGFNGNQRTWGGWSLNQDAQVKSFDL
FT                   FKYAGKASYLGTIDMEITFRSRNKAVATPFDQDELAAQFVANFESQIFSPTQYMIMEFK
FT                   GHYFDLKIRNLQAIDLGDIDSSAPVSSGIEVKGILTKQTQINFFKGRDGLVNLKSPNSL
FT                   RPRSNAVIRPDFKFEDLGVGGLDKEFTKIFRRAFASRIFPPAVIEKLGISHVKGLLLYG
FT                   PPGTGKTLIARKIGMMLNAKEPKIVNGPEILSKYVGSSEENIRNLFKDAEAEYKSKGEE
FT                   SSLHIIIFDELDSVFKQRGSRGDGTGVGDNVVNQLLAKMDGVDQLNNILVIGMTNRKDL
FT                   IDGALLRPGRFEVQVEIHLPDEAGRVQIFEIQTKKMRENNMMSPDVNLAELAALTKNFS
FT                   GAEIEGLVKSASSFAINKSVNIGQGATKIDPKNIAQLKVTRADFLNALSEVTPAFGISE
FT                   EDLKSCVEGGMFVYSERVNALLKHGARYVRQVRESEKSRLVSLLIHGPPGSGKTALSAA
FT                   IALKSEFPFIRMISPNELAGMSEAAKISYIDNTFRDAYKSPMNILVIDSIESLVDWVPI
FT                   GPRFSNNILQVLKVALKRKPPQDRRLLILTTTSAYSVLQQMDILSCFDNEIAVPNLSTL
FT                   DEFNNVMKEAQFLDDSGRMQVISQMQNAGTKINVGVKKVLTNIETARHDDDPVNELVEL
FT                   MTQSI"
FT   CDS_pept        211439..214294
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000246822" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21044346"
FT                   /gene_name="TIF32"
FT                   /locus_tag="CAGL0M01804g"
FT                   /product="Eukaryotic translation initiation factor 3
FT                   subunit A"
FT                   /function="translation initiation factor activity "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAG62399.1"
FT                   /db_xref="GO:0003743"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="HOGENOM:HBG028011"
FT                   /db_xref="HOGENOM:HBG382149"
FT                   /db_xref="InterPro:IPR000717"
FT                   /db_xref="UniParc:UPI00003B7028"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FK21"
FT                   /transl_table=1
FT                   /translation="MAPPPLRPENALKRADELISVNEKPAALQSLYEFITARRIRYATP
FT                   SQVEPIVFKFLELGVELKKGKLIKDALYQYKKLVHGSAEGLVSVGAVLRKFIDYVETKL
FT                   ASEQAKAEEKQKEEVSDDLEGGVTPENLLSSVYEADHSVAGFNDEALNSWMRFSWESYR
FT                   TALDLLRNNSQLEITYSGVVSRTMQFCLKHQRKNEFKRLAEMLRQHLDTANYHQSKFGS
FT                   NQVDLSDADTLQRYLDQRFQLVDASVKLGLWHEAYKAAEDVYHLMKMTTRKPKSSTLAN
FT                   YFENLVQIFLVSGDQILHTLAWKKYFELYSTNPNATEEEFKKIASTIFLSALSIQLDDL
FT                   PNVRYNYQSRSYRLLDVETKPTRKEVIQSIVEDDTIFSRVDAETKTLYEIMEVEFDGES
FT                   FKGKFEAILPKLEGESYFANYSVSLRDVIIRRMFVFASQKYEDISLNDLYSSVTFSSSF
FT                   KLSEWDIEKQLLQAAVDDYVSFQLDHEQNKVTFVKDPLVNFAAIKEEEVEEEEEEEEEE
FT                   EEEEKEAEGAEGAEGDTEEGQEAVAEPEPVIKRNYYIRKRLSELYEKLLEDTDYNTVSY
FT                   LDKVRIAREALIKHTKDTIEDMKKNSEERAKMHQERRRQHMESAAMNAEKDAEQRQKRI
FT                   MEERASIEAKLEEEAHRRLIEKKKREFEEVKQREIRKLVDELNAKGNGTKVEYDEVKDM
FT                   DIPDITKYFVNRLSKNKDELEERMNFAVKRMDHLERAYRKVELPLLKKQADELRATDEV
FT                   NFGNMKKKIVDAAKAEYEAKMEDYNRVSSVFDDYKTLRDRMLAAHNEKFAAIRAENAAK
FT                   LEAAKKARIEEVRKQRYEELLARSEAEKKAAEEAERRAKLDEIARKQREMEEALERKSA
FT                   ARTFTQPRAPVVPNANLDEIARKQREMEEAIERKLAGKSAAPAPAPAPAASTPAASTPA
FT                   APGKMSFAERMRLKRQQQQQK"
FT   CDS_pept        complement(215340..216605)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093252" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18500877"
FT                   /locus_tag="CAGL0M01826g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /protein_id="CAG62400.1"
FT                   /db_xref="HOGENOM:HBG398340"
FT                   /db_xref="HOGENOM:HBG429547"
FT                   /db_xref="UniParc:UPI00003B7029"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FK20"
FT                   /transl_table=1
FT                   /translation="MKVTSLVYAAMATSVLGQNSTSDDVPSGCSLGSSATATAQSDLDK
FT                   YSGCETIVGNLTITGALGSAALAGVKKIDGSLRIYNATSLGSFAADSVKEITGALNMQD
FT                   LTILTTASFGALEEVDTINLITLPAISTFNTNLQSANNIVVSDTSLESVEGFGSLKEVN
FT                   VLNINNNRYLNSFKSSLESVSGALQFASNADETAVSFDNLIWANNITLRDVQNASFAKL
FT                   ESVNASLGFINNTISTLNLTHLSKVGQSLSVVSNDDLTQLSFLNLTSVGGGLVVANNTN
FT                   LKTIDGLKNVQTVGGAIDITGNFTTLDLSSLKSVRGGATFNTVSGNFSCSPLKSLQSKG
FT                   AIQGDSFVCKNGATSTSISMSSRSRSSSASSSASATVTARSNDTASTSSTKTKKSKGAA
FT                   AQEVFPAGSFFGAVAAVAVALL"
FT   CDS_pept        217235..217690
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000722" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19348726"
FT                   /locus_tag="CAGL0M01848g"
FT                   /product="Similar to uniprot|P38247 Saccharomyces
FT                   cerevisiae YBR077c"
FT                   /protein_id="CAG62401.1"
FT                   /db_xref="HOGENOM:HBG124180"
FT                   /db_xref="HOGENOM:HBG204147"
FT                   /db_xref="InterPro:IPR020233"
FT                   /db_xref="UniParc:UPI00003B702A"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FK19"
FT                   /transl_table=1
FT                   /translation="MIHSRNVQALLDGMLGGCDVLEGTVPVPALHSVALLSADTGSIIS
FT                   FSKEHDLEHGPAEHDSLNNLRIMALLVKDKFSSDEKKSCEKGYDLDGGHRAYTYDVEDL
FT                   HASVTRIPDSDLLLMLLAHRDFPYGLLNMKLKACVKSFAQLYGYRLG"
FT   CDS_pept        complement(219813..220760)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21044347"
FT                   /locus_tag="CAGL0M01870g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /function="nucleic acid binding"
FT                   /function="zinc ion binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAG62402.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG124181"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="UniParc:UPI00003B702B"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FK18"
FT                   /transl_table=1
FT                   /translation="MIFESNPLNSFMLDDEERFKIDDYLDCFNDMSLPAIQNTTVIQPF
FT                   SMYNESYEKLFNETDSIISDEPSSVFELDTNSRRDTLKSEGFISLEHPDMLQKRDSDSQ
FT                   YHFKNELPYPRDEVVKMAEAYPPSLQKVEESVSPKSSCIQPADDETSNAFDEKFSAQAE
FT                   INKTSEDTKFICKVCLKKFKRPSSLSTHMNIHTGEKPYPCPFDNCTKSFNAKSNMLRHY
FT                   KLHFKLSNGAYILPTGEICAEKPTAKQLLQSSKRTSSRVQKKRKTSNTTTSTYVSDGYP
FT                   SEVDVSGSATPLNNDVLCKPYLNVLHQGGEASSI"
FT   CDS_pept        complement(228017..229039)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20195508"
FT                   /locus_tag="CAGL0M01892g"
FT                   /product="Similar to uniprot|P38246 Saccharomyces
FT                   cerevisiae YBR076w ECM8"
FT                   /protein_id="CAG62403.1"
FT                   /db_xref="HOGENOM:HBG124182"
FT                   /db_xref="UniParc:UPI00003B702C"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FK17"
FT                   /transl_table=1
FT                   /translation="MENWIENSSTLFNHNGNNLNLRQFRTYPEELLDTVEDDAHFFPSP
FT                   TNYTKKSSKYETLYLELDHLRPNCKHICGKNKLYLPRSFQHHKLTRMMRLSYESQSYEV
FT                   KKNFKCPPSACILESHLESDTSCNHYSSAGPIKRTDLINYRYLRSRDSRKEIMCRFCLG
FT                   VNWVDSTIYFKHLFLAHGIITRLDNTTDWYHINQKKNNITTIKLEDYMTFYVQEVKSSA
FT                   IQFTRNVLPHVVVRLLPIPSTYYSSIMGSGFRRTHVLCPNCNRYIRIGWCEHDEIIQRQ
FT                   YEDFESLNIQTFKEYSRISYIQTRNRQEIQGVYENYFVHYLECNFRDYDSTCLYIIFTD
FT                   "
FT   CDS_pept        232780..234810
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18500878"
FT                   /locus_tag="CAGL0M01914g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /function="binding"
FT                   /protein_id="CAG62404.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG124184"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniParc:UPI00003B702D"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FK16"
FT                   /transl_table=1
FT                   /translation="MSEEFSSWYGDVTRKCGSLAIDLGLSTLAFDQLVKLLEQEKHIST
FT                   ILLLVRLYLKNKDYYNVVTFLVNGRDNEILSDYRVWKAIALSYFKLNNVQDSLNAVDYA
FT                   LKLKSDDQDTLLLKARIMSFLDDSSLKTQYEALISSYSDKSSKEYYQILVCYMQYSRNI
FT                   GDIPKCFEIFQAISQEFSRTQKKRSINFLQVFSYAYQLYASTIYLTEGNINEAGRKRKR
FT                   GYNNDSPLEVINEFLSISERNYNSSLSIQPLKILQGQISFIEGIDLRESINYLNLELQI
FT                   LNNHAATLSEEGVYHKSILNYMIARNMLKLNPHENAQVAYEYFQNSLSLTPNLPFIWIS
FT                   VASLYLTLGQLEDSLATYSQAISLAMSFENVLPPKELSYYKRFAAVAWHGISQVYTVTL
FT                   QLTNAIEALDHAISIVYQEHDVTTEQELTSLRNEYVKLNSQSTPHPNIVYSLPEVSMKL
FT                   LLEYETCRDSFLFQNIDDLEIIDKNNLNDGAIKNFAGQVTTLTTQPPTDQSTLRVLNTA
FT                   NGTNSIAYTQKPPGSEVYTRKQSVTGTPSSAHAQQYGRNPQLSSSMSQTLNAPIQDVRT
FT                   IQQPNGQNIVVGNQILQQQQQQQYTTKQPFVVFNHATQKQELVTPQIVSTENGRYQPQH
FT                   VSMIQGLPQPNPNAYYQVNDGNVVLKPIQSMNNNEFITKVL"
FT   CDS_pept        complement(234892..237735)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093779" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17436716"
FT                   /locus_tag="CAGL0M01936g"
FT                   /product="Similar to uniprot|P38244 Saccharomyces
FT                   cerevisiae YBR074w"
FT                   /function="peptidase activity"
FT                   /biological_process="proteolysis"
FT                   /protein_id="CAG62405.1"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="GO:0008233"
FT                   /db_xref="HOGENOM:HBG059773"
FT                   /db_xref="HOGENOM:HBG397580"
FT                   /db_xref="InterPro:IPR007484"
FT                   /db_xref="UniParc:UPI00003B702E"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FK15"
FT                   /transl_table=1
FT                   /translation="MRFKALLRAIFRFRKTNFSILLIITYAIIIALLVFDRSRYKLDLP
FT                   NATSDKLRRNLLEQAWSDLQVITQSPHPYSSRNNDVVHDFLLQRVKNITRSNDNIYIDD
FT                   DYRNKSSILFHQPDVFNSTSKVSRVVYYESSNIIVKVVGSNNELPALLISGHFDSVPTS
FT                   YGATDDGKGIATMLSLLNHFSSSQPKRSVIFNFNNNEEFGLLGAYAFTYHPWIRDIEYF
FT                   INLEGMGAGDRAVLFRTSNVETAEIYKKAVKSRPFGNSIFQQGFNSRYIGSQTDYKVYD
FT                   EYGLKGWDISFYKPRDYYHTAKDSIQYTSKESLWSMLNQSLQLAIYISNEKLIKKSSSN
FT                   PAVFFDLLGLFFVVVDTKHLFYADIFMLIVGPILLMMKAHLDKRRRLERSRLVQLRLLL
FT                   SLGLSVVFLLLLTKSLNSFNPFVYSADYRTPLTGLFLLFVTVNYLIVTLAERLNPTESY
FT                   KTVAINQIFIIAWLMQLYITLRMAKSDFTLTGTYPLSIFSGCLIVALSLGLFGTKNKAV
FT                   NDAPNSSVRYASSQNDEDNPLPSQDRGENINQVRDTGNQEVTSNTNTDLHSNAEEVDER
FT                   MPLLSNNHIGDSGKMDKNSDFSKHYNWIVQFLCIVPISSFIFLFSLDYTLDAIHKMVQE
FT                   TTDDVQLICIIITIGVILLALPILPFISKLNYQSSVIIAIIGVLLFGKSLVMQPFSEIA
FT                   PLKVRFLQTVNQHDISKSSVSLFTAKDTPIKEMIYDLPSVKSQSTLVNCTVFGGSKICD
FT                   YYGLPPNLVDSEGNRQNKNLMKIEVLKNDNNDTQRSPYAPLSAEIKINVSENRVCSLAF
FT                   WSQSSKQSPVKKFSVIKSNNNNTNSVSNSIKYADGIDEVLIHKLDFNGAHHFSIEWLPN
FT                   IPFDLDYDPVIDGQGDNNIEITVACFTGEADSLSVVNGHPLKKIPAFDEVVKYSPKWYT
FT                   FTNRDRGLVVIKDKIQL"
FT   CDS_pept        complement(238113..240875)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000204521" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17436717"
FT                   /locus_tag="CAGL0M01958g"
FT                   /product="Similar to uniprot|P38086 Saccharomyces
FT                   cerevisiae YBR073w RDH54"
FT                   /function="ATP binding"
FT                   /function="DNA binding"
FT                   /function="helicase activity"
FT                   /protein_id="CAG62406.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0004386"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="HOGENOM:HBG522470"
FT                   /db_xref="HOGENOM:HBG716030"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="UniParc:UPI00003B702F"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FK14"
FT                   /transl_table=1
FT                   /translation="MQLPRYENKPFKPPRRIIPSGTVPRPVRSVGGSTASTFGVKRTYA
FT                   QTAELQPARSNDTSDRSKTDTTRRYFTIMYRKYTTKKNKTWNGDGYAILILDAAIKLII
FT                   YNEQGKPLGSSTKVNIDTLFDSIYTTKGLEFQLDYEIFDTDEIRKVRILLGKEPDSNLI
FT                   PSQTSSSQQNAIDKGISSELPVSQLFTKSTKKFISPTLKTNPNARPISSMNKQIAKTNR
FT                   PENTVPTQKFRSLFDCNTIENPLIMNTFQGSEVDIIVDPLLCKMLRNHQRIGVKFMYDC
FT                   LLGLETNLTAESTDDKSCRLERDSDIKGCILADDMGLGKTLMTITLIWTLLKQTPFASK
FT                   VQCSQLGVPLSGMISKVVIVCPVTLIGNWKREFKKWLGLNRIGILTLNPKNNVDMDKIS
FT                   VRNFIKVNRTYQVLILGYEKVLTVQEELLKQKDKLDLLICDEGHRLKNGASKILKVLKS
FT                   LDIDKKVILTGTPIQNDLNEFFTIIDFVNPGVLGTYASFKKLYINPISRARDINNKFNT
FT                   KVIEQGEEKSNQLIEFTKRFILRRSNNILSKFLPPKTDIILFCRPTIEQIKAFRDIIEN
FT                   VRVDMNNITFNTSLGLINLMKKVCNSPSLLCNDPYYQSNVDSNIFTVSNKSNSSGKLTV
FT                   LLELLLEIKATSPMEKVVIVSNYTQSLDIIQGLMNSNQLSNCRLDGATPAKQRDMLVNT
FT                   FNNNPNIFGFLLSAKAGGVGLNLIGASRLVLFDNDWNPAVDLQAMSRIHREGQKRPCYI
FT                   YRLITTGCIDEKILQRQLMKHNLTRKFLSSNTSDTGSANDDLFDKSDLKDLFTIHQNTK
FT                   SNTHDLICRCDGLGEEFDDDEEVLKAPALDGSFEQWSNALDAKRKMDVLESQRTQLEKK
FT                   LLKQCLLDYKHIDPDRSLDLYDDVATEVYKKGKKNITFAFIKVGNVIIE"
FT   CDS_pept        241386..243596
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17436718"
FT                   /locus_tag="CAGL0M01980g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /function="ATP binding"
FT                   /function="mismatched DNA binding"
FT                   /biological_process="mismatch repair"
FT                   /protein_id="CAG62407.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006298"
FT                   /db_xref="GO:0030983"
FT                   /db_xref="HOGENOM:HBG124185"
FT                   /db_xref="InterPro:IPR002099"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR014790"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniParc:UPI00003B7030"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FK13"
FT                   /transl_table=1
FT                   /translation="MIHVLPKETWQVLRADTQITGIDSVLRELLQNAVDAGASTVDVSF
FT                   SIKKNMCMVADDGCGMTRKDLDLLGRPHITSKIRNFRDLERFGNGNGTMGFRGEAIFAI
FT                   SQISELTMMTKHSDFRAHYWRDFPMTSVLTTEEDIRSSLHAQYLSTTPFYEDIWARSSG
FT                   TVVIVSDLFKYIPVRKKTLENVPVATITDSIREDFYQILVRNPNLKLNIFTFDDNYKNF
FT                   EFLNHVKEQYLHSLGSIPIHNAFIRVYGHVVPDPSIKIVKLSFREYNITGLISNCQVRS
FT                   KSFQFVFVNGRRYSNSEFLGKINRIFDQSTFATNAVEKDTRLGKRSARSYPLFVIKIDG
FT                   PAHVQDLIQSTSKDIIHLSDGKLINILILKVIYSFLKDQGFLTEIPTQLNDDNCDRIDQ
FT                   LGTLEEPIFMDNDFHRDFVIRNNVKMAKYNKVSHANISHPWKRQRLDYPVRRTSKWWKE
FT                   RSVNELHQSRISTKFAPIKKWAAYEKLHVFDYKDRFLSRSDDLKEVDVVNQVDQKFILL
FT                   RQKSARGNFELYIIDQHACDERIRLESFLKQYICDIMANALAVQKIFQSRIEIAISEKE
FT                   NFEQYRHEFSKWGIYYNVVHSNNNYSLDIFALPDMLADKIKANEELKDMMLQHIFDLKD
FT                   GSRSRIKTISSLDAQFLSGGWWSNVNKIPSFIRRFFDSKACRSAIMFGDTLNLQECRDL
FT                   VRRLNGCIQPNFCAHGRPSVVELIGHQHQWELKNFTADYDYD"
FT   CDS_pept        243827..244951
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000141976" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17436719"
FT                   /locus_tag="CAGL0M02002g"
FT                   /product="Similar to uniprot|Q12529 Saccharomyces
FT                   cerevisiae YPL165c"
FT                   /protein_id="CAG62408.1"
FT                   /db_xref="HOGENOM:HBG058099"
FT                   /db_xref="HOGENOM:HBG203868"
FT                   /db_xref="InterPro:IPR001214"
FT                   /db_xref="UniParc:UPI00003B7031"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FK12"
FT                   /transl_table=1
FT                   /translation="MTVTESYLQISEYFDINETSWGGRACFSKRDLNNGQVVLEVEDCM
FT                   GTSIDYDFRKEVCHYCYKYNNGKSMKVKISFNDLQDCLYEFPQLATYKAKFKGAGLWFC
FT                   CDTCRDKYLSIHNITELIESYEILLESFMRMIKNKSLLEEQEQDYNGITITKEYIDNTW
FT                   EDITTRWIPMVRKTKATKRAKFLPQISEDEYNCCRFVSETLFRIKHLDPGSDTLEAFHN
FT                   LQSNELSKIQKFPVLLNFQVLVFKTLFVLLPDNLKNSLTVQAFRHILGSEYGNAFGIWQ
FT                   DTEAVDSREYFGYWVFPKASYFNHSCDPNITKTRIDRKMVFTLNRDVACGEELNIDYSG
FT                   VLDLPVDRRQKFLFENWFFVCGCNRCNSDLKLVH"
FT   CDS_pept        complement(244928..245581)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000034148" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18500879"
FT                   /gene_name="ATG29"
FT                   /locus_tag="CAGL0M02013g"
FT                   /product="Autophagy-related protein 29 "
FT                   /biological_process="autophagy"
FT                   /biological_process="protein transport"
FT                   /cellular_component="pre-autophagosomal structure "
FT                   /protein_id="CAG62409.1"
FT                   /db_xref="GO:0000407"
FT                   /db_xref="GO:0006914"
FT                   /db_xref="GO:0015031"
FT                   /db_xref="HOGENOM:HBG203867"
FT                   /db_xref="HOGENOM:HBG252710"
FT                   /db_xref="UniParc:UPI00003B7032"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FK11"
FT                   /transl_table=1
FT                   /translation="MNSKNTIVYVKVKGKRPDGFVDPPVFEWNIQKEKKLWSLLSQLND
FT                   PDKEIDWALLAEGLDAPIYFLKRRCYELFTKHFELLRQQIDRKNKNALTDRSETPERDS
FT                   TEEITKEVNFLNQLPVRTPGTIQEEFNEDNGPKDKNKTPDTTKKAIEQLKSSRILNFKG
FT                   NKLDYNNREVGLTRYDSTYEKEGVHTEETESELSSSLGVSKSTLEEALMDKLQI"
FT   CDS_pept        245848..250293
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000194392" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21044348"
FT                   /locus_tag="CAGL0M02035g"
FT                   /product="Similar to uniprot|P14284 Saccharomyces
FT                   cerevisiae YPL167c REV3"
FT                   /function="DNA binding"
FT                   /function="DNA-directed DNA polymerase activity "
FT                   /function="nucleotide binding"
FT                   /biological_process="DNA replication"
FT                   /protein_id="CAG62410.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003887"
FT                   /db_xref="GO:0006260"
FT                   /db_xref="HOGENOM:HBG058097"
FT                   /db_xref="HOGENOM:HBG396797"
FT                   /db_xref="InterPro:IPR006133"
FT                   /db_xref="InterPro:IPR006134"
FT                   /db_xref="InterPro:IPR006172"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR017964"
FT                   /db_xref="InterPro:IPR023211"
FT                   /db_xref="UniParc:UPI00003B7033"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FK10"
FT                   /transl_table=1
FT                   /translation="MISGEETDSIQDGANEVEFDSFDLQLNNYDHYMAYPTSLDRTHGS
FT                   SLPLKKFHKVPVIRIFGCLRTGHQLLCHVHGIFPYFFVKYDGKEDDTSIIINEKCAKLH
FT                   QLLEQILRDKMKSKGSRNDKQDETNLNELVYIANVSVVKGVPFYGYHVGWTPFYKISLL
FT                   NPSLSEQVCNIIREQNVLQNGQNEVYESQFPYLLKFTADFNLFACSWINFKKVYFRAPV
FT                   LNEMLNMDEIMMTKELRVLLDRFHSKDTVLKKTMFPRIGNGLLEIDVIPQFIKNIDQIK
FT                   IRNIHHDLSEKKESVNYLDDGPYVSSTKNMLKDVEIQRKLYSLEEYKKAADISRNENDM
FT                   IWNSSHQFEMFLRKALSSVKVSDKDSNFLSGHFNANDFLKTPFEMIDELWPTKFESSID
FT                   LNDENERHDKNDQLLDVGEDFDKAEERDEDILGEPNEDDYIEKEMHSQDNGQFINVSTS
FT                   VISTTQSLDKLLTQSIVKNQRKLKIGNVLSDLGNVATNYHNYFPSNIKKYYRYKQCNIS
FT                   YSSMNEDLQDNGLPINDYMGPFFSDPCDLHKKDYQYAGKQFDITSTHLMKRYPLDFKED
FT                   LVRLTKQRLDNDVLFASWKYLKMPPSFNDVAESVTRKERARHSISQIKKPTATKSLGNT
FT                   SSIKRSESIHDNLTHFSLEIHVNTRGDLLPDPRKDEVSVIFWKVDSDTFPFSIDLQLEG
FT                   IMYTNKLERENLIETLESISGGVPIMEYEDEFSMFDALTDLILLFDPDLLSGYEIHNSS
FT                   WGYIFERSLSVHKFNIANEISRVNMGAQFKLRDSWGFKKSSGISITGRYVLNIWRLLRK
FT                   EIAVTQYSFENMVHLLLKIRLPKYSCSHLTSLWSNFKTGNELKTFLNYYLTRVRLNIGI
FT                   LKKISFTLNVMEEARLIGIDFQSVYNRGSQYKVESFLIRICKSENYILLSPSKVAVQKQ
FT                   KPLECVPLVMEPESAFYKSPLLVLDFQSLYPSIMSGYNYCYSTMMGRVRELDGTKRTLG
FT                   VTNFELKSELLKKLRDDIRIAPNGVIYAKEHLRKSTLSKMLSEILEIRFMIKKTISDLG
FT                   SDHQALKKLLESKQLALKLLANVTYGYTSASFSGRMPCSDLADSIVQTGRETLEKAVKM
FT                   IESTASWGAKVVYGDTDSLFVYLPGKTKEDAFRIGAEISNSITASNPKPITLKFEKVYF
FT                   PCILLSKKRYVGYSYLSSSQLNPHFDAKGIETVRRDGTPAQQKVVENALRILFETKDLS
FT                   KVKNYVVDTFTKIRSGNISIQDFCFAKEIKLGHYKSESTMPPGAVVAKRLKKQDSRAEP
FT                   QYKERLSYLVVKGKSGQILRERCVSVSEYFSNDHFALDSEYYITKTLIPPLDRLFNIVG
FT                   ISVSDWNQEGPMFVEGSIKPYTGADNIPTSTRCKACEQNTVSGDSYLCDNCVSNEKMAA
FT                   SKLIIKIQASASKLKVLNDICRICSRQYTGDMGLLSSNNALKCVSYDCPNYYSKLKAQR
FT                   LMQSKHYYSWNELLHNMDHW"
FT   CDS_pept        complement(250402..251271)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093572" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19348727"
FT                   /locus_tag="CAGL0M02057g"
FT                   /product="Similar to uniprot|Q12042 Saccharomyces
FT                   cerevisiae YPL162c"
FT                   /protein_id="CAG62411.1"
FT                   /db_xref="HOGENOM:HBG271741"
FT                   /db_xref="HOGENOM:HBG346941"
FT                   /db_xref="InterPro:IPR022127"
FT                   /db_xref="UniParc:UPI00003B7034"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FK09"
FT                   /transl_table=1
FT                   /translation="MGPIKPGMDNCQLLGPASLLVQCLMGISALALLLFKRNHEHPRRK
FT                   MEIWLFDIGKQIIGALGIHFINVGISVLKRHHEKKAYLFISIIGNLIESVSSTREDDGS
FT                   DEQCDWYFLNLLLDTTVGIPILWLAINCITYILQYLNIKNVESGNYFAEEENDIESQES
FT                   EQPLITAFFKQLGIFTSSLIVMKICVYLVLNYFEDLAYWFANLILSWSDRWPDLQVTLV
FT                   MFVFPIILNCFQYFCVDNVIKLHSDDVNNYNSKSFEPEEVIQEEYTNLISGAQKKDKNK
FT                   QSAYETIS"
FT   CDS_pept        complement(251658..253472)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17436720"
FT                   /locus_tag="CAGL0M02079g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /protein_id="CAG62412.1"
FT                   /db_xref="HOGENOM:HBG124186"
FT                   /db_xref="UniParc:UPI00003B7035"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FK08"
FT                   /transl_table=1
FT                   /translation="MDYETLLFELKPLLDIEQLKVANIDESNVQVYTSALEKCSQGARI
FT                   ESNRTIIGRSGLLDSLTESLAFLLEQEFTVDTQSNKNILLIISEIVRVLANSFADNDDN
FT                   RNIFFDKNRFLANPIIETYFAKVLALNLQQNDPDVIITLQMRLAAMVKNLIVDNRNYVT
FT                   HYAAFLCPTSYLRLDSINLTSENEVQMALFIAELIDAILEFDKKGATLDEMKIVSTLYY
FT                   QLSTYITSASVEIDDGDDEEPLIELLATLTNIAEIVFSIDGTFNFDKQQETKDIIQKNI
FT                   LQTIDNLEELKFHNKLIIMRRLVTTSGYIASDKSNTTHSEMNMCLNHLRNENPSPYTIG
FT                   AIFINITNAIRSTEESKELEQTLSIPDIICYSKKLSDPVQFQGVLDLLKKVLNLSNTLL
FT                   LPNDSLQGIANLLTYSNEQAQYFQGLIPLVNGLLNKLLTVIPSSKIEFIFQGNISEGFV
FT                   KLICKNGSISASLALDKLLLVKNPIKKDITDRLWECLFHFDQVAKENNTSESANVYLLF
FT                   QVAKTLGVYLRNTIDKPTEIQDFLLYQYEDQLVFLLSQILDLRDKNVRGSESAMNNGKF
FT                   VAGLIIDAKKSVRTTDDDRLLAICKQFF"
FT   CDS_pept        complement(254024..254827)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17436721"
FT                   /gene_name="PET20"
FT                   /locus_tag="CAGL0M02101g"
FT                   /product="Protein PET20, mitochondrial "
FT                   /cellular_component="mitochondrion"
FT                   /protein_id="CAG62413.1"
FT                   /db_xref="GO:0005739"
FT                   /db_xref="HOGENOM:HBG124187"
FT                   /db_xref="InterPro:IPR014804"
FT                   /db_xref="UniParc:UPI00003B7036"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FK07"
FT                   /transl_table=1
FT                   /translation="MSVSLVLCTWGGAARTARVYRVVKQAMIRTMFVRLRSAGQVRYQS
FT                   SFSFPSSQSLLQKGQLGKKKRSVRKLGLGISDKKQYNSGVTSAAQEAGGAVRDLKSEKA
FT                   QTKKKVYDYSTLPRVEQISDTKLKNMSTEVLYSGYRPLFFDVEPKNSQEGKTLYEFAMK
FT                   LEEFQEAMSPWVSSATGSEMYAEWDNVPGDVIKDLKPFTPPVVNSRKLNGATGENANDF
FT                   DEQGNFQKKAFFDKVQSILNRNGKGGRKRPGVTVLKHLKKLKEQN"
FT   mat_peptide     complement(254027..254695)
FT                   /gene_name="PET20"
FT                   /locus_tag="CAGL0M02101g"
FT                   /product="Protein PET20, mitochondrial "
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FK07 "
FT   transit_peptide complement(254696..254827)
FT                   /gene_name="PET20"
FT                   /locus_tag="CAGL0M02101g"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FK07 "
FT   CDS_pept        complement(255200..257236)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000142325" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17436722"
FT                   /locus_tag="CAGL0M02123g"
FT                   /product="Similar to uniprot|Q99299 Saccharomyces
FT                   cerevisiae YPL158c"
FT                   /protein_id="CAG62414.1"
FT                   /db_xref="HOGENOM:HBG103839"
FT                   /db_xref="HOGENOM:HBG124188"
FT                   /db_xref="UniParc:UPI00003B7037"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FK06"
FT                   /transl_table=1
FT                   /translation="MSGMIIRTPTRTKTKSFNGKQMDFTFPSPVRGSVDEHSLDNHRIV
FT                   NETLSLKPQEDIEVSSQMLSDYTSSASNANTYSGNSSNGYYSFANISDNTTASPKLHNH
FT                   NNMVSPILENTESSFQLQTVESLDPQRQRIRSTYEYGHMGSNQNLRQTREKSKTAESIS
FT                   TTIAQQTIPTADNISFDFSDISGYEDAVSNKSENKNHKPQNSVVKNQLRATSRAAISTN
FT                   DSPSLSNVYMSSLINSSLESTRKTSTASSSVRSSRSSLKRSNAVRCKGGLLQYFTKLGI
FT                   KIRKNCNKLRLVMRRKLFRFKKNSKSFSRSNSIRSGLEISKLPKVRHEKKLRQESSSIA
FT                   PHTLHQKRTHGFNNKLHKSMSLKSLQPALVSETVPEINNNLHDILESKEKTADVPAATK
FT                   TMKTTPSLRRTPSSIRRAASILTSNVATPKASANNRNSMIEYDTVENSRISSRNSSIKS
FT                   KGRLVRSSGSVGLSSIARQPSIVVKNKVIPLSMSRFSIKEEIKEEEEESEESTSDYYVE
FT                   TEPVEAAPRTLAGPKSYAPENFRYGANVDDIKTLYKHYLSTVISRRIKMRLEMAQGEHS
FT                   ATNEPALTHQSTASLKDPIASVLTEYDSEGSEGTNLFDDEDDSSASEEDDEVVLPPLKG
FT                   HNSTMSFVVQSPFTRQNSMASSSALLYLPVKRSLTLPIGMKIT"
FT   CDS_pept        257734..258735
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000216181" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21044349"
FT                   /locus_tag="CAGL0M02145g"
FT                   /product="Similar to uniprot|Q12052 Saccharomyces
FT                   cerevisiae YPL157w"
FT                   /function="methyltransferase activity"
FT                   /biological_process="RNA capping"
FT                   /biological_process="RNA methylation"
FT                   /protein_id="CAG62415.1"
FT                   /db_xref="GO:0001510"
FT                   /db_xref="GO:0008168"
FT                   /db_xref="GO:0009452"
FT                   /db_xref="HOGENOM:HBG056553"
FT                   /db_xref="HOGENOM:HBG746676"
FT                   /db_xref="InterPro:IPR019012"
FT                   /db_xref="UniParc:UPI00003B7038"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FK05"
FT                   /transl_table=1
FT                   /translation="MGPGLAVEIRRGLTATTMAHRKWLVRGSDLRKDILRKSSKRYRKY
FT                   GRSKKCFKELVQLLLKDEFLVDNNKPPSSKAGTQKELVKYWRKRRTLFSKVNSMPIYMT
FT                   SELWFSVTPERIARFLANFISACLPNAKRILDVFSGGGGNSIQFANVFDRVYCLDSNLE
FT                   HLYCSIKNGQSYGVSNKLWMCKGKWGEHTAKKFRKLNIDCIFGSPPWGGPEYIKDEKYD
FT                   LEKSLLPFGLYKLLKTFKIVSDNIILFLPKNSNLDQLSETTKEVFGPEAKCKVLYIKEQ
FT                   GYLKGMLCLWGSAFTNYQQDTASDSEEEEGEELNESDKSKNANIYINYDIDG"
FT   CDS_pept        complement(259132..259833)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17436723"
FT                   /locus_tag="CAGL0M02167g"
FT                   /product="Similarities with uniprot|Q12498 Saccharomyces
FT                   cerevisiae YPL156c PRM4"
FT                   /function="electron carrier activity"
FT                   /function="protein disulfide oxidoreductase activity "
FT                   /biological_process="cell redox homeostasis"
FT                   /protein_id="CAG62416.1"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0015035"
FT                   /db_xref="GO:0045454"
FT                   /db_xref="HOGENOM:HBG124189"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="UniParc:UPI00003B7039"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FK04"
FT                   /transl_table=1
FT                   /translation="MSKEKADNIQWTRAKRGLGGTVFVLVLLLLTFGNVLGIFSTDIPI
FT                   QSIIASTDSLNSNALIGKASVNSIKKESNNLNSVAHTSMSSSSVAKDGTVIEYDPEKNF
FT                   KQIINTSPAVLFIRSSEYESNILRKLLTRDYEITPELAIVDLDKHDHDVLLERHILSHK
FT                   IKSTKVEVLKSTSVKQAKAPYLFINGHSLINNGIADDILKFHEKGQLLTKLKAFAGENI
FT                   VFNKRDLPSNS"
FT   CDS_pept        complement(261290..263308)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000000988" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20195509"
FT                   /locus_tag="CAGL0M02189g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /function="ATP binding"
FT                   /function="microtubule motor activity"
FT                   /biological_process="microtubule-based movement "
FT                   /protein_id="CAG62417.1"
FT                   /db_xref="GO:0003777"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0007018"
FT                   /db_xref="HOGENOM:HBG396482"
FT                   /db_xref="HOGENOM:HBG525807"
FT                   /db_xref="InterPro:IPR001752"
FT                   /db_xref="UniParc:UPI00003B703A"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FK03"
FT                   /transl_table=1
FT                   /translation="MSASRDSEKYRFETPRVMKSPSPSLDSAVSISSYARSRSSVTRGF
FT                   RNGSSSGSSSRSSSPLRPGSFGGDPYLQYGKIRNRSESSSYENGSGNLDKYTGTIKVVI
FT                   RPKPYPTEKIVSWKIHGDKVISHNDIGDFTFDHVFSTGCSNFDIYGKTTQPLIDRLIEG
FT                   YNATIFAYGMTGSGKTFTMSGTEEEKGLIPLSVSYLFSSLLEKTNTENEKSEVWVSYLE
FT                   IYNEKINDLLDVASGSNVQNTPSRLFTSTHTSSSGDLKIRDDSECGVRVVGLTQKRCDT
FT                   SEEVLDWINKGNKNRKTSETEFNTRSSRSHAIVMIRLISKDIRTGEQNIRTLSLCDLAG
FT                   SERGVGQNERRKEGAFINRSLLALGTVISRLSAENNGSHHTGRAANSQQSLASPNGSSS
FT                   GNHIPYRDSKLTRLLQPALSGDSVVVALCTIDLAHESSSETLNTLRFASRSKNVALDVS
FT                   RVYKRINRSAHPFSSPSKLDGGDDRSEQRIQELLIQLQTRDRELAKLREVSAGVASGTM
FT                   NGAQQNLHPDTQLLTKENLLLKNKLKHYESLLVEDGMGVSGASTRNTSNSSSSSTLVSS
FT                   SPALDNKGRYAGTNSTGVDAELEEIAQLLPSEVAVMLETKFDNLRRQLQSAHRYSESLE
FT                   KQLNDSHTETEQLKRSLQTKDKLIEALTSAKRLQQQQ"
FT   CDS_pept        complement(264202..265449)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000197681" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17436724"
FT                   /locus_tag="CAGL0M02211g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /function="aspartic-type endopeptidase activity "
FT                   /biological_process="proteolysis"
FT                   /protein_id="CAG62418.1"
FT                   /db_xref="GO:0004190"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="HOGENOM:HBG252945"
FT                   /db_xref="HOGENOM:HBG590923"
FT                   /db_xref="InterPro:IPR001461"
FT                   /db_xref="InterPro:IPR001969"
FT                   /db_xref="InterPro:IPR009007"
FT                   /db_xref="InterPro:IPR021109"
FT                   /db_xref="UniParc:UPI00003B703B"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FK02"
FT                   /transl_table=1
FT                   /translation="MRLSLSVLMPLALMLLGDYADAKVFQAELKKEKLTKEMLELGFEA
FT                   HVQQLGHKYVSQYEKANPGTVLPRDHLFYPDQVHNVPLSNYMDAQYFADISLGTPPQKF
FT                   KVILDTGSSNLWVPSVDCGSLACFLHNKYDHSQSSTYIKDGRPLSISYGSGSIEGYISE
FT                   DNLQIGDLTIQNQKFGETTSEPGLAFAFGKFDGILGLAYDTIAQDDITPPFYSAIQQHL
FT                   LDESKFSFYLKSVNDPAAEGGSASDGGVFTLGGVDSSKFKGDLIPLHVRRQAYWEVPLN
FT                   AIKLGDQSTGKLENTGAAIDTGTSLITLPSDMAEIINAQIGAKKGWTGQYTLECSTRAK
FT                   LPDLTFTLDGHDFVLSPFEYTLEVSGSCISVITPMDFPEPIGRMAILGDAFLRRYYSVF
FT                   DLDANVVSLAEAVHSA"
FT   CDS_pept        complement(267332..269635)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000074515" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17436725"
FT                   /locus_tag="CAGL0M02233g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="CAG62419.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG058433"
FT                   /db_xref="HOGENOM:HBG396675"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR016256"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="InterPro:IPR020636"
FT                   /db_xref="InterPro:IPR020648"
FT                   /db_xref="UniParc:UPI00003B703C"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FK01"
FT                   /transl_table=1
FT                   /translation="MMETQPTQQATQATQKYLIDNFTQEQIKKNSVYRVICTSGQIPIK
FT                   DMEVDVEQIAKKKESIKKIWTFGRNNACDYHLGNISRLSNKHFQILLGEDGNLLLRDIS
FT                   TNGTWLNNQRIEKDRNHLLSQGDEITVGLGVSSDIISLVIFINEKFRDYLEEVRQELSS
FT                   QGLKVSSKSNANPNINLTGIYKDFSINDEVVGTGAFATVKKAVERNTGKTFAVKIINKR
FT                   KVVGNMDGVSRELEVLQKLNHPRIVSLKAFYEDEANYYMVMEFISGGDLMDFVAAHGAV
FT                   GEEAGREISRQILEAIQYIHSKGISHRDLKPDNILIEQDDPVLVKITDFGLAKVQGNGS
FT                   IMKTFCGTLAYVAPEVIGGFTGATGEEETEEERIEYSSLVDMWSMGCLVFVILTGHLPF
FT                   SGSTQEQLYEQIRKGSYHEGPLKDFRISDEARDFIDGLLQVDQSKRMTVDDALNHPWIK
FT                   QCSSQFDANSMSSQVSLSQSMSQQKALESLDDAQYEFLKAQKKLQQDEPINDKLKDFKV
FT                   PTQPPTRFTQPKVINPIENIKKYTKSVKKKGSGKFMTFKPLPESVIQESFEIKQGINPF
FT                   FIGRSDDCNCRIDDNRLSRVHCFILKKRHPIGKSIYESPAQGLDDIWYCHSGSNDSYVN
FT                   DIRMTPGKKYLLQEGDEIKIIKDKQKDFVIGFQVELNDTTGLFNNGLGIPNEERSVTSQ
FT                   TEDELKLVSRLAKIMAAQRSSTKEANETMDQNRNLLKKVHSVSLSQSITDPSRKVKRAK
FT                   LDQTDHNAENMQFF"
FT   CDS_pept        270614..271690
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000205736" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17436726"
FT                   /gene_name="RRD2"
FT                   /locus_tag="CAGL0M02255g"
FT                   /product="Serine/threonine-protein phosphatase 2A activator
FT                   2"
FT                   /EC_number="5.2.1.8"
FT                   /function="peptidyl-prolyl cis-trans isomerase activity "
FT                   /function="phosphatase activator activity"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAG62420.1"
FT                   /db_xref="GO:0003755"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0019211"
FT                   /db_xref="HOGENOM:HBG191557"
FT                   /db_xref="HOGENOM:HBG526297"
FT                   /db_xref="InterPro:IPR004327"
FT                   /db_xref="UniParc:UPI00003B703D"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FK00"
FT                   /transl_table=1
FT                   /translation="MIPSKRILTDKDVKIWEESETREDILSFIESLAKAVEGFENDQVS
FT                   EPVSDSVQSTIAVLTEIDKLIKLHPVIQDKNTSRFGKVEFRDFYDDVCEKADDLLSSHF
FT                   PALTSEQIEQLSIYLQESWGNKRRIDYGSGHELNFICFLYGLTHYKIFDLQRDARNLVL
FT                   VLFIEYLKIMREIETLYWLEPAGSHGVWGLDDYHFLPFLFGAFQLAPHKHLKPKSIHNE
FT                   ELVEMFADKYLYFGCIAFINSVKTSTSLRWHSPMLDDISGVKKWSKVAEGMIKMYKAEV
FT                   LGKLPIMQHFYFSEFLVCPEGISEPRTHIHNGDEDDDQCCQDGAAHNTWGDCCGIKIPS
FT                   LYAANAMEKQSHKPIPFD"
FT   CDS_pept        complement(271836..273119)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000207595" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17436727"
FT                   /gene_name="PRP46"
FT                   /locus_tag="CAGL0M02277g"
FT                   /product="Pre-mRNA-splicing factor PRP46 "
FT                   /biological_process="RNA splicing"
FT                   /biological_process="cell cycle"
FT                   /biological_process="mRNA processing"
FT                   /cellular_component="cytoplasm"
FT                   /cellular_component="spliceosomal complex"
FT                   /protein_id="CAG62421.1"
FT                   /db_xref="GO:0005681"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006397"
FT                   /db_xref="GO:0007049"
FT                   /db_xref="GO:0008380"
FT                   /db_xref="HOGENOM:HBG021649"
FT                   /db_xref="HOGENOM:HBG630928"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="UniParc:UPI00003B703E"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FJZ9"
FT                   /transl_table=1
FT                   /translation="MSIGDELVDADEVYRQARWKNQFEVLSKLPRVLQERVDAQKPVIE
FT                   ASGNSATPSNASRALVRHQQNPGDVGLVLNKKFADEQGHESVIERHDKLLNQTPRWHAP
FT                   WHLTRVIHGHHGWVRCIAMDKVDNEWFATGSNDKTIKIWNLASGKLKVTLKAHDMTVRD
FT                   LAISNRHPYMFSVSEDKTVKCWDLEKNTAIRNYHGHLSGVHTVDIHPTVDVVVTAGRDS
FT                   VVKVWDIRTRLPVMTLPGHKGPITKVRCLPVDPQVISSSVDASIRLWDLVAGKSMKVLT
FT                   HHQRTVRDISVHPSEFSFASACTNDIRSWLLPKGELLTNFVSQDLDVINTVSINQDDVL
FT                   FAGSDNGSLTFFDYKSGHKYQTFKTKEAPGSPESERGILSSTFDGTGLRLLTGETDRTI
FT                   KIWKQDETASQDTHPNLPWNPKLDSQRL"
FT   CDS_pept        273725..276406
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000141766" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18500880"
FT                   /locus_tag="CAGL0M02299g"
FT                   /product="Similar to uniprot|Q12152 Saccharomyces
FT                   cerevisiae YPL150w"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="CAG62422.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG124190"
FT                   /db_xref="HOGENOM:HBG203877"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="InterPro:IPR020636"
FT                   /db_xref="InterPro:IPR020658"
FT                   /db_xref="UniParc:UPI00003B703F"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJZ8"
FT                   /transl_table=1
FT                   /translation="MINAIQPPTKAEQNNIKAIIGNSYNRLYSQFSSSELTEVGNYKIQ
FT                   KQIGEGSFGKVYLATHRPTKQKVVLKTGDKSDPNVVREVFYHRQFDYPYITKLYEVIVT
FT                   ETKVWMALEYCPGKELYDHLLSKSRLPTLECAELFAQITGAVHYAHTLNCVHRDLKLEN
FT                   VLLDKNGNAKLTDFGFTRESMTKAVLETVCGTTVYMAPEMIQHKPYDGFKVDIWSLGVI
FT                   LYTLLCGCLPFDEDDDLLTKQKIINDTPVIDERITIPEAQNLIEQLLSKDPTERPNTSA
FT                   ILLHPFLQPYGTLILEQTNKIILKQKQGGSQFSSRLERRLIKKMKRIGYDTQAIRQSVI
FT                   KKKCDSLSGLWFLLAEKEKKIDDKNRPRRSRSLLSVRKVFDDSTQDLLTGDDGLLTTSL
FT                   EVTRVGSIGKILNKQAERVTSLAPMGVKKSIDFSTRSLNLTLTNTNQSQDNNTKNQESV
FT                   TFSKEQVRRVQSGTNASTQNEQSPKKTNIFKKMSKFFKEKKYFSNLNNEESASSTNTMR
FT                   RSLETSLGASSHNKESVSPEKGNSINEDENRNEKFDSTDKRKPIKQSEKATMVLLPEDR
FT                   HKLTITEPNVTRLKSSSVTSRQTSTDNDDSESMDNSRSGSAEIKKRNLVPTARPFSGLS
FT                   EISNDTYNSDYSTDGNTSSYRVNDPPLSQIMKTNSGGTSQYSGNSEKLTNGTGRRYIRR
FT                   NQSLISNASSASEKSSRTDSFYDITTASPPAFIDNRSKNNFGLKESILPRFGAHHSWGP
FT                   KRSYASNRVGSLGRRAQKRNYLKNNSSRTTQSIIKEEDSSDNDETDVSYHSYRYNNNKS
FT                   PLNAFRSGGTPEYGEDKLISSSPLQTFGNVEHTPPKSATDSPEAFNGIYAPVVSNRIPS
FT                   KNIVEDEELISAADLEDNFSDD"
FT   CDS_pept        complement(276554..277990)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17436728"
FT                   /locus_tag="CAGL0M02321g"
FT                   /product="Similar to KLLA0F11341g Kluyveromyces lactis "
FT                   /protein_id="CAG62423.1"
FT                   /db_xref="HOGENOM:HBG124191"
FT                   /db_xref="InterPro:IPR010770"
FT                   /db_xref="UniParc:UPI00003B7040"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJZ7"
FT                   /transl_table=1
FT                   /translation="MSVRRLDNVVDSKYLWQPVDGIESNSDAKLEDTYLCFGIFWLDIY
FT                   ADYQHQLEELQKHQVRIEQSLNDCNIHYPWSNIEGVAMEIRFLSEDKGKRPYLFGYHCV
FT                   EDNIEAEEGIVVSLLFEYLKESGPEVFMKICDTDGDFLIDKFEDLMPDVYAFPSANNRL
FT                   WLHEGKFKAIPASFKPGRGIESSECIEFLSKQMFKCEVLTKMQDAFEKEILNSFPHSYL
FT                   DELKLIKLAIPDDMCHSGLKLNPGLGSYLIKQSLENTDTAGGSVATIVEQAKQSPTTYD
FT                   LLVPASHLRILSTVQFNVTGKEKDCYDPHICGWILCNTFSRLIKTGKILYKPNSKRLTD
FT                   PDSIFANFPFKEVRKIKEVEKIFADMNENLYGAQTFNNKTKSKLAAKDYEVSKDDEARK
FT                   YFKSENVDIDEDDFFEYFLTEALGVSKKELDEYTTSNISNGLKEDGIPQTDDIGDDCDL
FT                   EMSDEILQKLLESFKMGNMQ"
FT   CDS_pept        278407..279219
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17436729"
FT                   /gene_name="ATG5"
FT                   /locus_tag="CAGL0M02343g"
FT                   /product="Autophagy protein 5 "
FT                   /biological_process="autophagy"
FT                   /biological_process="protein transport"
FT                   /cellular_component="cytoplasm"
FT                   /cellular_component="membrane"
FT                   /protein_id="CAG62424.1"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006914"
FT                   /db_xref="GO:0015031"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG190234"
FT                   /db_xref="InterPro:IPR007239"
FT                   /db_xref="UniParc:UPI00003B7041"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FJZ6"
FT                   /transl_table=1
FT                   /translation="MGDSKELVWNGSINVQIKLDSRLLVDGVPEGRRLVNIRVPRESHI
FT                   AIYTPLVLERLRNVLRSDIEELLPKVWYSYKDISLPWSIPFGTLFDIYNGAHKGISGSR
FT                   DNYINVWKLNLVTDEKFPINVIPIIEGQDQLRKFMMQSWKQCCFILNGSSKRVMSLSLQ
FT                   DSLEVWEGVTERDYAKYSGVIKRILPRTPRRIPVAIHAANGGPIVQTTEPTLTDTSFSQ
FT                   AVEGIVKADFVVCQGIVMYLRDFSDTSLYDVYDKLHSIDGYLHLIANL"
FT   CDS_pept        complement(279263..279721)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000115674" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18500881"
FT                   /gene_name="PPT2"
FT                   /locus_tag="CAGL0M02365g"
FT                   /product="Mitochondrial holo-[acyl-carrier-protein]
FT                   synthase"
FT                   /EC_number="2.7.8.7"
FT                   /function="holo-[acyl-carrier-protein] synthase activity "
FT                   /function="magnesium ion binding"
FT                   /biological_process="fatty acid biosynthetic process "
FT                   /biological_process="macromolecule biosynthetic process "
FT                   /biological_process="protein-cofactor linkage"
FT                   /cellular_component="mitochondrion"
FT                   /protein_id="CAG62425.1"
FT                   /db_xref="GO:0000287"
FT                   /db_xref="GO:0005739"
FT                   /db_xref="GO:0006633"
FT                   /db_xref="GO:0008897"
FT                   /db_xref="GO:0009059"
FT                   /db_xref="GO:0018065"
FT                   /db_xref="HOGENOM:HBG124027"
FT                   /db_xref="HOGENOM:HBG203879"
FT                   /db_xref="InterPro:IPR008278"
FT                   /db_xref="InterPro:IPR016614"
FT                   /db_xref="UniParc:UPI00003B7042"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FJZ5"
FT                   /transl_table=1
FT                   /translation="MSVLGVGCDVVHLPRMHRLLTKYDAGSRGFQRVVSKFMHPTERIA
FT                   LGVDGASLSAGQIRYIAGTWALKEAALKALHCAAPLHTVLPPAMFIYTKLLYRQRRSNG
FT                   VPQLLLDNEALRLDQLQFLRQAKFLSTLSHDNEYLVAYTTLIDTKNLV"
FT   CDS_pept        280372..282942
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000206081" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21044350"
FT                   /locus_tag="CAGL0M02387g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /function="ATP binding"
FT                   /function="ATPase activity, coupled to transmembrane
FT                   movement of substances"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAG62426.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0042626"
FT                   /db_xref="HOGENOM:HBG524837"
FT                   /db_xref="HOGENOM:HBG557888"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010509"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017940"
FT                   /db_xref="UniParc:UPI00003B7043"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJZ4"
FT                   /transl_table=1
FT                   /translation="MDGIRVRNVLINVHRQCIGLDIERIAGKRYLGVLLKHLYYVARTG
FT                   STGYLDGHKRRARMILLVVVLMGVAGASGISWGVMRMLTRLRGWYLHSWKNRGRRPSMR
FT                   RTRSQTRLVDGGRIIYVPEDSIDGKPTSSKKNKKFLIPPTDNDIYEHDKFLFKNVESER
FT                   TRSSQLFYSKFLNQMSVISRILIPSFLDKNAILLSSQIFFLIMRTWLSLFVARLDGQIV
FT                   KDIIAGRGRRFLLDIGCWFLIAIPASYTNSAIKYLQRKLSLSFRTNLTRYIHDMYLDKR
FT                   LGFYKLLYDSKASTSVIKNIDNSITSDVTKFSDATCSVFANIAKPVIDLVFFSVYLRDN
FT                   LGTMGVAGIFVNYFITGYILKKYTPPLGELASSKSSAEGDYYNYQLNMINNNEEIAFYQ
FT                   GTEVEKTKVKELYENLMERTLLVDKRKFTYNMVEDYILKYTWSGLGYVFASIPIVVSTV
FT                   ASGINNEEVNMKEFIVNKRLMLSLADAGSRLMHSIKDISQLTGYTNRIFTLLCVLHRVH
FT                   STDFNYGANIEDKLQEISDALSSSSTLPNKTKVDIIRGTIQRNFNGVRFENIDVIIPSP
FT                   SGREGVKLINKLAFQIPPHIDFNMSHSNSILDITGSKDVNLPFLQGPGSSLLILGPNSC
FT                   GKTSIQRIIAEIWPIYNKKGLMSIPAQENLICIPQKPYFTRGGTLRDQLIYPMSSDEFF
FT                   DRGFKDKYLVQIMSEVKLDYLLKRGTGLSYLDTVADWKDVLSGGEKQRVNFARIMFHRP
FT                   LFVVLDEATNAISADMEDYLFNLLKRYRFNFITISQRPTLIKYHDLLLEISGKSSGSWH
FT                   LQTLGTDEAINSIEHEIEELEEKLENVKLWEIERDELIRKLSVV"
FT   CDS_pept        complement(283059..284402)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000182423" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17436730"
FT                   /locus_tag="CAGL0M02409g"
FT                   /product="Similar to uniprot|Q12080 Saccharomyces
FT                   cerevisiae YPL146c"
FT                   /protein_id="CAG62427.1"
FT                   /db_xref="HOGENOM:HBG175368"
FT                   /db_xref="HOGENOM:HBG330550"
FT                   /db_xref="InterPro:IPR011211"
FT                   /db_xref="InterPro:IPR011687"
FT                   /db_xref="UniParc:UPI00003B7044"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJZ3"
FT                   /transl_table=1
FT                   /translation="MAPLKVNERPAQYKQSSRKGKKAWRKNIDLTDIEKSIETQKDLEI
FT                   THGTSDLASLQDTALFQVDEEGDIDLKKALIKRKQIKKNLKSKEILDSIKTASKIKSVI
FT                   HPRHQEHQTKEGGKVQGVSKKELKKLLSLAGKIQGESKLKNRSDKDGLVKSAAADLWNE
FT                   EESNKVKLPSGIEFKKKRDEIPEELIKYSTTSWSIAEVKPKTLEHKPVKVAEYEDLPHA
FT                   GKSYNPDSKHWNSLISKEYESEKKREDARNKIQEYQAKIQRLMEVLDDKEEESSSEEDE
FT                   EDEEDETEETTESTDVTLGLSINPVVKNKKKTKYQKNKAKRHEEKVKMHKEIKELKQQI
FT                   KELEKIEEIEQEVEKRHEEKDKKVKKEKKNKKGKLGTKYHILNEGLEVKFKDELSDSLR
FT                   KVRPEGSLLYDTVRKLQSSGKVEARIPRTKGRRYKQKITEKWTYKDFK"
FT   CDS_pept        complement(285179..286495)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000197950" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17436731"
FT                   /locus_tag="CAGL0M02431g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /biological_process="steroid metabolic process "
FT                   /protein_id="CAG62428.1"
FT                   /db_xref="GO:0008202"
FT                   /db_xref="HOGENOM:HBG053829"
FT                   /db_xref="HOGENOM:HBG677053"
FT                   /db_xref="InterPro:IPR000648"
FT                   /db_xref="InterPro:IPR018494"
FT                   /db_xref="UniParc:UPI00003B7045"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJZ2"
FT                   /transl_table=1
FT                   /translation="MSGYASSSAWTSFLKSVSTFNGDLSSLVAPPFILSPVSLSEFSQY
FT                   WAEHPDLFLEPSFINEANFKTKCTEDPNVESPEMARMLSVTKWFISTLKSQYCSRDETM
FT                   GSEKKPLNPFLGELFVGKWDNKDHPEFGETVLLSEQVSHHPPITAYTIFNDKNKVKLQG
FT                   YNQVKTGFTKTLMLSVKQYGHTLLEVNKESYLITPPPLHIEGILMAAPFVELEGRSYLQ
FT                   SSTGLLCVVEFSGRGYFSGKKNSFKARIYKSAADSADKNKAIYTISGQWSGSSKISKLN
FT                   PATGYSDEIGTFYEAERVPVSHLSVKPIDKQHPLESRKAWKEVAEAIKAGDMDLITKTK
FT                   SDLEQKQRDLRKEEEAKGICWERRWFKDFDYSDAPGKDYLVPEKDDIFLQLAKAMDLSI
FT                   KNVPSGTLNGEKEDKKEDLTSIHWRFDRKLWDEEKEVVL"
FT   CDS_pept        287732..288094
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21044351"
FT                   /locus_tag="CAGL0M02453g"
FT                   /product="Similarities with uniprot|Q12245 Saccharomyces
FT                   cerevisiae YPL144w"
FT                   /protein_id="CAG62429.1"
FT                   /db_xref="HOGENOM:HBG124028"
FT                   /db_xref="InterPro:IPR018854"
FT                   /db_xref="UniParc:UPI00003B7046"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJZ1"
FT                   /transl_table=1
FT                   /translation="MSQIVVDGLSVRVDCDVEDGVKSPISLNLCLSGDEELKSSRLECY
FT                   YYTIMGRKDDVLGIPLRDTSSDWIRDLARLCATMITKKYNKPCYVTISTVGENNFQAST
FT                   IPLLAAVKEHVATLVN"
FT   CDS_pept        join(289221..289239,290018..290322)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000195636" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17436732"
FT                   /locus_tag="CAGL0M02497g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="CAG62430.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG211000"
FT                   /db_xref="HOGENOM:HBG539420"
FT                   /db_xref="InterPro:IPR001780"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR018266"
FT                   /db_xref="UniParc:UPI00003B7047"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJZ0"
FT                   /transl_table=1
FT                   /translation="MAESHRLYVKGKHLSYQRSKSVNNPNVSLLQIEGVANPQEAQFYL
FT                   GKRVAYVYRASKEVRGSKIRVMWGKITRTHGNSGVVRAKFRNNLPAKTFGASVRIFLYP
FT                   SNI"
FT   CDS_pept        complement(290723..292993)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000247883" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17436733"
FT                   /locus_tag="CAGL0M02519g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="CAG62432.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG203881"
FT                   /db_xref="HOGENOM:HBG252860"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="InterPro:IPR020636"
FT                   /db_xref="InterPro:IPR020674"
FT                   /db_xref="UniParc:UPI00003B7049"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJY8"
FT                   /transl_table=1
FT                   /translation="MTASKRHTYYGGGSISYERTNNSEHDKTQRPQDHQGPKHRKHVTF
FT                   GPYVIGATLGEGEFGKVKLAWSKSAYQQCDNTEGNAGNKPMTFKVPKQVAIKLIKRDFI
FT                   TKDPSKETKIYREINALKHLSHPNIVKLEEVLQNSKYIGIVLEYAAGGEFYKFIQRKRR
FT                   LKENHACRLFSQLISAVHYIHSKGLVHRDLKLENLLLDNEENLIITDFGFVNEFLRQNG
FT                   MMKTSCGSPCYAAPELVVSNRPYDARKADTWSCGIILFAMLAGYLPWDDDPKNPDGHDI
FT                   SRLYNYILNTPLKFPEYINPVPRDLLRKILVIDPKKRINIRSIEKHPWLESHSTFLSIT
FT                   PDEWDRLSNTKNIYRKSKPQFYPNKRPGSTYSNYSSGSKDNKRDSLIIDSALVSLPVPP
FT                   KEFQSHILARPSSLVVESRYSPLGKRNGHNRSNSAASAALQAVFDASERESLKSVDSKP
FT                   RSRSNDHKDIIEGIQPQKHAFVKPSRKVRPTSMQAPGSSYIHHGNFEGLHELMKRDNST
FT                   ASSHQTSISSEARIFDASPTLIPDLTKSPSSSTGNSPKLLPRKSFTVSKPLLDLKFASA
FT                   DIIKANESTDSLSKRIHDQIYEVEHPRQRRHSYRYSGIISDLIFGTLSEEGEINTFENK
FT                   DHKSDAEESEMTISESKLDSVSICSQQSNIHRNISKQASSVSLLRTTSNHSTNNLNVGS
FT                   RTYGRAELYDKRHLRQIPSNTLNQINAPGNTHRNSAIYSEDDKRKSTAKRVFEFFKRRS
FT                   MRV"
FT   CDS_pept        complement(294348..294479)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17436734"
FT                   /locus_tag="CAGL0M02541g"
FT                   /product="Similarity"
FT                   /protein_id="CAG62433.1"
FT                   /db_xref="HOGENOM:HBG124030"
FT                   /db_xref="UniParc:UPI00003B704A"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJY7"
FT                   /transl_table=1
FT                   /translation="MLGAPISRDTPRKTRSKTQFFQGPIVSLITEKCTYEWGNPSIN"
FT   CDS_pept        complement(295156..296529)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18500882"
FT                   /locus_tag="CAGL0M02563g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /protein_id="CAG62434.1"
FT                   /db_xref="HOGENOM:HBG058424"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="UniParc:UPI00003B704B"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJY6"
FT                   /transl_table=1
FT                   /translation="MTVDTEIASNKLRNEEFKIWKKTIPLLYQHISTMKPKYANASKGT
FT                   IKDVPCCLTFSDEVIPNKANGTLSTVIYYGIGNEIYSLDCDLPLGLHLQKDTLQPNEKL
FT                   QLPQFDQIVSRIQSEDLSPKWRAAANCNIYKIKCVGNGKVVALLDSGAIVWFQESTESP
FT                   VSMVDGGAKIIPNKYELEEDFVNDSLNKIDFDFDLSLNGEKIIVSQAVLNEDRTVIKVF
FT                   SNIDKDLGKLLISLDLPGTKSVHNIKFYNDNIFGFCDNSGNLYFYDSRNLATPIWKIEN
FT                   EHILSFAFSPLVETLLITGGANGIINFWDVKRLTVKTATTGGDKRQESLLSLSNHVEEP
FT                   ISSVEFSASSPSEFITVGISGSIYHWDVFNYFEKVSELFSEGGDQSAIDSLDTEEIQAE
FT                   SLTFYHTGGSRRHLGKSTKKNSVSVHPIIEGLIGTIDTDGLITVYKPFTGVLPEAEDS"
FT   CDS_pept        complement(297048..298130)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000990" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17436735"
FT                   /locus_tag="CAGL0M02585g"
FT                   /product="Similar to uniprot|Q03012 Saccharomyces
FT                   cerevisiae YPL138c"
FT                   /function="zinc ion binding"
FT                   /protein_id="CAG62435.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG058422"
FT                   /db_xref="HOGENOM:HBG203883"
FT                   /db_xref="InterPro:IPR001965"
FT                   /db_xref="InterPro:IPR011011"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR019786"
FT                   /db_xref="InterPro:IPR019787"
FT                   /db_xref="UniParc:UPI00003B704C"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJY5"
FT                   /transl_table=1
FT                   /translation="MSNLLPEWCPPYSTTKIDTNTGEDVYCICKKPDYGELMVGCDGCD
FT                   DWFHFECMKIPETYRNLVESFICPYCRVGITGPGSKGDGECPKSLWKKKCRLQDCYEPC
FT                   ESGSKYCSKEHGKEYMSRLLNKVKIKNDLNNRYANESDDKLLKDVYHATKNNVEKFKTF
FT                   GSSSFIDSDIDRVDRHGEIYDKIINDDKYYKDLLTEKDNITNNQIEGLKKKVEELDKYL
FT                   DWISSVNKLINGEDNTIEQEENVNDTIKTKKKKKKSQKRRSKKAICGYSLNLAKIPCNP
FT                   EEFYNKYSEITTSTPDCNEIEGICIKLRCNKHSDWSTMTSDQYTRQIISLETHLKRLDL
FT                   SISTRKRQLNINYFEHIMRS"
FT   CDS_pept        complement(298560..302174)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000111153" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19348728"
FT                   /locus_tag="CAGL0M02607g"
FT                   /product="Similar to uniprot|Q03016 Saccharomyces
FT                   cerevisiae YPL137c"
FT                   /protein_id="CAG62436.1"
FT                   /db_xref="HOGENOM:HBG058420"
FT                   /db_xref="HOGENOM:HBG203884"
FT                   /db_xref="UniParc:UPI00003B704D"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJY4"
FT                   /transl_table=1
FT                   /translation="MITNDVDVPVDWLYKGSKPHKKARRKNRSAVAVAGAAGKTERSRS
FT                   LSISNASLSHGMYADPHAKRVSGTMAIPRAMAGAIAGAGAVAIEDDDEVDIRADGGPGA
FT                   RMPALTKTHSLNQETKDEVPVLTPPPTPTQSRNSPSLVSVKRSASTSSKPKKTSLFGSL
FT                   FGRSRSSSQSNDTEKKLDTAKRLAISTASEKKTYPQELLTPASPVSANSPSPDIRRSTS
FT                   ITKSAKEHRARNSDNTTTDKNTHQETQKESGSRERPTDLTKISLKRVKFAVDKFETDPP
FT                   QQLPSRTPKPGNIMIPDDMISELPAISVGITSNQQKNNLGPQFTKDSIEYKRALEIHQI
FT                   ALKEAEKHQQEAHHAARRIAHEVSNFSNGKQASAPGFMLNLVAQSDQSKRDQNSAVHDT
FT                   DINIDLSEKLNKTGIDLPIHMHEHHFDDPGSTLEGNQEITLDVVYTRCCHLREILPIPS
FT                   TLKQVTDKTAPLQTLKFLNPKPTLIDILSFCDFIAIVPIQTIVFDNVNLSTEMFKIVIS
FT                   SVAYSSVLEKISLRNVTMNKESWQLLCKFLLTSQSLNKIDISQTRIKPETGTELLRSSM
FT                   DWDLFAKTLAKRAEHLRPLEEILVNGVNFDNIPLEDFQNFLITFATQKHLTNGIRLGLA
FT                   NATKSICSVQHYKFLLEWMSNYNVQGVDLGFNDLSNLIKPTLGKLSSLTYPNLHYFTLN
FT                   STNIQSTNDMALLLKALSKLPNLEFLDLSNLPQVFPDILPYMYKYLPRFPQLKRLHIDN
FT                   ENMTYKEMTVVCNLLAKCTGLIHVSMLSQKPPMSETESAENLSTNGDSNSGTVFAKNNF
FT                   SATLYAFVRDSPNLVGLDIDYSSISDEVSSRLALCLMRNMRRTMDSSFQLDELDSQDEL
FT                   LFDGSLVTMTAKDVLERLTQLNTKQIIEKKDATKRYLLKKYVQKLHKIHNNVQQTIDNL
FT                   FEKRKSGDLPMQEKENLVRLILLEKNLVHILDIFDNMPNLSEVLGENKIASSDSLVDHP
FT                   NLRHVVETDNLNENSNERDLQVNENDNLQQRPHLMATESGRTIDTLTGRPVFSRRSSTT
FT                   SLASKKQEEEEGDFHKWGFYIQQQKALYPDGESQYGESSAVSASTSQTTLPSIDSKEKK
FT                   IFTKLPSGPELRTAIIKAKGVSSIEELIQKINDYHCCDIESLYNILKQNELEGNGIVTS
FT                   ESDLTDNEREHLEGAVKNIYEQLLNNASMNRDVKKVNQ"
FT   CDS_pept        303016..303657
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000069228" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17436736"
FT                   /gene_name="ISU1"
FT                   /locus_tag="CAGL0M02629g"
FT                   /product="Iron sulfur cluster assembly protein 1,
FT                   mitochondrial"
FT                   /function="2 iron, 2 sulfur cluster binding"
FT                   /function="iron ion binding"
FT                   /biological_process="iron-sulfur cluster assembly "
FT                   /cellular_component="mitochondrial matrix"
FT                   /protein_id="CAG62437.1"
FT                   /db_xref="GO:0005506"
FT                   /db_xref="GO:0005759"
FT                   /db_xref="GO:0016226"
FT                   /db_xref="GO:0051537"
FT                   /db_xref="HOGENOM:HBG281533"
FT                   /db_xref="HOGENOM:HBG584215"
FT                   /db_xref="InterPro:IPR002871"
FT                   /db_xref="InterPro:IPR011339"
FT                   /db_xref="UniParc:UPI00003B704E"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FJY3"
FT                   /transl_table=1
FT                   /translation="MGVCVFFPLCLPCPGALTYIREAQFISSWTPADPRHKQLKMFLQR
FT                   FVTVGGAAIGARSTMGAMGAIGAIGAKGTMNNIGRRMYHPKVIEHYTHPRNVGSMDKTL
FT                   PNVGTGLVGAPACGDVMRLQIKVNDKTGVIEDVKFKTFGCGSAIASSSYMTELVHGMTL
FT                   DDAAKIKNTTIAKELSLPPVKLHCSMLAEDAIKAAIKDYKSKRTSTTTLH"
FT   CDS_pept        complement(304583..305971)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000164620" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18500883"
FT                   /locus_tag="CAGL0M02651g"
FT                   /product="Similar to uniprot|P19541 Saccharomyces
FT                   cerevisiae YPL133c"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="signal transducer activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG62438.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0004871"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG058418"
FT                   /db_xref="HOGENOM:HBG398051"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="UniParc:UPI00003B704F"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJY2"
FT                   /transl_table=1
FT                   /translation="MEEPAAKKQKKLYKSCIFCRRSHVNCDHQRPCSRCIKREIGHLCV
FT                   ADENVSNIQSQYQYKNSMSPIGSTEIPNAEINIGDETRAIQGSNSSVYGTETPISSSNN
FT                   NLLLPPQPNFVSENVGSEFSSLNEFLMMLENPIPGESENTSQSNKEQERTAHSNMEDSI
FT                   ENTQEQTDNNEGIIGSVSVNQEISQDINEASSKANGTKTVNDGQGQEQDQEHNRQKLNK
FT                   QESSNSKAQSDKYDDTPTSKEQFFLTAADPSTEMNPVDRLKLVINAKLEAGLLKPYDYA
FT                   KGYARLQEYMDKYMNDTNKQRILKPLMSIRPAFRTIAKSLKDVDLVLVEESFERMLLSY
FT                   DRVFTSMSMPACLWRRTGEIYRANKEFASLVDCTVDDLRDGKLAIYELMTEESAVNFWE
FT                   KYGSIAFDKGQKAVLTSCSLRTKDGLKKRPCCFSFTIRRDRYNIPICIVGNFIPLSPTR
FT                   DHSN"
FT   CDS_pept        306446..307303
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000264965" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17436737"
FT                   /locus_tag="CAGL0M02673g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /function="copper ion binding"
FT                   /protein_id="CAG62439.1"
FT                   /db_xref="GO:0005507"
FT                   /db_xref="HOGENOM:HBG175824"
FT                   /db_xref="HOGENOM:HBG525908"
FT                   /db_xref="InterPro:IPR007533"
FT                   /db_xref="UniParc:UPI00003B7050"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJY1"
FT                   /transl_table=1
FT                   /translation="MSYTVGLRMAARRSVLRMTPLSQMRMVPRVSHRWSSNGPSSSAKS
FT                   SSNGNIDFSKLTRDEIKQLRDMKMAKDRKYKDRTVAYYFGSVAVIFLGLAYAAVPLYRA
FT                   ICARTGFGGVPITDKRKFTDDKLIPVDTGKRIRVSFTSEVSQILPWKFTPQQREVYVLP
FT                   GETALAFYKAKNNSDKDIIGMATYSITPGDAAQYFNKIQCFCFEEQKLAAGEEIDMPVF
FT                   FFIDPDFASDPSMRNIDDLILHYTFFRAHYGDGSAVSEHQPVEDVNMANAQILTPQVID
FT                   ATKD"
FT   CDS_pept        308170..309063
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000105947" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18500884"
FT                   /locus_tag="CAGL0M02695g"
FT                   /product="Similar to uniprot|P26321 Saccharomyces
FT                   cerevisiae YPL131w RPL1"
FT                   /function="5S rRNA binding"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="CAG62440.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="GO:0008097"
FT                   /db_xref="HOGENOM:HBG232151"
FT                   /db_xref="HOGENOM:HBG391676"
FT                   /db_xref="InterPro:IPR005484"
FT                   /db_xref="InterPro:IPR005485"
FT                   /db_xref="UniParc:UPI00003B7051"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJY0"
FT                   /transl_table=1
FT                   /translation="MVFIQNLKTSAYHSRFQTPFRRRREGKTDYYQRKRLVAQHKAKYN
FT                   SPKYRLVVRFTNKDIICQIVSSTITGDIVLAAAYSHELPRYGITHGLTNWAAAYATGLL
FT                   IARRALQKLGLDETYKGVEEVEGEYELTEAVEDGPRPFKVYLDIGLQRTTTGARVFGAL
FT                   KGASDGGLYVPHSENRFPGWDFEAEELDAELLRSYIFGGHVSQYMEELADDDEERFSEL
FT                   FKGYLADDIDADSIEDIYASAHEAIRADPSFKPTEKKFTKEQYAAESKKYKAKKLTKEE
FT                   RDARVAAKIAALAGQQ"
FT   CDS_pept        309656..310444
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17436738"
FT                   /locus_tag="CAGL0M02717g"
FT                   /product="Similarities with uniprot|Q03029 Saccharomyces
FT                   cerevisiae YPL130w SPO19"
FT                   /protein_id="CAG62441.1"
FT                   /db_xref="HOGENOM:HBG124031"
FT                   /db_xref="UniParc:UPI00003B7052"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJX9"
FT                   /transl_table=1
FT                   /translation="MKRPFIFSSQILASFVVAEQFRAFLSTDEIGSDSIQRGTDDNPLV
FT                   IRIDKQSYSPELIDTLTKSTNIIFADLPDVPEFIKADKISDVDYQVVQNTWKHKDKKND
FT                   EEEKQDDNDKKEDKNKQENNDKNEETKSKTKPNSKTVEDHKTTLSTKTTTHSTIIYTSS
FT                   KPEKTKESEENSKDSRSGDKGKPYDDSEDNGDSDDELCDDEEEKESKNSNKLPSNHTEP
FT                   HLGDNEDEFFDNIGNHLNNRGHYQWLLYAILFALPFPNIL"
FT   CDS_pept        join(310925..310933,311165..311881)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000176324" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18500885"
FT                   /locus_tag="CAGL0M02739g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG62442.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="HOGENOM:HBG055834"
FT                   /db_xref="HOGENOM:HBG329099"
FT                   /db_xref="InterPro:IPR005033"
FT                   /db_xref="InterPro:IPR016665"
FT                   /db_xref="UniParc:UPI00003B7053"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJX8"
FT                   /transl_table=1
FT                   /translation="MVASTKRTIRIKTEQHILPDVPPVENFPVRQWSIEIALLDEEGKE
FT                   MPATIFDKVVYHLHPTFANPNRTFNEPPFKIVEQGWGGFPLDISLYFLEKGGERKISHD
FT                   LNFLQESYEVDHVIQVPLNKPTLTAELAKSGFTEDTSSGSKRKMTGSNTGAESKTKKAK
FT                   TTTASTIKGNVDLEKLAFGLTKLNEDDLVGVVQMVTDNKTPEMNVTNNVEEGEFIIDLY
FT                   SLPEGLLKSLWEYVKKNTE"
FT   CDS_pept        complement(312153..313730)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000066020" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17436739"
FT                   /locus_tag="CAGL0M02761g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /function="telomeric DNA binding"
FT                   /biological_process="regulation of transcription "
FT                   /biological_process="telomere maintenance via telomerase "
FT                   /cellular_component="chromosome, telomeric region "
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG62443.1"
FT                   /db_xref="GO:0000781"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0007004"
FT                   /db_xref="GO:0042162"
FT                   /db_xref="GO:0045449"
FT                   /db_xref="HOGENOM:HBG058413"
FT                   /db_xref="HOGENOM:HBG203887"
FT                   /db_xref="InterPro:IPR001005"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012287"
FT                   /db_xref="InterPro:IPR013867"
FT                   /db_xref="InterPro:IPR014778"
FT                   /db_xref="InterPro:IPR017930"
FT                   /db_xref="UniParc:UPI00003B7054"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJX7"
FT                   /transl_table=1
FT                   /translation="MTGDIQMASSDTEDVNRFANIIEDLPVKTRLTLSTLSLLNDVSTQ
FT                   LLRFLISNAHTPNVIAVISNKENYISTGESEMFHTLVRIFKNIRDVYESRTPLLNVNNV
FT                   APGLWLLNMPPPTILKGHEAYIISTIRKANLVTFILTVINCLPYGFDFLQKVYLDVFCP
FT                   NTILTDQTNGDQVSKFLKPQAIIYLDLKTHAYISSIRDHLGANEQIPDAEKRILLDTIF
FT                   PDNIAMRLVNRKIVAPNEKKILTPSEKEFVGRCERRKETLIKFTNYTDLLNSYDWTFFV
FT                   KELLEYCGKNMNLIVWGKKGRSKTALLEFNPSDFDPQILFATGSHLTTDLAVNSHDPSP
FT                   IGNTFDTGNKEKLIDANELRPLTDAESESINNEIQSALQNESGQGMQKNFMDDAHMSGG
FT                   ENVHSQLVDSNNSILSDVISKSPSVKVVKAKRTWSKEEEKTLITGLIDLGPAWAKILDL
FT                   YGPGGKINENLKNRTQVQLKDKARNWKLHYLKTGKPLPEYLNRVTGNLDKIAKTKRRGS
FT                   KEGSIPPN"
FT   CDS_pept        complement(314946..315635)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000066021" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17436740"
FT                   /gene_name="HHOA"
FT                   /locus_tag="CAGL0M02783g"
FT                   /product="Histone H1"
FT                   /function="DNA binding"
FT                   /biological_process="nucleosome assembly"
FT                   /cellular_component="nucleosome"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG62444.1"
FT                   /db_xref="GO:0000786"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006334"
FT                   /db_xref="HOGENOM:HBG124032"
FT                   /db_xref="HOGENOM:HBG203888"
FT                   /db_xref="InterPro:IPR005818"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniParc:UPI00003B7055"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FJX6"
FT                   /transl_table=1
FT                   /translation="MAAKKVTKDTKPGYKNLIIEGLKALNNGKGASRVALKKYIKDNHS
FT                   DVASVSLFDSYFNNAIKKGIDSKEFHFPKGPSGVLKLVKPASTSTTTKAKTTDKKVTKK
FT                   STASKASEKKTPAKKTATATTKKVTKPKKDEKKKTTQKKSSAITYREMILTGVLSMNNG
FT                   KGASRMALKKFIKDKYPTNVEKVVNFDYLVNNAIKKGVESGELSQPSGPSGMVKILKKG
FT                   KESIKSI"
FT   CDS_pept        317204..319822
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000141926" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17436741"
FT                   /locus_tag="CAGL0M02805g"
FT                   /product="Similar to uniprot|Q02931 Saccharomyces
FT                   cerevisiae YPL126w NAN1"
FT                   /protein_id="CAG62445.1"
FT                   /db_xref="HOGENOM:HBG058444"
FT                   /db_xref="HOGENOM:HBG203889"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="UniParc:UPI00003B7056"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJX5"
FT                   /transl_table=1
FT                   /translation="MDIDKFHLSLVSGGKPSLARNVDTPDSKKNSTLLSDDLTHYVIPF
FT                   NNQIKIYSTETKHCVKTIKFPNHEVLNTVFMNDDVKIVHFAFGDMTKTNDTIDNELLSI
FT                   VTNTGSLLVLNLKGKLVEDPKHLNISAKLNDPKESISKILFGEATQQIKLITSKVNSDN
FT                   TLAYYLYDCSFEDNISLTCTHELQNVQNISWSNNNLYLSYLVEQPKSEGSSKTEKIFKC
FT                   ISIFDDSLNQEFDLSIILPSTTVSQSSNSKTVSTIAIDNNGIQLAVGFFSGVITIVDLA
FT                   DLQTRLLKWHIDSVLSLTFTDDGSYLLSGGWEKVLSFWQLATNMQQFLPRLNGVIVDID
FT                   TIGNGKFYSLTLQLTENVTSADYQILLLNAADLTSVLSITGPLAVFSSETKNSKQPLSS
FT                   MNTKTSESVSSSVVSKKKLKKKLLKNKRQDFTVPACINPVSKQIYFPHMSAIQVYDFYK
FT                   NEPIAYQYVTSAVAGAMGKVRTELNIQEPLITEVQFTKDGKWMITQETEFPPEDLPSSK
FT                   DLNYILKFWNKESGEGDWQLKTKVLNPHGLAVPITKILVAPSCINNSEGCLTADNNGGL
FT                   KYWSFEKHEKNWCLTKVSLPNFNHFSNSVSLAWSSDGSLIFHGFDDKLQVIEFDTLRKF
FT                   ESSFSELTFDFEIQALLLSNDKTLVVATKTTLYAFDILAGAITHSYDLFPYIDGVYKNT
FT                   NISRLLACNSKSGQIALVVNQQVEDESNNKTLNYKSSIIIFSADLSERVGSYSHDEYIS
FT                   CIEWNYESDFIFMDIQSRLGVVGATVSTEMSDEVNNEGVFDGLYHESGNSFHEELKKLS
FT                   SQKVEAENVDTEDKNDVDLEFINGNFANKAINMNSFTSMMDNIQNIQMESLFDRVMKVL
FT                   K"
FT   CDS_pept        join(complement(321650..321739),complement(320283..320948))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000232073" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17436742"
FT                   /gene_name="RPS0"
FT                   /locus_tag="CAGL0M02849g"
FT                   /product="40S ribosomal protein S0 "
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="small ribosomal subunit"
FT                   /protein_id="CAG62446.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="GO:0015935"
FT                   /db_xref="HOGENOM:HBG481547"
FT                   /db_xref="HOGENOM:HBG736296"
FT                   /db_xref="HSSP:1VI6"
FT                   /db_xref="InterPro:IPR001865"
FT                   /db_xref="InterPro:IPR005707"
FT                   /db_xref="InterPro:IPR018130"
FT                   /db_xref="UniParc:UPI00003B7057"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FJX4"
FT                   /transl_table=1
FT                   /translation="MSLPATFDLTPEDAQLLLAANTHLGARNVQVHQEPYVFNARPDGV
FT                   HVINVGKTWEKLVLAARIIAAIPNPEDVVAISSRTYGQRAVLKFAAHTGATPIAGRFTP
FT                   GSFTNYITRSFKEPRLVIVTDPRSDAQAIKEASYVNIPVIALTDLDSPSEYVDVAIPCN
FT                   NRGKHSIGLIWYLLAREVLRLRGALTDRTQPWSIMPDLYFYRNPEEIEQQTAEEAAQEA
FT                   GEEEAKEEVTEEQTEAAEWAQENADNVEW"
FT   mat_peptide     join(complement(321650..321736),complement(320286..320948))
FT                   /gene_name="RPS0"
FT                   /locus_tag="CAGL0M02849g"
FT                   /product="40S ribosomal protein S0 "
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FJX4 "
FT   CDS_pept        324009..325811
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000718" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17436743"
FT                   /locus_tag="CAGL0M02871g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /protein_id="CAG62447.1"
FT                   /db_xref="HOGENOM:HBG190107"
FT                   /db_xref="HOGENOM:HBG204123"
FT                   /db_xref="InterPro:IPR022751"
FT                   /db_xref="UniParc:UPI00003B7058"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJX3"
FT                   /transl_table=1
FT                   /translation="MVSMRLLMNSLRKRKLLVAIQVVVLFLIFSHSFGTDYLIPYNSNT
FT                   EYASSAARVQPMQLPDPVAKKTLIGNVLRAALDAKPSPFKLDRDALKTSSCPKKGDVSS
FT                   GGIDQFHWTSAKNLKACLNLDDYAIKTLSEAHSRYMKTLFNDKGEFAISKSDFKKLYPN
FT                   EKGIVTLGGGRYTILAMLMIETVRRHGSTLPVEVMFPPEDEGEFDFCNNWLPKHNGRCV
FT                   MMSQEVPFEILQKDKEVRFKSYQIKSLALLLTSFKQFVFIDADNNAMKNIDHIFDTEAF
FT                   KTHGLILWPDLWKRFTNPGFYDIAGVKYDLGKRVRNVNDDASPPETYDPNHSIYTTHDL
FT                   KQREEIAKHLYEDVSLADLDGTIADTTTESGQMMVDNKKHLSTLLLALYYNIYGPDLYY
FT                   YMMSMGTAGEGDKETFISAAHVLHLPYYQVKTNIGFDGYVNDVDNQFKGVGLMQTDFEQ
FT                   DYQRHKQVLKELATEKPLEPVKYQLPNHFQDKMKNPDGTSLDIMFLHASFHKFDPADLA
FT                   KSKQYFKQNGEQVRGYNRIDAYKNFDFELFSFKKLYDNLCTSDHISFKSLKKHEGTEFW
FT                   TSMCSYFKQRVDFLTKTKPANAFI"
FT   CDS_pept        326338..328779
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000057127" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20195510"
FT                   /locus_tag="CAGL0M02893g"
FT                   /product="Similar to uniprot|P25623 Saccharomyces
FT                   cerevisiae YCR030c"
FT                   /protein_id="CAG62448.1"
FT                   /db_xref="HOGENOM:HBG058965"
FT                   /db_xref="HOGENOM:HBG204111"
FT                   /db_xref="InterPro:IPR018808"
FT                   /db_xref="UniParc:UPI00003B7059"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJX2"
FT                   /transl_table=1
FT                   /translation="MNNHRSTYINQILERKDPYEATETLRIRLSQAKLLNTNLYLFLNQ
FT                   LADLRRNYNQQLRKIIIENEDLNSMLRKQMIENNVLTAEEMQHFTFNSLGEIEPLWNTL
FT                   VSELKLDLAANTKFSKVIEDEVILGIKNSVEKNSNWGTSKHLHSKLSKVAVSLKRNKDP
FT                   NTHAELQSEWDADKAKLFQIFETMDYERLYSVKDCLLKYQSGYTDYILKTTEKCDTYMT
FT                   QFLEFNPEKEIQRFANDASNYKFSQVQPGNNAKYAPSNMNTPNQERGSFNDKTSPSRFA
FT                   SASTVIKHDMGSEQPIMLEDSTTYKNMNKTQKLKSKMGSIFGKNKLKSKKSQQRLSSSP
FT                   EKPPLSKSFSSASASTNYSSRKSQMASTMQTPQVDIQNRESGITDQISSSNISTPKSFQ
FT                   QQPKIEQAPIASMSQPALIPNQKDKPLPDINQSKKERDIVSDQNAKSTPEIIQHKPLHI
FT                   TSPNSSKSQTPRQWSTSSAASTTNNEPPAYSPHLSNNDNMPNNTAANTLGSQQMMQPQL
FT                   TGELTALQAQTTGATGTSSANNSLFQHLPDDFSIFGLNASIAEVLNATFKDGVLTSSQL
FT                   VGEVALNYVKNTVMNTPLPIGLNLQVTNASTFNKVILNQAFMEKVADTEYKVNPQFIDG
FT                   RTLGAMKYSIDNTTVPVVIHPIWKFEPHQASVVLTVGLSNQIPESINELTLSDFTVMVN
FT                   IAGTESTSALSKPQGTFNREKNRITWKFKEPLTISRDGENVKLIGRFMTNGQGFEPSDG
FT                   VMLKFVIREQQGQQDASINIIGSKITLSVQEYDVENPFGGEWQPMRTNRTLASGNYIAT
FT                   S"
FT   CDS_pept        complement(329147..329923)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18500886"
FT                   /locus_tag="CAGL0M02915g"
FT                   /product="Similarity"
FT                   /protein_id="CAG62449.1"
FT                   /db_xref="HOGENOM:HBG124033"
FT                   /db_xref="UniParc:UPI00003B705A"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJX1"
FT                   /transl_table=1
FT                   /translation="MIRFGMPHNQGSLPAIQASIAYGSSNLPSPEDDFDLRLSPSISGR
FT                   DTQTLLNYVSSSENDAIISSSRTDDELSGIHDNAENGSSDYYNNILSTSSSTSLGTYEH
FT                   VIISRTRSPIQEATSLTPNVSTQIDKWCLEIQLDRQRTPSLALADDQVDIDRNDLWTSH
FT                   ILADLDDSHLKRIKEFAAYFLPVLKESRRQQRELQKQTARRNTDTANTRKFRIPSLFNK
FT                   DLLSLSFENISIESDCSSYIEVLSSPYLNISYSDLT"
FT   CDS_pept        331097..332218
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000216678" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17436744"
FT                   /locus_tag="CAGL0M02937g"
FT                   /product="Similar to uniprot|P48510 Saccharomyces
FT                   cerevisiae YMR276w DSK2"
FT                   /protein_id="CAG62450.1"
FT                   /db_xref="HOGENOM:HBG492682"
FT                   /db_xref="HOGENOM:HBG560425"
FT                   /db_xref="InterPro:IPR000449"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR006636"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="InterPro:IPR015496"
FT                   /db_xref="InterPro:IPR015940"
FT                   /db_xref="InterPro:IPR019954"
FT                   /db_xref="InterPro:IPR019955"
FT                   /db_xref="InterPro:IPR019956"
FT                   /db_xref="UniParc:UPI00003B705B"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJX0"
FT                   /transl_table=1
FT                   /translation="MSITIHIKSGQNKWDVSIDPSQTILNLKEEIAKVSEIPSGNQRLI
FT                   YSGKILKDDQTVESYNIKDDHAIHMVKSGGNASTSNAPTNANESSNSSTTAVPSNIASG
FT                   QTGGFNPLADLTGARYAGYANLPSADMFGPDGGINNAPDQDEMLRMMENPIFQSQMNEM
FT                   LSNPEMLDFMIQSNPQLQAMGPQARQMLQSPFFRQMLTNPAMIRQSMQFARMMNGQGGM
FT                   PGADATDASAFPAPGGDDTETTTGSTENTSTNNRTNSNANANPNAAANPFAALMDPASN
FT                   PFAAMMGNMNNQQGGAGVQQPAFDPTLLASLLGGQLPAPAQEDNRPPEERYEQQLRQLN
FT                   DMGFFDFDRNVAALRRSGGSVQGALDALLNGDV"
FT   CDS_pept        332990..335266
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000197682" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17436745"
FT                   /locus_tag="CAGL0M02959g"
FT                   /product="Similar to uniprot|Q03254 Saccharomyces
FT                   cerevisiae YMR277w FCP1"
FT                   /function="phosphoprotein phosphatase activity "
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG62451.1"
FT                   /db_xref="GO:0004721"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="HOGENOM:HBG053858"
FT                   /db_xref="HOGENOM:HBG396857"
FT                   /db_xref="InterPro:IPR001357"
FT                   /db_xref="InterPro:IPR004274"
FT                   /db_xref="InterPro:IPR011947"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniParc:UPI00003B705C"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJW9"
FT                   /transl_table=1
FT                   /translation="MSTPVLTPMGLPYPITVDELMVPIGSYVEKGQRLFAYKFWYMVEI
FT                   ANSPDDNDIDYEGPEIEKSKRKVRESIEFYEAPFEGDLLSWNVDEKDEIAGPNMAVCEI
FT                   KRPCNHDIVYGGLCTMCGKEVDEYDQVDANLTISHTDTNLRVSRKEAIDLDKQITTRLK
FT                   NEKKLVLVVDLDQTVIHCGVDPTIGEWKADPSNPNYETLKDVKCFSLEEEPILPLIYMG
FT                   PKPPVRTCWYYVKIRPGLKEFFEKIAPLYEMHIYTMATRAYALEIAKIIDPDKSLFGDR
FT                   ILSRDENGSLTQKSLTRLFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINS
FT                   NFLPKQQTTMLQLGRRTRQKIKESEELLTDIMDTEKKLQEKIDEEVKRQEEKLNHQMAT
FT                   AEESTDQESKEKIAKKLEFSASLEVQQQNRPLAKLQKHLHDQRLLIDDDDELFYLKDTL
FT                   AYIHKEFYHLLEDASDQNEADITMLLPKLKKKVFKECHFVFSGLIPLGTDIKRADIVIW
FT                   TSLFGAESTSDIDEHTTHVVTKTPGTYKARLAKAFNPDIKVVHPDWIFECLASWKRIDE
FT                   KPYLLIVEQPVSEDELIEFKKKLEQKKKKLEELEIEEEEELNERANQMEPTMPLFGGDT
FT                   SWLNDDEDEVEFGSDDDNSDEDSLISEDTDNGLAANGNSSESSITNKVPEATEDVLNNP
FT                   SDTQNEEDQIPNGNGNHLPKRPIDDVSENAHEMASKKQLTSKDDDRSSDVESDFEEDLL
FT                   NALDD"
FT   CDS_pept        335863..337716
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000268676" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20195511"
FT                   /locus_tag="CAGL0M02981g"
FT                   /product="Similar to uniprot|Q03262 Saccharomyces
FT                   cerevisiae YMR278w"
FT                   /function="intramolecular transferase activity,
FT                   phosphotransferases"
FT                   /function="magnesium ion binding"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /protein_id="CAG62452.1"
FT                   /db_xref="GO:0000287"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="GO:0016868"
FT                   /db_xref="HOGENOM:HBG193285"
FT                   /db_xref="HOGENOM:HBG571743"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="UniParc:UPI00003B705D"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJW8"
FT                   /transl_table=1
FT                   /translation="MSTTDIPVELRTAIESWLQLDKNEETRNEVIKLCNDQNWDELHKR
FT                   FDSRIVFGTAGLRARMEAGTNRLNKLVILQASQGLATYIKDKFPQNLTAVVGHDHRYHS
FT                   QEFAQVTAATFIRAGFKVYYLNPHDEFVHTPMVPYSVDHLNASVGVMITASHNPKMDNG
FT                   YKVYYTNGCQIIPPHDHGIAETINNNLEPWSTDWNFTKILSNAETDGKIEYVRKRMLTS
FT                   YLNSVVNQLIQRDFAAPDEKPWFVYTPMHGVGHQIFSTILNESLNLKDNIDYITVPEQK
FT                   DPDPSFRTVSFPNPEEKGALNLAITLAEANGIKLVLANDPNADRFSVAVRDDSKNEWKQ
FT                   LTGNEIGLLFAFYEFKMYQKAADKGIKNKPLAMLNSTVSAQVIKRMAEKEGFLYKDTLT
FT                   GFKWIGNEAAKLEEKGYFVPFGYEEAIGYMFPAMEHDKDGVSAAIVFLQAYANWLQSSS
FT                   NPIDIIHECYDKYGVSAEYNGYYIVSDPSKTDKVFESIRSSYTSMGLSFPESIGEHFRV
FT                   TEFRDLTIGFDSTTADKKPLLPVDKNSQMITITAVPSGASNTGESVRFTIRGSGTEPKL
FT                   KVYIEGISSTEGRARILAKSLWETLKHEWFKPSSNGLSTDF"
FT   CDS_pept        complement(337942..339618)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000174951" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18500887"
FT                   /locus_tag="CAGL0M03003g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="CAG62453.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG176437"
FT                   /db_xref="HOGENOM:HBG325775"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI00003B705E"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJW7"
FT                   /transl_table=1
FT                   /translation="MVLIVTHNMTSEKNNPKSEKTNYDGVVTKSIAFDGCEECSSSDEC
FT                   QSNSDQLSVTSKGCICSVDDCHENDSPFQNPEYFETGFKEVMFIISCMVAQLLNQAGQT
FT                   QSLSTMNVLADYFKSNSSKQPWLMASFPLVSGSFILISGRLGDIYGLKKALSVGYIIMT
FT                   LWSIICGLAKYTNSDAFFIVCRSFQGLGIAFILPNIMGLVGNIYKVGTLRKNIVISCIG
FT                   CMAPAGAALGALFGGLIVTEDAEQWPWVFYAFGIASFVNMLLALYSIPNNVPTNLNNLN
FT                   MDWIGSLLGVSGLLLLNIVWNQAPIVGWGEAYIIVLLIISIILLLIFVVYEIKYATSPL
FT                   LPPSVLENKKILMILAALFFGWGSFGIWTYYYYAFQLNLRKYTPLWAGGTHFMFVIWGT
FT                   VAAFVVALTIKKVGPAVLLCFSMVAFDCGSIMLSVTPVHQTYWRMNVGMQIILSFGMDL
FT                   SFPASSIILSDFLPMQYQGMAGSLVNTVVNYSTSLCLGMGNTVEQQYNAHGADLLKGYR
FT                   SALYLAIGLASAGVCVSLVFLVTDIIAKRHRKRIESECESC"
FT   CDS_pept        complement(341849..345613)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000111315" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17436746"
FT                   /locus_tag="CAGL0M03025g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /function="DNA binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG62454.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG058307"
FT                   /db_xref="HOGENOM:HBG203520"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniParc:UPI00003B705F"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJW6"
FT                   /transl_table=1
FT                   /translation="MVSNADETFVAPRLIRVAGGGDDDVHGSGSGAGPANGNSVSGSNT
FT                   GSRGSTPTYRVAQACDRCRLKKTKCDGKIPQCSQCALVGFECKISDRLNRKSFPRGYTE
FT                   TLEERVRELETENKRLMALCNSDLGSNTRSDGLEKQSPSKRKRSPSMERDSERGFTENM
FT                   ELQLQQSCSSCGNSDPNHRCVHLKPVVSNIIVDSNTDVSFEQNVAPGLPAVKALNSMAE
FT                   REESAQLAMLVSLALPRSTEEILFIPQLMANIQKTFGFSSKQSLYTVSLLSSLKKNLPT
FT                   PNSNSSDENLSPNYYVSEDFRPFFYEVLKFDILGETETENGSNRNESPDSTIPNSRSDD
FT                   LLSWMEIQRLVDVYFECWSNTIPIFSRKLFIKQMKAFKTEVDKFGDRLFEVYKTEQIKI
FT                   NFLKIFATVLAVMCQMALLSRLKQLEATTQELECKRTQNLIAHYNQLIEKIHLDSFFQD
FT                   MSTTTVQSLQLLSFISFYFLNVGDIPRLYQLRGTVISMAQQLRLHRCPSAVLLSASGST
FT                   MQKFEQGERRLLFWAIYYLDVFYSLQLGVPRLIKDHEIECALPVSEEEDSQLEGRVSDF
FT                   SLAVIRYAKVLGNILDSIFKRNMMSEAATESMAFVHEKALDIWKNRLPEKYGFRLEANG
FT                   LFNFDELTVVKNSEKDLIEKSSILLFYFLAKCMIHLPVIATRSASLEQQLQPGTSSDTS
FT                   ETPKESQNKTPTRVCPSYILMQKAASTMLQVMHYTSEYYLPSPINISRTKARFALLTAC
FT                   SAVEYLKGGSLYVETKNLLENLIIKLELERKLDLPGIISWHSLKLLDMALMLLLQSPTT
FT                   KMEKLDKLVQKKINHYNRQMGIPAMKLSNSRKNNKKIKLENESSQLSSTSNPIAKGELK
FT                   SDSVVCEEDDNVNDNEVTTTAKLEENNEFINPNKIEQGVTSNTLAFSFSSTDLSALFNA
FT                   PESLFKVPNENTQYNQQHEMHNNSISSSHSKEPVNKERDSDKQELNAIFNETQNRSTSF
FT                   AKLMLLLNNEHKSLSSSLENDVRNVGNKLSSENAGQLPSHGATSGLNSKGNEFLSMNTL
FT                   YGGDNDFIIDASLGLAPLLSENNEIHRQHEGTQVQAGNNDILSTRIGFNGKDDYSNSRS
FT                   FTNEMFGGSDTKRTRSDTTALLTANSELTHDSQDGNVNFGSTNSELHERLNNNHFDAAT
FT                   SYLPEQKSEYGSSFGNKNTVKSLSPSTSFLDDDTLSLSFGDYSTQRRPRRYPNYNNTLG
FT                   KDSLAMKTEINGGRNQGNLHDLFQWQNSK"
FT   CDS_pept        346435..347349
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000176611" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17436747"
FT                   /locus_tag="CAGL0M03047g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /protein_id="CAG62455.1"
FT                   /db_xref="HOGENOM:HBG191816"
FT                   /db_xref="HOGENOM:HBG627717"
FT                   /db_xref="InterPro:IPR003737"
FT                   /db_xref="UniParc:UPI00003B7060"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJW5"
FT                   /transl_table=1
FT                   /translation="MLKRPNTPTMKSIRNFPFSKLLFKLTKLTIIFQVLYIYFTPKVED
FT                   LNKENLTKLLPTHDNFGVLNLVIAHPDDEIMFFSPTILQLIDHVQELNVVCLSNGDADG
FT                   LGELRAKELKDAIGYLTVNRNLRNVSLNILDYTDGQNEVWSGVATDLKKYILTSEPGVK
FT                   QKDIILTFDREGISGHRNHIACNEGVISYLKTIKSNSFVFLELKSLSTWQIISKYSGVV
FT                   PKLLEIIYNKIRASNKTFVSYLPNRDSIATDSNVCFISTFDQYALSFAAMCYAHKSQMV
FT                   WFRYLWWSFSRYVFVNDLSRITV"
FT   CDS_pept        complement(347584..349230)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19348729"
FT                   /locus_tag="CAGL0M03069g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /protein_id="CAG62456.1"
FT                   /db_xref="HOGENOM:HBG124034"
FT                   /db_xref="UniParc:UPI00003B7061"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJW4"
FT                   /transl_table=1
FT                   /translation="MRKQVIGINNIFHLARIRSIPVHCHCKGPLYSYPVVSKTLFHTKN
FT                   VEVSKYSHVELRSLNEQIHSQLTSLTDLNKRQLLLVETLSRNNNLEKLLDYYEIDEGSV
FT                   EDAIQLLQDSNVSIQEFSSMIQPVLNRTNLVGKYHMGYLSKLMQIYISLTRTHNGGSVD
FT                   ALNKDDMNKFIKRFIEGSQLKRAQTALQFLLDGYKERGEDLLGPYGDKQTIAHFLMLRS
FT                   GALQDLWKIDVSNGNNKKQAFYKINGSHRNVKSTYNVLDSVKLFEIVRYILRYNDKDNH
FT                   SQPVYFDEGILKNVILCLGYVGQTTLIEDIINKIWELDSVSVPPKYNITVTSDLLTAIV
FT                   SAYSKCGKSIQPGLVIADKFFGKIPNIIVKDDFWINLQKWNIILPNKWRSTIDLSKRTW
FT                   ELMKSWRNSTNNGGFITANVEFLNLVYKVLSSDYIKLKDLEWIYDIFQHSLVTLYSKNS
FT                   LTVDEIKLLKKFQIFTIKKMVYFGHYSKCLQFIKEWSYDAANKQQLTNLFVVLRNRYLQ
FT                   KRGYNQEKEMTKVQKKYDEEEQEDMLLGGLW"
FT   CDS_pept        complement(349679..352171)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000208273" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17436748"
FT                   /locus_tag="CAGL0M03091g"
FT                   /product="Similar to uniprot|P09880 Saccharomyces
FT                   cerevisiae YJL087c TRL1 tRNA ligase "
FT                   /function="ATP binding"
FT                   /function="RNA ligase (ATP) activity"
FT                   /biological_process="tRNA splicing, via endonucleolytic
FT                   cleavage and ligation"
FT                   /protein_id="CAG62457.1"
FT                   /db_xref="GO:0003972"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006388"
FT                   /db_xref="HOGENOM:HBG051833"
FT                   /db_xref="HOGENOM:HBG333213"
FT                   /db_xref="InterPro:IPR012387"
FT                   /db_xref="InterPro:IPR015965"
FT                   /db_xref="InterPro:IPR015966"
FT                   /db_xref="InterPro:IPR019039"
FT                   /db_xref="UniParc:UPI00003B7062"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJW3"
FT                   /transl_table=1
FT                   /translation="MNLSRNVKDLVEKLEAASQLPGRGKAIKRICKLSNSDGQVVSWKF
FT                   NEWDYGKNNIKLPCCARGLFITDDSKNPQIVARGYDKFFNIDETPFTRWDTLESDTKGT
FT                   YNVTLKANGCIIFVSGMADGTLVVCSKHSTGPRDDVDRNHADAGEQFLLSQLKSIGIEP
FT                   QQLALELYQNNVTAVAEYCDDTFEEHILEYTNDDVGLYLHGINYNETTFRTWDMDSVSE
FT                   FARKYNFKQIKYENFNDFTLLKKFLEECSNSGTYHGQEVEGFVIRCKTRENGNDFFFKY
FT                   KFEEPYLMYRQWREVTKDYISTKSRVFKFKKHKFITNKYLDFVIPILDSSPALCEEYMK
FT                   GFGIIKLRNEFLKDFGMSGLEILNHEKVLELENANKIDYDTVDEHTKFLIIPVAVIGCG
FT                   KTTTAMTINNIYPESWGHVQNDNITGKDNSLLMKRSLELLAKPGIKCVVVDRNNHQARE
FT                   RKELFDWIDEYKEDYLPYDTNIKVICLSFTKRDDLENVREITTNRVFARGDDHQSIKLS
FT                   KYGEKKVMGIMSGFIKRFQPVNEDRMPDIMFDHVIDLTVTEKDSSLINAKRILNNLHDK
FT                   YPVLVPTVPTDEEIRAAFEKSLEYKPTTVKIINEKGSRRNKNKDKKHTSAPTMKKLKPV
FT                   YFFAELRDPTKLLRCIKAFIEENRSSIDNDSYIHIDRLFQDKKYQEKLHVTLIHLMQGK
FT                   KGTETQQQLWDDYLRSFDEYLTVNPETFDKNCDRIKTKYSIKVTVQSLYWDSKIATLTV
FT                   KPELVEVERDGSLNTLACCNDIPHITLGILEEGIKPVYSNELLKMMNQNDKESRPANSF
FT                   CLELAGLEVQIADVYIHL"
FT   CDS_pept        352552..354423
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000000807" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21044352"
FT                   /gene_name="EXO70"
FT                   /locus_tag="CAGL0M03113g"
FT                   /product="Exocyst complex protein EXO70 "
FT                   /biological_process="exocytosis"
FT                   /biological_process="protein transport"
FT                   /cellular_component="cellular bud neck"
FT                   /cellular_component="exocyst"
FT                   /protein_id="CAG62458.1"
FT                   /db_xref="GO:0000145"
FT                   /db_xref="GO:0005935"
FT                   /db_xref="GO:0006887"
FT                   /db_xref="GO:0015031"
FT                   /db_xref="HOGENOM:HBG059390"
FT                   /db_xref="HOGENOM:HBG202183"
FT                   /db_xref="InterPro:IPR004140"
FT                   /db_xref="InterPro:IPR016159"
FT                   /db_xref="UniParc:UPI00003B7063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FJW2"
FT                   /transl_table=1
FT                   /translation="MNEIDVDEADILVLSQGLEKTSRLTHQVNKSLAKISKTSAQSSQL
FT                   FGPILARNNVLKTLQRNIDSTLNSVASVKDLANEASKHEVLLRKGIASLGLKPFTVELH
FT                   KLEDMYQDMSVGNSRHTENAEFHGILKHLKEMITSSEEQLELEFIQILKRIEPFDPQIN
FT                   MEKKIPFPYYSDEDISQMLIIFNYFYVKSEDSRMQDIFIRERGDQMLKSMAFMEPFAKK
FT                   VTSSKNAPYEKGSSGFINYTEAVLGFIANERSLIDDVFSQFAEIKPRVLRNILDPIVAA
FT                   FCKVLMSDLIFVKSNIDNAGLFSFELTECISGVQKSVKGMNLKNQMQLIDADKQVKDVT
FT                   RSLFKDTVDRIKSKTNQMTTIPSDNGVTEATVDTMSRLRKFSEYKTGCLAAMESISRDV
FT                   WLSKSFREKEYTIQSAAIADNETAASLLSCFLSDCIDTLVANLERRAQTILMPNQEPDV
FT                   ANPNSARNKFKQRIGFLVLMNMTLVEQIVEKSELSVMLGNLGKARIEKLKKRYVNYLVA
FT                   DWKDLTVNLMDTVVIDSVGKKSKDKEQIKEKFRRFNEGFEDLISRTKQYKLSDPALKRL
FT                   LKSEIVALLMPMYDRFYGRYKDSFKNPRKHIKYTPDDITNVISQTLR"
FT   CDS_pept        complement(354638..357859)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000141755" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17436749"
FT                   /locus_tag="CAGL0M03135g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /protein_id="CAG62459.1"
FT                   /db_xref="HOGENOM:HBG189670"
FT                   /db_xref="HOGENOM:HBG202366"
FT                   /db_xref="InterPro:IPR011021"
FT                   /db_xref="InterPro:IPR011022"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="UniParc:UPI00003B7064"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJW1"
FT                   /transl_table=1
FT                   /translation="MPIADSNSPLFPIGKDLTIPTDAKPVASTASVQIYIKLAEPVVFL
FT                   QDFENLNHSDKPPGILRGSLILRILKPTKVKNLTLNFKGYARTEWIEGIPPKKQEFAEI
FT                   NDIINHTWPFYQSSEHHHSHHAHSSTASSSPAASNATSNNSGSNTRTGTPGNEDSPVYK
FT                   GTGAALYRPLPRSTSERALRTGATQSSTPTNFSPLKNNTVLRSKSKDNLDDFARKRVLS
FT                   RASSHSTLTNNSFNSSSNNNNGHTLNKTLSPMSFLRRATSSNSAHAFGVNDTPSASHRN
FT                   GASTPTHPAPTGSFISDILSGNFASPGDSTTHNHAGNSSHQVNSNNQSQQATADFDPVG
FT                   ENGTFQPGDYIYPFEQLIPQSYPETVKAEFGFVEYYLFVSLERHGPFKSNLTGRTPVNI
FT                   IRTQSDNSVEESEPIIISRDWENALFYDIVIGSKDIVLDAFLPINFRLSPMEKLTLHRI
FT                   RIYVTETMEYFCKNQKVHRIEPTKKFLLAEHKGPRVPGLPKDANYNKAKNMGNLLLDES
FT                   SGDLVNKEFQYQLFVPSKFNNHQKIHPDTTYDNIKANHWIKICLRLSRVVGDKRKHYEI
FT                   SIDSPMRVLHKLCSHANTLLPSYESHLIFNKQNFTDSSSQKNRESTNDNELGLYHDSNI
FT                   FFPKEVLMSPLLSPDVQALDVNTESIYNAPYRVIRHDEFDDSRHKSGNDPSANVFNSPT
FT                   LKSNIYQPDSIQRELASPQAVPLSPMLSSLSLTDFHQSNPPDFESLEDQLSAATTRSNS
FT                   PMILPKDPPTYKEATHNDPSGVVASASIPKIKLSHSQESLPINNKNLRIKGLTPFSDTA
FT                   SIDTLSNDSDIAAGFQFSSSPNLTHSLLRSHSPSMISLHTGENVKNTPRLDVSHDNMPS
FT                   TIRDDRHFFNDISQILGDEAEENENHLKLSRTHESSNGEASARSSFDMSAINFRKDSVT
FT                   AEPLLSNRNNSQISGIGNFAMPSKESLPLLGSPTDSSVDITALYDRNSAAWHPLQLEGE
FT                   IPLSPIVSNESHSNMLFKANQRPNDDATNTSHDDMLTRDVNPTDDSSGGLSDTDHRRTS
FT                   HIGEHEKPITNAAETHKNINAVDSI"
FT   CDS_pept        358599..361211
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17437832"
FT                   /gene_name="IRS4"
FT                   /locus_tag="CAGL0M03157g"
FT                   /product="Increased rDNA silencing protein 4 "
FT                   /function="calcium ion binding"
FT                   /biological_process="lipid metabolic process"
FT                   /protein_id="CAG62460.1"
FT                   /db_xref="GO:0005509"
FT                   /db_xref="GO:0006629"
FT                   /db_xref="HOGENOM:HBG124035"
FT                   /db_xref="HSSP:1EH2"
FT                   /db_xref="InterPro:IPR000261"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="UniParc:UPI00003B7065"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FJW0"
FT                   /transl_table=1
FT                   /translation="MHMRLNKRRRNHVQEQMSELPQDAKNDSLAAAQVIFKRHADNANS
FT                   TPPSPVGLDSAGHLDKQADTAQRVHKVGTPSGTSSSHNSGNEGMHKVTKPLGENTATTA
FT                   PIAIKQPVRVVRASPTAIVSPTSHTPLDAATAAANVVAEKSKIRTTQQQLQDKKRRDIE
FT                   NAHHAASAAAVTSSNLAVGSPPSQYIPSVPTLNVTSPQMRNSSQNIDRRSKSNEEAHNG
FT                   HEKMMNSRSNSINSSTIKGSVSEPNTVTPLRQNSPSNMDDIIQKMEAVDIDEGRKNSFV
FT                   MNGSGDSVDSLKPNVVRRPMRTPSGRRVRPPSPIDKIGSIQEPHLESTGFNDQNDFSEM
FT                   SSLIDGSSSEDITKIRGSGIRERSPVDGVEHGGMSVNIPMQRSLSSDVLSPSQQAAMVA
FT                   ATKLSPSTQTLPVEELEYLASTGDVSAYKALNKINGTNMAYKGTIPDLIPSRARAQKTS
FT                   KLKFKIFGGGKNSDRRNNATPIGYDPVMNISTDFGGKKVVESNQNNVKFKTTMRSQKYL
FT                   GNDNLDDNDLRTQYIDDDDDDDDYDSAYEDLDYSRDDSEAMYKGDRESSNPRSNSLLQS
FT                   SSYSGKVGFNSNANSGTSINNSGNVSNLDYSLRDGVAEKKKSRRDKIKKKLKSTASVVP
FT                   YYPHYALTHLASGVSTVNSNLNNSNKNTKWFNEDKPWKSHKDVGFVTSQERKRYEAMWV
FT                   TNRYLYLNLLPWWPKEEVEKDEDDSASNLNSNASTNVGGVLSDGDNEEDDVTRFLLSLP
FT                   ADGLMLNLVAKDIWERSNLPNDLLKQIYDLVDTRKDGTLNRESFLVGMWLVDQCLYGRK
FT                   LPQELDPKIWDSVDRWVLNVVNSTMMTALERKQKKKMMKKELKNIKREQKQAIAEQHN"
FT   CDS_pept        362253..364484
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000066085" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17437833"
FT                   /gene_name="IML2"
FT                   /locus_tag="CAGL0M03179g"
FT                   /product="Mitochondrial outer membrane protein IML2 "
FT                   /function="binding"
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="mitochondrial outer membrane "
FT                   /protein_id="CAG62461.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0005741"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG124036"
FT                   /db_xref="HOGENOM:HBG395662"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="InterPro:IPR019412"
FT                   /db_xref="UniParc:UPI00003B7066"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FJV9"
FT                   /transl_table=1
FT                   /translation="MFKVFGALSGKGSSDSNGNSTRSSINEKRTKLILKEANDFEIALR
FT                   AMDYVLDDRTEEGLALLRENEKVNGQNQTITVLARGVIEFLQATLSFEMEEIKNASNTL
FT                   AKAEQLSWKSRTEAQKSGIRNSSIYPPGTVYAVTYTESCLLHALLMLFTESMMDAAKAL
FT                   LKLRKAYSMLHEIMEVVKKSELSRKVSSSSAVSIQSNGSFVSEEATFVSADIPYQLSET
FT                   ESNDPELWAFAEKIYKMRKLRLSGAHIGNTPAISRLRSGLGLSASNKSEELANSEQSVL
FT                   SDEAAERQATIDEFIHSGVNLCYGILQVVLSLIPPAIGAVLSIVGFRGSREEGLRLIWK
FT                   ATKDRNVHGCIGLLGLMFYYDGPFQFTDVDFDIPPALSNTKTSDSDTDRDGSISIDEMD
FT                   GHALLHPGPILEEALLHARALFPNSALWLLNEARMLSSRGRLPEAIELLDSIDVESIHM
FT                   RQVKGLLVFDKAITLVHMQEYERAATNLLSLLKISDWSHAFYTYFAGCCYLENWRMAQM
FT                   GFIKDDKLEFYREKAEELIFSAPKLLGKKTFKSKNLPLDRFMLRKVEQFKATQKKLGVK
FT                   NILDAIGTSPIREITYFYNGYNRMSKSDLEIAQKMLTSYHNPAIDQHDPDQELIKNLLL
FT                   SLTMRRLGDVESGVKLLDEKVLPSIYYMQNGKVKYIKKTEDPWAYPTALYERALFTWKL
FT                   DGVDNLSECRHWLVTAQNYAGDYELSTRVGMKIKAALDRVEESLQHGTA"
FT   CDS_pept        complement(364771..366252)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000233340" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19348982"
FT                   /gene_name="ARP4"
FT                   /locus_tag="CAGL0M03201g"
FT                   /product="Actin-related protein 4 "
FT                   /biological_process="DNA repair"
FT                   /biological_process="chromatin modification"
FT                   /biological_process="regulation of transcription "
FT                   /biological_process="transcription"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG62462.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006281"
FT                   /db_xref="GO:0006350"
FT                   /db_xref="GO:0016568"
FT                   /db_xref="GO:0045449"
FT                   /db_xref="HOGENOM:HBG345785"
FT                   /db_xref="HOGENOM:HBG559892"
FT                   /db_xref="InterPro:IPR004000"
FT                   /db_xref="InterPro:IPR020902"
FT                   /db_xref="UniParc:UPI00003B7067"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FJV8"
FT                   /transl_table=1
FT                   /translation="MSNSALQVYGGDEITAVIIDPGSYTTNIGYAGTDCPQSILPSSFG
FT                   EIHEAEESTSEDNTEKTRKTRKVFSEQSIPIPRPDYEVKRVVENGQVCDWDSAVEQWSW
FT                   ALRNELHIESNRGIPAMLTEPLWNSKENRSKSLEILLEGMEFEACYLTATSTAVSFATG
FT                   RPNSLIVDIGHDIASVTPVIDGMSLSKSTRCNHFAGRFLNKLLTDYLKPREIIPLFEVE
FT                   QRKPEFKRRSFSYSVADSLYDYANSRGFFQECKETIFQVATTPIAQEKNNQATSTGRTI
FT                   ESPWNEVIEFESNDRYQFAEQLINPLKESVPDDWPVNVAGVVETWRNDYVPMKRNKVGS
FT                   GNNKEKEGTKESTPLDSNTATPLPESSSTTNENGKRTAEDIKREELPGIVDLISSSISS
FT                   CDVDIRASLAHNLVITGGSSTIPGLSDRILNELNMKFPALKFRVLATGQSIERQYQSWL
FT                   GGSILSSLGTFHQLWIGKKEYEEVGSERLLHDRLR"
FT   CDS_pept        complement(366828..370457)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000246781" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18501142"
FT                   /locus_tag="CAGL0M03223g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /function="RNA binding"
FT                   /protein_id="CAG62463.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="HOGENOM:HBG057930"
FT                   /db_xref="HOGENOM:HBG395610"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR004088"
FT                   /db_xref="InterPro:IPR018111"
FT                   /db_xref="UniParc:UPI00003B7068"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJV7"
FT                   /transl_table=1
FT                   /translation="MSLTFATEKELAVDNTPAESSLDSLDGTTFDSDEESKPVEEAPKP
FT                   EPKPLPSLKDLPSLVDSNSFKPATKVEWGPNMKPAAISSSVSPSMSRSASATSAGRMRS
FT                   NNIQETFTLDLQSQLSVTKLELSRILQTVKQANNVSVESTLSRNSRTFLISGPAPKVKE
FT                   AKRELIKMLTRPITENIEVPSRCKAVIIGSGGKNIREISDRYDVKIHISKEPKPDSYNE
FT                   DLDDDLSDISIFGDFESVKQAKAKILSIVNEDLKNITARLSVEDSTLGSFVNVKEVSSD
FT                   DVKVQYYQDTGSFTITGSLDDIKNAKTKIKDYLQKLSNELAEENVKIPSKFQFLIDADE
FT                   VKDRFGVIVKFPKSSSDETVQFAGLKDKVAEAISFARTSSKQYIVDSLDISKAHNKNLD
FT                   HAKRLVIYFQKYNVLDKVAEEFPDVKYVLPSIEDLQNAKEVFIYLSAKNDKTSEIKAAR
FT                   REIIAIVNDITPAETLVIDDLDYELFHRNIKHILLGHESEAKFIQIGDYFKGDDSVVLF
FT                   ATSTDEDFKPSTDEIKESLEKVNANLNDLRKKQNSLEVATYDLESEKQDEFFGKDSVAL
FT                   KLILEDISGDDGHIQIKLHSPEKNKMTLRGDERAVKKANKDIKSIVENPSTTAKITVEV
FT                   PVASVSRLIGNKGANLQKLRNKYNCSIDIPQQGESDQDKTVEITIKGLQFIIEHAKKDI
FT                   ANEAKRLADIVTKELVAQAKYHRNLSGPQGMYRTRLQEKYNVFINFLKENNTITIKGPS
FT                   RGVNKAYDELKALLDFEMENGHKTIVNVPVEHMSRIIGKNGDTINGLSDEFGVELDFLQ
FT                   KSDDPKAVETGVVELEITGNRNAIKEASTKIAAIVSEAADHVTEKLDIDRKYHKTIVGA
FT                   GGHTLREIISNAGGDEVRGRAVDIPNADSESSIITIQGPKKFVSNVVKAINKIVEESQN
FT                   SITKKIEVPGERLGALIGPGGIVRKQLESEFNIQLYVPKRDEEETRVSLTGLPENIEKA
FT                   EKKIFTEIIRDNFDLEIMVPANVQNYVSDRGNLPQRLRLEKFVNVRYGNATKKANNLNR
FT                   TPVDIPYEKVAGAEGEKVKFTVEETGPSVVENVDGEIPWRLIYEPIDFDSILDEENGEK
FT                   KEASVDENKKQQLLKEAKEIIENRINDAPNATYSGYVWTSDPSKFFKVVGMGGSNVKKI
FT                   RESTNCIVYVPKKSDKINNVIFIKGAKENVEKAGEAIIKSLKQ"
FT   CDS_pept        complement(372122..373810)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000053808" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21044611"
FT                   /locus_tag="CAGL0M03245g"
FT                   /product="Similar to uniprot|P39994 Saccharomyces
FT                   cerevisiae YEL020c"
FT                   /function="magnesium ion binding"
FT                   /function="thiamine pyrophosphate binding"
FT                   /function="transferase activity"
FT                   /protein_id="CAG62464.1"
FT                   /db_xref="GO:0000287"
FT                   /db_xref="GO:0016740"
FT                   /db_xref="GO:0030976"
FT                   /db_xref="HOGENOM:HBG316485"
FT                   /db_xref="HOGENOM:HBG460149"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="UniParc:UPI00003B7069"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJV6"
FT                   /transl_table=1
FT                   /translation="MGKKVIHSRNIASLLKYQYDVDVVFGIVGIPVVEFAQELQSVGIR
FT                   FIGFRNEQAASYAASAYGYLTGKPGVLLVVGGPGVIHALAGVYNSMNNRWPLLIIAGSV
FT                   PRDEKYQGGFQELDQVSLLKPYLKFAGELTGTKKDANIVFNAWNSATQGTPGVSYIDFP
FT                   GDLITDVVEAIEFYKHETKRITTGPDPRSIAEVTSLIKEHQDKNILVVLGKGCINSSLA
FT                   LRHFIEEFNFPFLPTPMAKGILPDSHRLNVSAARSQALKSADLVLVFGARLNWILHYAS
FT                   PPKWNSNAKFVQVDIEPLTLGVNNPNGTSYCIWGDIQLTIENLRDTLHKLDFVKHKGLT
FT                   KELKEKIESNKHNLRVRLNPENYYGAKMLNYYSVYSMLKNLIDDRSSFIVSEGANTMDI
FT                   ARISFETDFPKRRLDAGTNATMGVGLGYAIAAKVHSPELNIVTIQGDSAFGFSGMEIET
FT                   AVRYRLGIIFIIMNNSGIYHGSDPSTITNETQLPPTMLSEKCRYDLVARGLGAKGYLVK
FT                   NLQELEYYYKKALVHTRERIPCLLNVIIEPGQNKKISFGWQKSKL"
FT   CDS_pept        complement(374158..374958)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000837" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19348983"
FT                   /locus_tag="CAGL0M03267g"
FT                   /product="Similar to uniprot|P38632 Saccharomyces
FT                   cerevisiae YEL019c MMS2 DNA repair protein "
FT                   /protein_id="CAG62465.1"
FT                   /db_xref="HOGENOM:HBG124038"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="UniParc:UPI00003B706A"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJV5"
FT                   /transl_table=1
FT                   /translation="MDSVALPEALPIHKDQRDNFHDLRECYISSELSTIEKQYEKTINQ
FT                   LTTYIDLLEEDQILQCVNKLTESYKDTLAQKEQADQLDNQLESLKQDYLRISDHSPATD
FT                   IDSFREYTNGTVGIDSFQKYFTEGIVDQKPTIPRNNVRRKPNTYEKLLKALPYIIRDPT
FT                   CVIPDEDQEEDDIQIEGGKIELNCPITCKPFENPMISKACNHVFDKVGIQMYFDTPDKK
FT                   KCPQGACGHELTARDFIPDNIMMLRCKINNRKKNDQARNMLDVL"
FT   CDS_pept        375233..375850
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18501143"
FT                   /gene_name="EAF5"
FT                   /locus_tag="CAGL0M03289g"
FT                   /product="Chromatin modification-related protein EAF5 "
FT                   /biological_process="DNA repair"
FT                   /biological_process="chromatin modification"
FT                   /biological_process="regulation of transcription "
FT                   /biological_process="transcription"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG62466.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006281"
FT                   /db_xref="GO:0006350"
FT                   /db_xref="GO:0016568"
FT                   /db_xref="GO:0045449"
FT                   /db_xref="HOGENOM:HBG124039"
FT                   /db_xref="UniParc:UPI00003B706B"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FJV4"
FT                   /transl_table=1
FT                   /translation="MNEEIQTLLIYQICDSLRFQANMEDISVDDVMDVMQENIMVECLL
FT                   DGVIMDKADVQKIVIQYVTDGELGEEAIGDKMESMYSNSRKKLLKEIDDLDNTISTNRK
FT                   KDKLLNLYRDTVLNRLQNKKTVLDKLYHGMKEDSSVIRNRIYLERIKNETPNSIAELQL
FT                   MLQRSIADCIMSEPIGSEKYNIAKEIQINLEDTIRFMKRALE"
FT   CDS_pept        complement(376045..376164)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21044612"
FT                   /locus_tag="CAGL0M03305g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /protein_id="CAR58073.1"
FT                   /db_xref="HOGENOM:HBG398760"
FT                   /db_xref="InterPro:IPR012589"
FT                   /db_xref="UniParc:UPI00017BD8B2"
FT                   /db_xref="UniProtKB/TrEMBL:B4UN57"
FT                   /transl_table=1
FT                   /translation="MLPGGPIVVLILVGLAACIIVATIIYRKWQERQRALARF"
FT   CDS_pept        377932..378930
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000074707" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20195765"
FT                   /locus_tag="CAGL0M03311g"
FT                   /product="Similar to uniprot|P39996 Saccharomyces
FT                   cerevisiae YEL017w"
FT                   /protein_id="CAG62467.1"
FT                   /db_xref="HOGENOM:HBG124040"
FT                   /db_xref="HOGENOM:HBG203732"
FT                   /db_xref="UniParc:UPI00003B706C"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJV3"
FT                   /transl_table=1
FT                   /translation="MSTFARWRKAELFDLMNKLKITDVSNSTKKSDMIVLIEHYLENLS
FT                   APLDYMHDFPELQTYYEDKQQLKIESDIEDELDKISSTSEDMEYGEDIDMKEETSETSS
FT                   DSSAEETETVVEKKDYNNLDFSEEPTKLQDFKFNFDQILDDIIDRAYIINENVKDYLSS
FT                   ISAVESIFTIIELVLFSVHLFANYRTGETVLSAQHSIGYMDYYFRPEYYKREVVHFLNK
FT                   IGLPILTWFFLLRIVPCFVSYYINFIRYELLVDMDPMVYHLFKGIVEFLIITRFNDNQN
FT                   PIQGFLSSFSFSPLGHLHVDPCRDLREFNDALGYLPLCFSVVCTILTLYIL"
FT   CDS_pept        379851..381758
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000246503" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19348984"
FT                   /locus_tag="CAGL0M03333g"
FT                   /product="Similar to uniprot|P39998 Saccharomyces
FT                   cerevisiae YEL015w"
FT                   /protein_id="CAG62468.1"
FT                   /db_xref="HOGENOM:HBG059012"
FT                   /db_xref="HOGENOM:HBG396957"
FT                   /db_xref="InterPro:IPR004443"
FT                   /db_xref="InterPro:IPR019050"
FT                   /db_xref="UniParc:UPI00003B706D"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJV2"
FT                   /transl_table=1
FT                   /translation="MSQFIGYGVKLELKDGKILEGKITKATSKGLVLSDVKFEDGGSSQ
FT                   LFKVRSSQLKDLKVVSVRQKNGKGNGSNGNAANKSSRNKSRNDYSMNSGSQTNGNTSHG
FT                   GSRHNNNNNNNSRYDSDWANDDVNQIKLQDDFDFQGNLNMFNKKDVFAQLKQQDDVAPE
FT                   LRLVAHNKKKDYEKPKNFNIDEMVIPNAKEDSWHKIDSERPQQQKSDGYLDFESGTDDD
FT                   DVDDHEDRQLSNTRDRKNNNQIKHNVEDDDDDDDEGLEFHDADELPITQAVNITHLLHK
FT                   AAKGSNSGKSKDGSQGNEQMLAKLEQMIIQQSKGSTRRNSSISSKKPTLLKIKDSSKQI
FT                   ATATPVQLLEIERIAQDHFGITAPILIENFAINLAQVIKQKLGGKARLRLENSNAEPLV
FT                   VILTSDSVRSGARALALGRQLCRTGHIRVITMFTTSVNEIQDSLVKEQLELFKKCGGKV
FT                   VNKVSSLESAVMSLNSPVEIVIDAMQGFDYNISDIFENIAEAEQADEDVNASDQNRRNN
FT                   TRNSVSKAETIEQRITDIINWCNNQRGSTKIWSLNVPSSFDSGSGVQNFPVAVQATGVI
FT                   CTGWPLSSLPNIKYTLSSLDDVVAVDMGFPRGVYTLQNSLRKFLSFDVFAIEGSIALEL
FT                   "
FT   CDS_pept        382549..384297
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000177331" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17437834"
FT                   /gene_name="VAC8"
FT                   /locus_tag="CAGL0M03355g"
FT                   /product="Vacuolar protein 8"
FT                   /function="binding"
FT                   /cellular_component="vacuolar membrane"
FT                   /protein_id="CAG62469.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0005774"
FT                   /db_xref="HOGENOM:HBG055740"
FT                   /db_xref="HOGENOM:HBG327627"
FT                   /db_xref="InterPro:IPR000225"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI00003B706E"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FJV1"
FT                   /transl_table=1
FT                   /translation="MGGCCSCFRDSSDDVSVLPITDNEREAVTLLLGYLEDKDRLDFYS
FT                   GGPLKALTTLVYSDNLNLQRSAALAFAEVTEKYVRQVSRDVLEPILILLQSQDPQIQVA
FT                   ACAALGNLAVNNENKLLIVDMGGLEPLINQMMGTNVEVQCNAVGCITNLATRDDNKHKI
FT                   ATSGALVPLTKLAKSKHIRVQRNATGALLNMTHSEENRRELVNAGAVPVLVSLLSSNDP
FT                   DVQYYCTTALSNIAVDEANRKKLAQTEPRLVSKLVSLMDSPSSRVKCQATLALRNLASD
FT                   TSYQLEIVRAGGLPHLVNLIQSESVPLILASVACIRNISIHPLNEGLIVDAGFLPPLVK
FT                   LLDYRDSEEIQCHAVSTLRNLAASSEKNRKEFFESGAVKKCKELALDSPVSVQSEISAC
FT                   FAILALADVSKQDLLDADILQALIPMTFSTNQEVSGNAAAALANLCSRIDNYSKIISSW
FT                   DQPKEGIRGFLKRFLQSNYATFEHIALWAILQLSESHNDKVIYLIKNDKEIINSVRKMA
FT                   DVTYDRLQKSGVDVNKNGNSEERGDNEDHQSNNDRNLANSTSSDQYEDASMELYNITQQ
FT                   ILQFLD"
FT   mat_peptide     382552..384294
FT                   /gene_name="VAC8"
FT                   /locus_tag="CAGL0M03355g"
FT                   /product="Vacuolar protein 8"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FJV1 "
FT   CDS_pept        complement(385581..387701)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000175159" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17437835"
FT                   /gene_name="GLC3"
FT                   /locus_tag="CAGL0M03377g"
FT                   /product="1,4-alpha-glucan-branching enzyme "
FT                   /EC_number="2.4.1.18"
FT                   /function="1,4-alpha-glucan branching enzyme activity "
FT                   /function="cation binding"
FT                   /function="hydrolase activity, hydrolyzing O-glycosyl
FT                   compounds"
FT                   /biological_process="glycogen biosynthetic process "
FT                   /protein_id="CAG62470.1"
FT                   /db_xref="GO:0003844"
FT                   /db_xref="GO:0004553"
FT                   /db_xref="GO:0005978"
FT                   /db_xref="GO:0043169"
FT                   /db_xref="HOGENOM:HBG021253"
FT                   /db_xref="HOGENOM:HBG302308"
FT                   /db_xref="InterPro:IPR004193"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR006048"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniParc:UPI00003B706F"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FJV0"
FT                   /transl_table=1
FT                   /translation="MSLTKIPENVQGAVSIDPWLEPFADVLSERRYLADKWLYDIKHAT
FT                   PDGSEQSLVDFARNAYKTYGLHANQQTKEIVYREWAPNAQRAFLVGEFNNWNEESHEMK
FT                   HKDEFGVFSITLAPLENGDFAIPHDSKIKVMFVLPDGSKVYRIPAWITRATQPSKETAQ
FT                   KYGPTYEGRFWNPPNSYQFKHQRPKFNLANDSIKIYEAHIGISSPEPKVASYKEFTQNV
FT                   LPRIKHLGYDAIQLMAIMEHAYYASFGYQVTNFFAISSRYGTPEDLKELIDTAHSMGIL
FT                   VLLDVIHSHASKNSEDGLNMFDGSDHQYFHSLTSGRGEHPLWDSRLFNYGSFEVQRFLL
FT                   ANLAYYIDVYQFDGFRFDGVTSMLYLHHGVGAGGAFSGDYNEYLSRDRSGVDHEALAYL
FT                   MLANDLVHDLLPESAVTIAEDVSGYPTLCLPRTAGGGGFDYRLAMALPDMWIKLLKTKQ
FT                   DDDWDMGHIVHTLTNRRHGEKVVAYCESHDQALVGDKTLAFWLMDAAMYTDMTVLKEPT
FT                   LVIDRGIALHKMIRLITHSLGGEAYLNFEGNEFGHPEWLDFPRVGNNDSYHYARRQFNL
FT                   VDDDLLRYRHLNEFDAAMQNCESKHQWLNTPQAYVSLKHEVDKVIAFERNGHLFVFNFH
FT                   PTQSFTDYRIGVDVAGTYKIVLNTDRAEFGGHNRIDEAQEFFTTDLEWNNRRNFIQVYI
FT                   PSRTAIVLTRQM"
FT   CDS_pept        complement(389650..390294)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000233452" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20195766"
FT                   /locus_tag="CAGL0M03399g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /function="small conjugating protein ligase activity "
FT                   /biological_process="post-translational protein
FT                   modification"
FT                   /biological_process="regulation of protein metabolic
FT                   process"
FT                   /protein_id="CAG62471.1"
FT                   /db_xref="GO:0019787"
FT                   /db_xref="GO:0043687"
FT                   /db_xref="GO:0051246"
FT                   /db_xref="HOGENOM:HBG492183"
FT                   /db_xref="HOGENOM:HBG756483"
FT                   /db_xref="InterPro:IPR000608"
FT                   /db_xref="InterPro:IPR015581"
FT                   /db_xref="InterPro:IPR016135"
FT                   /db_xref="UniParc:UPI00003B7070"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJU9"
FT                   /transl_table=1
FT                   /translation="MSGNSKRRIETDVMKLLMSDHEVELVEDSMQEFHVKFYGPKDTPY
FT                   EGGVWRLHVELPDNYPYKSPSIGFVNKIFHPNIDIASGSICLDVINSTWSPLYDLLNIV
FT                   EWMLPGLLKEPNGSDPLNNEAANLQLKDKKVYEEKVREYIDKYATKERYESQFGTPEDD
FT                   EDDGDDAEMKDEDGDDDIDEPVSDLEDISDDNADPSEELSDISDIELSDED"
FT   CDS_pept        complement(390927..391586)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20195767"
FT                   /locus_tag="CAGL0M03421g"
FT                   /product="Similarity"
FT                   /protein_id="CAG62472.1"
FT                   /db_xref="HOGENOM:HBG124041"
FT                   /db_xref="UniParc:UPI00003B7071"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJU8"
FT                   /transl_table=1
FT                   /translation="MFFVSSTGIDISDAGKEFSFSSVESKFAQRWFIGNCKHRNPSRKN
FT                   AINQFFKSNAYSETINYSRKLKQKKLKQKEMAAMQRQNTTLLTAGSQNQEQPENSSREI
FT                   TNLLTGNDIWRHKRDDQVVVDTVTVHKKTKSFWKSFKHMRKQIRKLRLQKKNVYKPQGC
FT                   TTHTQRQCSKKETLERINFLKPLPYLVGDSYSPEIIKQNILAITEHSEQNLLLTDY"
FT   tRNA            392109..392182
FT                   /gene_name="tRNA-Asn (GTT)"
FT   CDS_pept        complement(393154..393990)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000224167" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18501144"
FT                   /locus_tag="CAGL0M03465g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /cellular_component="membrane"
FT                   /protein_id="CAG62473.1"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG191130"
FT                   /db_xref="HOGENOM:HBG736287"
FT                   /db_xref="InterPro:IPR000791"
FT                   /db_xref="UniParc:UPI00003B7072"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJU7"
FT                   /transl_table=1
FT                   /translation="MSDKDQGSAQLAGDHQEYQNKNYDSDVENMAGGDHEIGKIYTSGA
FT                   NNEYIYIGRQKFLKTDLYEAFGGTLNPGLAPPSSHKFANPAPLGLSAFALTTFVLSMFN
FT                   AKAQGIVVPNVVVGLAMFYGGLVQLIAGIWEIALENTFGATALCSYGGFWLSFGAIYIP
FT                   WFGILEAYKDKESDLGNALGFYLLGWTIFTYGLTLCTLKSTVAFFALFFLLALVLLLLS
FT                   IGEFSGKVGCKRAGGVVGVVVAFIAWYNAYAGVASRQNSYIVAHPFPLPTNEKTLY"
FT   CDS_pept        complement(396552..397505)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000186563" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17437836"
FT                   /locus_tag="CAGL0M03487g"
FT                   /product="Similar to uniprot|P32910 Saccharomyces
FT                   cerevisiae YNR003c RPC34"
FT                   /function="DNA binding"
FT                   /function="DNA-directed RNA polymerase activity "
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG62474.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003899"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="HOGENOM:HBG059128"
FT                   /db_xref="HOGENOM:HBG397531"
FT                   /db_xref="InterPro:IPR007832"
FT                   /db_xref="InterPro:IPR016049"
FT                   /db_xref="UniParc:UPI00003B7073"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJU6"
FT                   /transl_table=1
FT                   /translation="MSDINNATIQLSDRAKELHNVMITKGSGALFTQQELSERSGLASL
FT                   SDLMSIVQELLDKNLLKLVKQNNELKFQAVDFFEAQKKSTMSAEEALVYSYIESSGREG
FT                   IWSKTIKARTNLHQHVVLKCLKSLESQRYVKSVKSVKHPTRKIYMLYHLQPSIEVTGGP
FT                   WFTDSELDVEFINSLLTIVWRFVSECTYPGGFSNFQNGSQGALYAPGIKNYCSLEDILQ
FT                   FIEQAQVANVQLNLGDIRSLCEVLVYDDKLERVLHDHYRVTLSSVMQMNQVASVSQADD
FT                   ATDMYAESEYSIFDFHTVMAPSSMDKEAVYFDEWVL"
FT   tRNA            complement(397755..397826)
FT   CDS_pept        complement(398183..400981)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000184434" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19348985"
FT                   /locus_tag="CAGL0M03531g"
FT                   /product="Similar to uniprot|P32074 Saccharomyces
FT                   cerevisiae YNL287w SEC21"
FT                   /function="binding"
FT                   /function="structural molecule activity"
FT                   /biological_process="intracellular protein transport "
FT                   /biological_process="vesicle-mediated transport "
FT                   /cellular_component="COPI vesicle coat"
FT                   /protein_id="CAG62475.1"
FT                   /db_xref="GO:0005198"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0006886"
FT                   /db_xref="GO:0016192"
FT                   /db_xref="GO:0030126"
FT                   /db_xref="HOGENOM:HBG022373"
FT                   /db_xref="HOGENOM:HBG631201"
FT                   /db_xref="InterPro:IPR002553"
FT                   /db_xref="InterPro:IPR009028"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR013040"
FT                   /db_xref="InterPro:IPR013041"
FT                   /db_xref="InterPro:IPR014863"
FT                   /db_xref="InterPro:IPR015873"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR017106"
FT                   /db_xref="UniParc:UPI00003B7074"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJU5"
FT                   /transl_table=1
FT                   /translation="MSTSTYKKFEQAGSSDLPDKMTIYQDCMNTFNETPVNPKRCRLLI
FT                   SRLLRLLAQGETFPRNEATALFFSISKLFQYPNDSLRQLVYLAIKEFSGISEDVLMATS
FT                   SIMKDVQNGSDLVKPNAIRSLTNVLDESTAFSAERLLKSALVSKHPSISSAALCTSYHL
FT                   LPISEVTVKRFTNETQEAVVDLKQFPSSSMNGEYYPNSTYITQYHALGLLYQLKKNDKM
FT                   ALLKLVRQFSEGNVLKNQLAKVELVRIVSELIQKDPQLFTQFKPLLNNWLSNKFESVQL
FT                   ETAKMITSFAIHNPRLVSPELYAAAISALQSLLSVPRVSTRFATLRILNRISMISPEKI
FT                   AICNPELESLVNDSNRNISTYAITTLLKTGTAKNISSLIHTITRFIHDVSDDFKIIIVD
FT                   AVRTLSLNFPQEWKSIVTFLIDVLKNSEGGFKYKNSIVEALIDIVSFVPQSKELALENL
FT                   CDFIEDCEYNEILVRILHLLGKEGPSTTNPSLYVRHIYNRVVLENSIIRSAAVVALSKF
FT                   ALTKNDSTLCESIISLLKRIVHDKDDEVRDRASIALKFIEAAKEKNDKVANDLIQSSSA
FT                   YDLSSLESKLSAYLSSNTDSFQTPFDSQSIPKYAEDELKAMELKKKQEKIFENKGDKTR
FT                   DSSKTESTSNSAGENFNAEAEYDDGKDDLLAAKYAEEMAAIPEINAFGSIVNTTKAVPL
FT                   TEPEAEFVVTGIKHLFADHVVIQFNIRNTLTDVILDNVSVSCVPEESGDVTLEEQFTIP
FT                   IDRLLPSAESSCYVAFKKPEAIVTETFMNSINFTTREVNPDTNEPFEGDEGFEDEYEID
FT                   PITLSGGDYVKSSFVGNFTSAFDELPHEEIAVYNIQEDISIQEVVDKVIQNTSCLPLGS
FT                   TQYVGGDSNSHTLKLFGKSALTGSKIGMLVKFIKSSKGVALKVQGKAEDATLCADLVNS
FT                   VI"
FT   CDS_pept        complement(401779..402873)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000192069" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20195768"
FT                   /locus_tag="CAGL0M03553g"
FT                   /product="Similar to uniprot|P53829 Saccharomyces
FT                   cerevisiae YNL288w CAF40"
FT                   /function="binding"
FT                   /protein_id="CAG62476.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG028784"
FT                   /db_xref="HOGENOM:HBG316388"
FT                   /db_xref="InterPro:IPR007216"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="UniParc:UPI00003B7075"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJU4"
FT                   /transl_table=1
FT                   /translation="MNVGVHTVGALSLDDGVIPPPGLNPNMMGMGNMPMGVPPMGAGGN
FT                   AGNAGNAGNQNPNASAGGNAGSSNANAASANNNASSGNAPAGTAQHALDDPNVYHWICE
FT                   LTYGPQKEQALLELGRKREQFDDLAIVLWSSFGVMTSLLNEIISVYPMLQPQLLTSQLS
FT                   NRVCNALVLLQCVASHSETKHLFLQAHFPMFLFPFLNTTSRQRTFEYLRLTSLGVIGAL
FT                   VKNDSKDVIGFLLRTDIVPLCLRIMESSSELSKTVAIFILQKILLDDVGLQYICATLER
FT                   FYAVTNVLKDMVEHLTVHTPPGRLLKHIIRCYLRLSDDLEARRVLKVVLPNKLRDNTFT
FT                   EVLMDDVATKRCLAQLLLTLNEEN"
FT   CDS_pept        complement(403738..404733)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000224152" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17437837"
FT                   /locus_tag="CAGL0M03575g"
FT                   /product="Similar to uniprot|P38629 Saccharomyces
FT                   cerevisiae YNL290w RFC3"
FT                   /function="ATP binding"
FT                   /function="DNA clamp loader activity"
FT                   /biological_process="DNA replication"
FT                   /cellular_component="DNA replication factor C complex "
FT                   /protein_id="CAG62477.1"
FT                   /db_xref="GO:0003689"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005663"
FT                   /db_xref="GO:0006260"
FT                   /db_xref="HOGENOM:HBG533331"
FT                   /db_xref="HOGENOM:HBG541599"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR013748"
FT                   /db_xref="UniParc:UPI00003B7076"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJU3"
FT                   /transl_table=1
FT                   /translation="MMTEDRDNLPWVEKYRPQTLDDVYGQREVVGTVKKFVQEGKLPHL
FT                   LFYGPPGTGKTSTIVALAKDIYGKNYSNMVLELNASDDRGIDVVRNQIKDFASTRQIFS
FT                   KGFKLIILDEADAMTNAAQNALRRIIEKYTKNTRFCILANYSHKITPALLSRCTRFRFQ
FT                   PLPNDAVEKRMANVLVHEHLRISPAAKEALLELSNGDMRRVLNVLQASKATLESPEDEI
FT                   TDEVIYECCGAPRPQDIQTILKSILEDDWSTAYDTLTRIRSSNGLALIDLIESIVKILE
FT                   EYKLKKEETRISLLSQLGDIEYAISKGGNDKIQSSAVIGAIKSSFELELV"
FT   CDS_pept        404993..406768
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248364" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18501145"
FT                   /locus_tag="CAGL0M03597g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /protein_id="CAG62478.1"
FT                   /db_xref="HOGENOM:HBG191085"
FT                   /db_xref="HOGENOM:HBG397409"
FT                   /db_xref="UniParc:UPI00003B7077"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJU2"
FT                   /transl_table=1
FT                   /translation="MLLWVLFLYLLASGSAFRFGGNDSWWNRRDLAAGGSEVAVDMQLL
FT                   DIVNKADGGSTSTSSDVGASSSAQSNADDTNGDGDDDDGDDDDDDDGEDEPQIINSNLI
FT                   YEWTPIISKMTPGKVDNYMFNINPESTGLGFAPSYEILIFLSGNICQQPTNSTDLQIRV
FT                   YYSFDEKMLSNISLGNFETFSNGYLEALQISPVNHTSNGTTLNSKNLYVSVRLWDLIND
FT                   KEVDKDDPNIKNLTSTEWDYRLSISENDLVFQWDTRSWIDVLDTDSTSALISTGNVTDD
FT                   GQIYSNYTIYDPTLYDLYLYTYDEYQKFLNVSELSLCAIKNGPHLVSSEGASATNPPLE
FT                   MLQETGLKIQKRIAESSSGIAEQFYITGLTPNTTYAAFLTKKIGKGQSLSNVGGVLFDA
FT                   EIFTTQTSDACSLIFGMSFCSDNAYSVPSSEFTNGNKSDLAIEYDNIASALYSNFSKAL
FT                   QLVPCDADLDARYSPIRTCDDCATSYRDWICAVSIPRCSTTESSSYIYRSKTDNRNSYV
FT                   NKFIKPTEDYYEVLPCIDMCYAIVRDCPSVFNFKCPDQESEPELLFQSYNIFKQSSPFI
FT                   TCNFIGNASYLKIHK"
FT   CDS_pept        complement(406841..408055)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000176412" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18501146"
FT                   /locus_tag="CAGL0M03619g"
FT                   /product="Similar to uniprot|P48567 Saccharomyces
FT                   cerevisiae YNL292w EXM1"
FT                   /function="RNA binding"
FT                   /function="pseudouridine synthase activity"
FT                   /biological_process="tRNA pseudouridine synthesis "
FT                   /protein_id="CAG62479.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0009982"
FT                   /db_xref="GO:0031119"
FT                   /db_xref="HOGENOM:HBG175930"
FT                   /db_xref="HOGENOM:HBG397258"
FT                   /db_xref="InterPro:IPR002501"
FT                   /db_xref="InterPro:IPR014780"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniParc:UPI00003B7078"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJU1"
FT                   /transl_table=1
FT                   /translation="MNGIFAIEKPSGISSNQFMMQVQKIFNNSAVFSKEIERATAERRK
FT                   QFEQQTGKKASKRKLRKVSKVKMGHGGTLDPLASGVLVLGVGTGTKQLSQYLSGTVKVY
FT                   ETEALFGISTTSGDSEGEILSRNSVKHLKLEDVKTVEEKFRGSLKQTPPIYSALKMNGK
FT                   SLHEYAREGKPLPRAIEPRQVTIYDLEILPKTLSKDHDYKLIETEDESNSQIVKDLNAN
FT                   MLFDTLYYSKEYVEKMNLPSEVAAIEPPIPLTDEEKQEIGELKDKYRAPLLHAKASVSS
FT                   GTYIRSLVSDIGKAMRTSCYMTKLIRIQQQEWSLEKNNVFKLEDFTDKDEQVWAKVLEI
FT                   VLEKGSSVNIVEELKNAESLYQQQIKDLKVKETEDLAGATGSTAQPVVEETEHNDLKRK
FT                   HEESL"
FT   CDS_pept        complement(408582..410747)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248756" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21044613"
FT                   /locus_tag="CAGL0M03641g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /function="Rab GTPase activator activity"
FT                   /biological_process="regulation of Rab GTPase activity "
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAG62480.1"
FT                   /db_xref="GO:0005097"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0032313"
FT                   /db_xref="HOGENOM:HBG058940"
FT                   /db_xref="HOGENOM:HBG397500"
FT                   /db_xref="InterPro:IPR000195"
FT                   /db_xref="UniParc:UPI00003B7079"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJU0"
FT                   /transl_table=1
FT                   /translation="MSSENLIDDAGVVSETTQPQEVHGSTDAPARTQDSDDVPKSNRAV
FT                   LSTAGLRLTHASRSDLKKPVLGFPKKSPSLPNFHENVQSDNENNSDPTLSKLLDESKFV
FT                   HNSHRLNFSLLKDDQPIDESDDTSGIETKEVKIEVKSQLHVPKTHKRTATLGGVSMNED
FT                   DGNLSVIDMYGDEVESRVSKPQVPAEATQVDNDESQDEEVPPHAGSNTSENPGQHNTEK
FT                   ATTEAAMTQEMLREQQIKADRRQSTFHYDRYGFKKQTNYVSEAKYDSWWNEYSQYCIRR
FT                   KHKWKQLLEKSGLPVDNDSPTRFPSKSEKLKRYVRKGIPAEWRGNAWWYFARGQDLLNR
FT                   NKDRYDQLLERMEILLSSDKKKIQDLDIIERDLHRTFPDNLHFQHNSYHGDEPPLISSL
FT                   RRVLVAFSLYNPKIGYCQSMNFLAGMLLLFLDEERAFWMLVIITSRYLPGVHNVNLEGV
FT                   NIDQAVLMLCIKEYLPEIWPYINPELKTINKTSNSLGIKNGGSTGVKNEFLYKLPPITL
FT                   CTASWFMGCFVGVMPVETTLRVWDCMFYEESHFLFKISLAIFKLCENDLSKVRNNGSSL
FT                   LPNYMNGNHKSMSKDESDMEVFQIIQVFPKSLIDPNDIFDKIILKKRLSFNRLDQEEID
FT                   RCRKYVATQRQKYKKFHDNGKNATFSGVNEDVPPAGESGTRIASDTINEALSSEIYGFK
FT                   KGLTGVHWNNSIKEKVRQMRKKIDKDD"
FT   CDS_pept        411533..413152
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17437838"
FT                   /gene_name="RIM21"
FT                   /locus_tag="CAGL0M03663g"
FT                   /product="pH-response regulator protein palH/RIM21 "
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="plasma membrane"
FT                   /protein_id="CAG62481.1"
FT                   /db_xref="GO:0005886"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG124042"
FT                   /db_xref="InterPro:IPR014844"
FT                   /db_xref="UniParc:UPI00003B707A"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FJT9"
FT                   /transl_table=1
FT                   /translation="MAVSIYDSLRTPGPKHYKYKICDGIDLGDGLVIDPLNLDSLVVYA
FT                   KNVKWSSFCDYGVPLYLAADTMDTPYEYPPIIMNDWRWFIFNDHYFGKYWGYGLYTILM
FT                   VYSTIFVITVALTVLSFLTVNKGPYKITSLLLKLSSVLASTSIIYFLTSALSTISRQQE
FT                   HYGVANGNVFGTLLNSNLVIATLNLLSMFFYKLCQVSIVARLFERKLEWRIVVFVGGIM
FT                   SIVSFIISAIVSYTDRVGIRNDNLVTLSPFGLLFDIALETCFAFIIVTNVWGTRKTWVS
FT                   HLQMWYLALLTIAIVLLSPAMFLADVGTGLLSAYAATVSPLLYTMSTFVAWEWLERIHI
FT                   LKKAAQVKSLLGQKIYEDEQEGYNFAYYSVNNESNLDTNSDSHISLYNDMFRNSEQFSN
FT                   VGSNLSSKESSSLPAQMNSTGISFPTAVNQVEFQKRKSFLDHLTNFTYSRPYKIYKKSK
FT                   SIIQLRKRNSETVKNERSNEELSIEKVRRRLGLTNERREYVYNTKDIVFASDDDTESEC
FT                   ESNNILNESIDSHFPENGAGSV"
FT   CDS_pept        complement(413333..414814)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17437839"
FT                   /locus_tag="CAGL0M03685g"
FT                   /product="Similar to uniprot|P48564 Saccharomyces
FT                   cerevisiae YNL295w"
FT                   /protein_id="CAG62482.1"
FT                   /db_xref="HOGENOM:HBG124043"
FT                   /db_xref="InterPro:IPR014804"
FT                   /db_xref="UniParc:UPI00003B707B"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJT8"
FT                   /transl_table=1
FT                   /translation="MSLVNSRQYRIMRFVPRICRQYRQFSQGRRKSGAVLKEKENTEVK
FT                   LQDNTTALNGVVNDADLLEPSGGDKTSETKWKRELKKDISSAKKPTTLVPSVSSTDHLT
FT                   DQEIHLEGLFAGSKPLFLGKLASMKSMPSFFDNGVLLSKNFRVINASDDGGEKSLDEFL
FT                   ESVKDNDWNIDNSEQKKVIPWQASISGIEYEDKSFSNIPKHVLSKLRPYKLIKLKMPKI
FT                   VNKQRRASMIKNLKFHNNKVNDELHLVDIFGKPHERDIAKHQLGAASAELDSNMSKEQI
FT                   SAKREHFKELMYYYHRYGFIKSDCDQYKTYVDKQSKLAQKEFQKVTGLVIKPGRSDFCL
FT                   PLHLYVNKRQNSKILLERYLRKKLYRDVISVMLNFSSNISDQSMIKRFKKKLYNIQEET
FT                   IRDLTNILPSTEFEALEADCCIMKSPVSGFKRMHWLKYSKRHNVMWGKNYSKEFNVSGN
FT                   SFALTRSGVRRMKYPVYINWTTYDSTFRAWNHYNM"
FT   CDS_pept        415143..420122
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000074721" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17437840"
FT                   /locus_tag="CAGL0M03707g"
FT                   /product="Similar to uniprot|P48563 Saccharomyces
FT                   cerevisiae YNL297c MON2"
FT                   /function="binding"
FT                   /protein_id="CAG62483.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG058938"
FT                   /db_xref="HOGENOM:HBG202733"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI00003B707C"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJT7"
FT                   /transl_table=1
FT                   /translation="MRRVRNCDVFCVYIDLETSGQSTNGIENMMSRAGASFAVFNKQLD
FT                   ADLHALVAEARRRNSEVKEASHKSIEILKTIKTINDLENHPDFVVPFALACKTKNAKMT
FT                   TIAMQCLQNMASTRCIPEKRMDMILDAFIEATQLAMDIQLKVLQLVPIFFKTYSSYLKG
FT                   GLCKKLLYCCTSLLRVPNKAPIVAGTASATLQQLMDEIFDRLSDKTLESNNDEDEDFEV
FT                   LVNNNDFIKVNAFRYDANLVFSNLCSIVDTKSTEKTDNSLLDITDISTDLALEILESIL
FT                   QNGKQFLIEYEDLQFVLRIKTIPLLLRCMSNSKQFSTVLRCFRCIRLLIDKEFLMIIEL
FT                   ELEVMLSMIIHNLSLDSSILPWQRVLSLEIFNEISQNPTMLNDLYDIYDKYEDKKPILH
FT                   NFLTQSYHILLSDDFKDYIGYSSVIEKIEMPLISNNSFQTKNQYMQMLDKNTAPNVNIT
FT                   YIIWLIVNCTNCWSEKLSSQAVALTEIENKSLRNTTKDQLHVTLNGLFENLFNIHTLLL
FT                   QSSTIDTTIFHNIVRAFQKLTHCAGMLGEVSKVDRCLDYFRKAIITVEHASNTEKDLKV
FT                   NAPSHIRKSSGSAMLSTLSESIVGPDLNKDIQKENDNIQLYPQSINSKQVSLFRALTSL
FT                   AISLGPNFSAKSWYFLFTAWNWVYYFIYGPSNDILNSLNIDEEFISHDLSRNDLASIEN
FT                   TIHSFHDATKSYPLQTLIIMLTELEKLSDLTLNLNPKDQVGYQPFFNNSEFSVAIYNPS
FT                   FFISEIAELTSSNMSRILASTKTSSYWDKFIDYMVSQMADRKRTFALRLYCSHVIASVY
FT                   KTCTNEIYEIEDTNLRKTCFTKYEQIFTSSLNRIMASIEVLEVNKLNILNENLNTEGDI
FT                   IFQVLNTLKEQLNEFGDMISDSWVTVFSIINSPFRWIDSNISTLLQDDSDDLSLIDGII
FT                   MKQKNMIQVSFDVFKLITDDFLKNLHLNVIPDVIDTIVAFVNQEKILNVSFSSISQFWL
FT                   VGDYLRSNYSADIEKFRTECDDYFTHPSENNAEFIRAIKSPESTISQKYYGIWLYLLKN
FT                   LLFCSLDKRNEVSVGAIQTFFRIIDSHSSTFPSWQAIFNNVLYPFLNTERSDEQLQTNL
FT                   DCLNVTLKGLVQLFSQKFSDFDEYNKNAAEWSALLQLFIKLLQCPSTGVRYVTIKNYGT
FT                   IVTELCTKENIPTNLLDLCATIWTDYNIGYSDFGNSSQLSEKTDYDCISELLLSFPSLC
FT                   TMIDSVKDDNNVFYEKSMSLLLSAVKFPLLPEHSRDQAKPSTLQNAVLEGMSLIYTKLN
FT                   KNNIFVYFVHLSMISTLLFDTRDKIEKKLAPKLHENAISRIPTFEALSYKSLQMLEKQL
FT                   SELKSAEQPRNKYVLKIIRNLREIIVSKSLIDLSTDGSRPLWVLASSCYRSFLACIDNV
FT                   SDCFANDSEGQQEFIEIFMSIFLTPLRRRDTKVDSMTEKSDLSEFDQYSQLFKNKSLMP
FT                   LFTSDHYDLLVRNIWDASLIYEFDDIQKAILQDSGGPKNCEKILSHLNDLEVFGLTRTQ
FT                   DTLSKVSCSKRCLQELISFALLDDKDMSELKYLTFPYIVSRISLLLGKYISDEFLSGSA
FT                   PIPKLRGEEMNILLNGLLKLLDNLLRSKVPISKEVESLAHLYPLVLRTIPVSHKLTGLQ
FT                   NTVLELSLSFTKLISASSHQP"
FT   CDS_pept        complement(420316..422901)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000234202" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17437841"
FT                   /locus_tag="CAGL0M03729g"
FT                   /product="Similar to uniprot|P48562 Saccharomyces
FT                   cerevisiae YNL298w CLA4"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="CAG62484.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG537393"
FT                   /db_xref="HOGENOM:HBG755340"
FT                   /db_xref="InterPro:IPR000095"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001849"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="InterPro:IPR015750"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI00003B707D"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJT6"
FT                   /transl_table=1
FT                   /translation="MSLSAAAAKISDSDFQSIGPAPRPPVSAGGAAFNKTQPITRYMSQ
FT                   LDLNSGRANRSNSNVRRKSGWVSYKDDGLLSFLWQKRFMVLNDSALTLYKNEKVTEDPV
FT                   LKIPLTVIVSVSKNQLKQYCFELTRVSERNSSNGGQSGNTDSMAKKTIYIATKTETDLI
FT                   SWLDSIFAKCPLLSGVSSPTNFTHKVHVGFDPETGSFVGMPTNWEKLLKHSRITGEDWN
FT                   NDSAAVIQVLNFYQEYNNGEGSTYGAGSTTSVSSGSTNSSQINLLKDTNTSTNSSDKVS
FT                   PISQANSMVPQRRAPSPPKQSSTVNSVNSVNVVPSQNSSQQAINMPNRSNTPIRQGSSP
FT                   YQNNISSKNNMAPRMQAPSPAGGNKIQNSLPKLATHNNYNQQQGFVNKYPSPGSSPGSS
FT                   QPPSPINGYRPHHNMSNPYANKGPGSPLNARPNQQTTIQNQVPFNQRNGSQQQSNYPMK
FT                   VYPTIPVLKQPQQGGGYPNQNVIQNQTSVNAANMAMRQQQQQQNKINQNNPPAALQPVR
FT                   QAPKKPAGVSKDGAEKAKKTSKPTMSNAEIMSKLKQVTLDADPSTLFKMIEKAGQGASG
FT                   SVYLAERTEIIEADGPQHQRGGTEHEDPLIGDKVAIKQMVLSKQPRKELIVNEIMVMND
FT                   SRHENIVNFLEAYLKTEDDLWVVMEYMEGGSLTDIIENSPTNGSAYSPLSEPQIAYIVR
FT                   ETCKGLKFLHDKNIIHRDIKSDNVLLDTKARVKITDFGFCAKLTDQRSKRATMVGTPYW
FT                   MAPEVVKQKEYDAKVDVWSLGIMAIEMLEGEPPYLNEDPLKALYLIATNGTPKLKHPQS
FT                   LSLEIKRFLSVCLCVDVKYRASTEELLHHSFFNIACEPEDLTSLLENKK"
FT   CDS_pept        complement(423750..425630)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000246586" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21044614"
FT                   /locus_tag="CAGL0M03751g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /function="nucleotidyltransferase activity"
FT                   /protein_id="CAG62485.1"
FT                   /db_xref="GO:0016779"
FT                   /db_xref="HOGENOM:HBG124542"
FT                   /db_xref="HOGENOM:HBG395964"
FT                   /db_xref="InterPro:IPR002058"
FT                   /db_xref="InterPro:IPR002934"
FT                   /db_xref="UniParc:UPI00003B707E"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJT5"
FT                   /transl_table=1
FT                   /translation="MRGDRSKRKVAKYQKKESARVKRLRRSSFNALQRNIEVFNDNKEF
FT                   LNKYENLELDLSDPENRTHLLSEYNDDLTQSDGESKADNHNDSYDTIPVIDIDSGDEGI
FT                   VSDIKISGGKLEDNDDFIAFSSSSEDENSGAENNESEDYLSSGNTSSDDELAGRRNAER
FT                   ELNADFPWLLNHDHSKQKEISDWLTAEIRDFVAYISPSREEIETRNKTIAKIRRSVKRL
FT                   WTDADLQVFGSYATDMYLPGSDIDCVVNSKSGDKENRQYLYELARHLKNDGLATRVEVI
FT                   AKSRVPIIKFVEPESDIHIDVSFERSNGLEAAKLIREWIGDTPGLRELTLVVKQFLHAR
FT                   RLNDVHTGGLGGFSIICLVFSFLRLHPRIITGDIDPLDNLGVLLIEFFELYGKNFAYDD
FT                   VAICVDDSRATYKPKTSCRFYPPARTSFTLAIQDPGDPTNNLSRGSFNVRDIKKSFSGA
FT                   FDLLVNKCFELDAATFKNRVGKSILGNVIKYRGAPRDFNDERALVENRAIIENEHYHRK
FT                   RARVVHADDEDTSDEDDMFINISANEEETEEMYKVEKVEKVVKKRKIAKADTNTKTKTK
FT                   TKAKARNHTSIDQLMGIPEDEEPPVIQEREKKSLSMQDKRDYWLSKGQAL"
FT   CDS_pept        complement(426518..427099)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17437842"
FT                   /locus_tag="CAGL0M03773g"
FT                   /product="Similar to uniprot|P48560 Saccharomyces
FT                   cerevisiae YNL300w TOS6"
FT                   /protein_id="CAG62486.1"
FT                   /db_xref="HOGENOM:HBG124045"
FT                   /db_xref="InterPro:IPR000420"
FT                   /db_xref="UniParc:UPI00003B707F"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJT4"
FT                   /transl_table=1
FT                   /translation="MKFSTASILAIAASVASAGTVVSDGVTYVDITTTPVVTTSAVSTV
FT                   KTTSTPYTTTTVSTKPASVSSSANSASAAKGNAAVISQIGDGQIQATTATPAKPSSAAP
FT                   AKPSSAAPVSPASSSKASPSSVAPASPSIEQQKSSTLSTSAVKTNPAVVSQIHDGQIQA
FT                   STLQQQLTNAAGKNSATFGAALLAAVAMLL"
FT   CDS_pept        complement(428607..430148)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248803" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17437843"
FT                   /locus_tag="CAGL0M03795g"
FT                   /product="Similar to uniprot|Q99383 Saccharomyces
FT                   cerevisiae YOL123w HRP1"
FT                   /function="nucleic acid binding"
FT                   /function="nucleotide binding"
FT                   /protein_id="CAG62487.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="HOGENOM:HBG058606"
FT                   /db_xref="HOGENOM:HBG208282"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniParc:UPI00003B7080"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJT3"
FT                   /transl_table=1
FT                   /translation="MSSDEEDFNDIYGDEHQDQQQTVSNESKPVDSTTAPSTESASVPM
FT                   DPLAALQALSSNLNNSNNTDNNNDKDTSSGSQTTADGNAVSSEQNGSNVSSEPQVSNQT
FT                   QNSEQRESIEEANRRQVKADLSRENCKMFIGGLNWETTEDGLREYFSKYGNVVELKIMK
FT                   DPNTGRSRGFGFLSFDAPSSVDEVVKTQHILDGKVIDPKRAIPREEQDKTGKIFVGGLG
FT                   TDVRPKEFEEYFSQWGTIIDAQLMLDKDTGRSRGFGFVTYDSPDAAEKVCESRYREFKG
FT                   KQIEIKRAEPRHQQKQAGQQAVSPPVAGMGMNPMSNPMANPMAGMYQNPMMGGFNPMFN
FT                   PQAMQDYYQKMQEYYQQLQQQTGMDYSQMFQQQMSMMMPGFQMPPMNADGSGSPLNNAG
FT                   SENTPSGDDHNGSDNSSSSNVQTIGGDSNDSNSASNERNEDGSNRMKKNSLPKNIPRGP
FT                   RGPSERNDRGSYHRDRSGGSRHGGYHGSSNGSYRRERGGYNGGRRSNGYHPYNRS"
FT   CDS_pept        complement(431237..432664)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000141968" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20195769"
FT                   /locus_tag="CAGL0M03817g"
FT                   /product="Similar to uniprot|P48559 Saccharomyces
FT                   cerevisiae YNL304w YPT11"
FT                   /function="nucleotide binding"
FT                   /protein_id="CAG62488.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="HOGENOM:HBG058605"
FT                   /db_xref="HOGENOM:HBG202713"
FT                   /db_xref="InterPro:IPR013753"
FT                   /db_xref="InterPro:IPR020851"
FT                   /db_xref="UniParc:UPI00003B7081"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJT2"
FT                   /transl_table=1
FT                   /translation="MADGRRKRYSLNVVVSPSPSERRFSGMDFTEASGTSPWNSPFGGG
FT                   STESFHFDKSNRNSRHSFYRTLSSSNSLSGGSVYRNSSVGLGLSSSAYMNDVMCSRESL
FT                   SMSAIESNAANIKVLFIGDAGVGKTAMILNYCRELPTRAQWEHIIGLSPTPNRAGSSNR
FT                   SGRNQMVRRSLTARAYERKSDIMQDQRKRYSSTDYDDYKENDFMAQRDFKIVKDVESES
FT                   SSLNYDPEELIVDTKTTIGVDIKTNIINIDNRIFNCILWDTAGQERYRNAIMPSLYKKS
FT                   NAIILSYDITDKCSFKNSYEHWLVEAMGHFAARDYEKARFYFIGNKTDLYKQREVTHED
FT                   VIAAIEEIESRYGLVIAGNFEVTCKNFDSLNEAMNNITVDLVNNGCYEEKAEQELEGTA
FT                   VLEEDEEMKESTTLNEQYDDEVVSTSNDEDSGEDSDGSLEPVIRKRTTAKTRIIDISKP
FT                   KNQPNILDTSHKMSCCT"
FT   CDS_pept        433214..434101
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000060393" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19348986"
FT                   /locus_tag="CAGL0M03839g"
FT                   /product="Similar to uniprot|P48558 Saccharomyces
FT                   cerevisiae YNL305c"
FT                   /protein_id="CAG62489.1"
FT                   /db_xref="HOGENOM:HBG347532"
FT                   /db_xref="HOGENOM:HBG595196"
FT                   /db_xref="InterPro:IPR006214"
FT                   /db_xref="UniParc:UPI00003B7082"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJT1"
FT                   /transl_table=1
FT                   /translation="MSVNKNSYVPLPNESAPPPYQEEDPAPNLYNVPDDFKWSTNVSAC
FT                   EPLVRQQFLHRVYSILSTQLLATLSMGYLTYKWEPLREFTNSNTWLVILASIGSILTCI
FT                   WLAFAPSVDDYVPEDEANYTGETETNNELRPAKAPWYYLSKRGQYAVLSVFTICEAYSL
FT                   STITLAYDPQIILSAVLITTVVIVGVSLVALSERFQFLTESATTIYFWLNWGLLLLFGM
FT                   VLTGVFFGFSSKMNIFYAWFGAALFTIYLLMDTQMIFRKVRPDEEVKCAMILYVDIINL
FT                   FLHILRILSSRENE"
FT   CDS_pept        join(complement(435566..435578),complement(434549..434964))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000231365" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18501147"
FT                   /locus_tag="CAGL0M03861g"
FT                   /product="Similar to uniprot|P04456 Saccharomyces
FT                   cerevisiae YOL127w RPL25"
FT                   /function="RNA binding"
FT                   /function="nucleotide binding"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="CAG62490.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG439330"
FT                   /db_xref="HOGENOM:HBG532383"
FT                   /db_xref="InterPro:IPR001014"
FT                   /db_xref="InterPro:IPR005633"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR013025"
FT                   /db_xref="UniParc:UPI00003B7083"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJT0"
FT                   /transl_table=1
FT                   /translation="MAPSAKASAAKKAVVKGTNGKKALKTRTSATFRLPKTLKLARSPK
FT                   YASKSVPHYNRLDSYKVIEHPITSETAMKKVEDGNILVFQVSLKANKHQIKKAVKELYE
FT                   VDVMKVNTLITAKGNKKAFVRLTADYDALDIANRIGYI"
FT   CDS_pept        complement(436916..437539)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000094284" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18501148"
FT                   /locus_tag="CAGL0M03883g"
FT                   /product="Similar to uniprot|P42847 Saccharomyces
FT                   cerevisiae YNL306w MRPS18"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="CAG62491.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG191219"
FT                   /db_xref="HOGENOM:HBG397603"
FT                   /db_xref="InterPro:IPR001971"
FT                   /db_xref="UniParc:UPI00003B7084"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJS9"
FT                   /transl_table=1
FT                   /translation="MLRSLGSKWLLAGRRLNSSVADGGRISFAGAVKDLTRKDEVANIS
FT                   NPYGEKRAMKGKSLEVPLKYKLNCVFRKNNTHFTYSAVVEDKNYLVNNPELSYNEKYLY
FT                   YLRLPQKVKFAISTGCLGFRKALRGEYEAAFQTTTKVFQMIKEKGLMDKDIEIIMDDFG
FT                   KGRTAFIAALNGKEGNEIRRKVTRISDKTALKFGGVRSPRMRRL"
FT   CDS_pept        437944..439704
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248807" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18501149"
FT                   /locus_tag="CAGL0M03905g"
FT                   /product="Similar to uniprot|P42846 Saccharomyces
FT                   cerevisiae YNL308c"
FT                   /protein_id="CAG62492.1"
FT                   /db_xref="HOGENOM:HBG359175"
FT                   /db_xref="HOGENOM:HBG396601"
FT                   /db_xref="InterPro:IPR007851"
FT                   /db_xref="InterPro:IPR018034"
FT                   /db_xref="UniParc:UPI00003B7085"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJS8"
FT                   /transl_table=1
FT                   /translation="MPRKKSAAKKAREAAAKTQGEVPEQKISEEVEAKPLDANDEHEDA
FT                   SDESSSEEEDDYGELLTEEVEDGIKNVLTAIRNNEKDKLLNPEVKFFEDPEKAAEKMEV
FT                   SEKHKPVYLKDYHRMNILSGNALKDDDELDEDELETVDGKQSFVSQQREERQQLLNEIN
FT                   NAFDGDDQKSEEENDDEDDDGFLKKKEKKMEVSKTDPLREIDPNKDEDKFLEEFVNQHA
FT                   WIPKKGDKIISLDGGMDMEEDDEEFDDAVEQFENAYNFRYEDPNAAEIVSYARTQATLR
FT                   RSKTSSRRRKREEEKSHKEEEKKEKEEKIQKKKVKKVNKVTDILTQIKKEYGADISEEM
FT                   VEKITSTLMNNDYKEDEWDNVVAELFNEEFYAQEGKPEWDEDDEIMADFYKEGEEVNDG
FT                   QEPPELDTNDTTETNDQDNAGRSKKKSKIEEKKSKKKEKKQLQEMVETAIEKNKMAIID
FT                   EVEEERGRSREKEELKFRYREVSPESFGLSTREILAADDTDLNEFIGLKKFAPYRPKEL
FT                   RAKDKRKVTKSRRLREWKKKVFNNESGLTEEQFIALMEKEGSSEPPMKKHKKSHDKDKK
FT                   NKNSHKKNKK"
FT   CDS_pept        complement(440211..441497)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000865" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18501150"
FT                   /locus_tag="CAGL0M03927g"
FT                   /product="Similar to uniprot|P42845 Saccharomyces
FT                   cerevisiae YNL309w STB1"
FT                   /protein_id="CAG62493.1"
FT                   /db_xref="HOGENOM:HBG124046"
FT                   /db_xref="HOGENOM:HBG202699"
FT                   /db_xref="UniParc:UPI00003B7086"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJS7"
FT                   /transl_table=1
FT                   /translation="MADISREKEDELASKILERAQLAQMRRQLKIGLSKVPSETRDDEQ
FT                   YEENHTKADITDDSTDNYTLGSAYSATPRSRASMVSPRKRQSGDPREMSAIMNASPLKK
FT                   VLLDGIKDGESSENVSPVSRRFVRPSTPPKTASRPASVHIPQKSSYDNRTPTTPKLTNA
FT                   HTAFTNSLNSAEKNAMTKADTATLTKVPSTPKRGNSSQKKQAGVNKNNTDDSTGADLLM
FT                   YLATSPYSSARAHNTTYNRKNSVSSVTKVPTTPYTSLYMSHSHTQEMNDDAVRFSALKA
FT                   SLNSPQSTFKVPHVVGSQANNGQWFPDILMDSPSLYLGSALSPSANKKKLASPGPGSGS
FT                   GHAVSTHLPVPSTPSRELHHQTNTNLLKTPNFNMGDYLQNIFSPSPQVSLNDLGNSHMT
FT                   EMQAKSALAVGPVEGGSVHSSPTRIASDV"
FT   CDS_pept        441978..442553
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000141576" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17437844"
FT                   /locus_tag="CAGL0M03949g"
FT                   /product="Similar to uniprot|P42844 Saccharomyces
FT                   cerevisiae YNL310c"
FT                   /protein_id="CAG62494.1"
FT                   /db_xref="HOGENOM:HBG124047"
FT                   /db_xref="HOGENOM:HBG448469"
FT                   /db_xref="InterPro:IPR007853"
FT                   /db_xref="UniParc:UPI00003B7087"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJS6"
FT                   /transl_table=1
FT                   /translation="MLRLLRGTGAVRALRYTNARSLNRAMAGAVVSGRHLGGRAAPLCR
FT                   ASQFSTTVAKLQSQDNDKTYPLGSFKVDQPQIMIAFTCKKCDTRSSHTMSKQAYTGGTV
FT                   LITCPGCKNRHLIADHLKIFSDDRITIEDILNAKGESVSQSTDDLVFEDIPESLKETIG
FT                   HYASDAPESYKKRLDNEKVHTLPHPEEK"
FT   CDS_pept        442995..445340
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000141854" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20195770"
FT                   /locus_tag="CAGL0M03971g"
FT                   /product="Similar to uniprot|P42843 Saccharomyces
FT                   cerevisiae YNL311c"
FT                   /protein_id="CAG62495.1"
FT                   /db_xref="HOGENOM:HBG058599"
FT                   /db_xref="HOGENOM:HBG202693"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="UniParc:UPI00003B7088"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJS5"
FT                   /transl_table=1
FT                   /translation="MRKLQLFGGSKYFSLSQKEGKPVHKNINNQEKVEDEVEDETDDQL
FT                   SLLSLPPKILRRILSHLDSASLIALTHVHSKLYKIISNEFLFSNIVLDSKISLLKFSAM
FT                   IHSEFHTSNALVNGTRGSTSPQENKSQNVRFLVRSVEFVNPQSHDSLLKYSKFHKKNDT
FT                   GSLIGGSYNFNTSSEIPISKLPTSPKAEDRPKSSSLAQTSFGGKLDTHENTRSSSRTRS
FT                   TNHYKCYKLMEKFEHKFSGYTYIELMLDIIDYLPNVTHVKLSNVDPSFKVPLWYSVFND
FT                   GSRDFFKKIIKGQQSITNDDLRTFELSKEFVREYEKKFYHLPLLKSLEISAAIDKKQTK
FT                   PVVFRPNLICCFGVIQELTLENITLDKESFETPMEFVPLHLRLEETNDLHVNGKPTSLE
FT                   LYNLHSPVSSLTLRACTIIQGNGILRLIHNYFKDVKNLQLLELSSKYDLFLCNCFSSLS
FT                   NLTIDCNSACFTNEMTVNDDYYLKEITLSNEDETNCDDNISVTETLLESSSRVVIQAPP
FT                   PTSAVVVSLNLDYISKTSGSNAQENPLPSDSKKPALITKSQGDYFRQLRIPTFHYFYHY
FT                   YKSIWERIPHKNVNINIINIPFTNVYPMSPKGLAESMIVSSDANDQETLIAYRPSGYSA
FT                   HDVPTSSIIHVSEEAREFNSTQYYWENGVRRCYLDAIQELRESSSYYQSMTQHEILDMI
FT                   DYEAINGYQNFKFYKDIPNVNLWCFLKSLSKFKSVKINLLRTWLYCTPRSRYDWELLLK
FT                   PVLNVNVPVIVTDRDGYVVYSYGQHKMH"
FT   CDS_pept        complement(445590..446429)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248662" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20195771"
FT                   /locus_tag="CAGL0M03993g"
FT                   /product="Similar to uniprot|P26754 Saccharomyces
FT                   cerevisiae YNL312w RFA2"
FT                   /function="nucleic acid binding"
FT                   /protein_id="CAG62496.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="HOGENOM:HBG176493"
FT                   /db_xref="HOGENOM:HBG512106"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014646"
FT                   /db_xref="InterPro:IPR014892"
FT                   /db_xref="InterPro:IPR016027"
FT                   /db_xref="UniParc:UPI00003B7089"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJS4"
FT                   /transl_table=1
FT                   /translation="MATYQPYNEFSSVTGGGFENSDSRPNTMDSGTGSNTNTLTPVTIK
FT                   QILDSQQAIQDGPFITHNQELHHVCFVGVVRNITDHTSNIYLTLEDGTGQIEVRKWSDD
FT                   SSDVAQGTDGDDGFGEMKGGESQIAQQYQIGTYVKVFGALKEFGGKKNIQYAVIKNVDS
FT                   FNDVIAHHLEAIKCHAIANGKMQGSSLASGDNEGAGQSLFVQDDEGAGNKNPLQRILEF
FT                   CKQQCVGKDANTFAVPIPLISQSLDIDETTVRNCCTTLTEQGFIYPTLDDNHFFAVD"
FT   CDS_pept        complement(447059..447889)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21044615"
FT                   /locus_tag="CAGL0M04015g"
FT                   /product="Similarities with uniprot|P21705 Saccharomyces
FT                   cerevisiae YNL314w DAL82"
FT                   /protein_id="CAG62497.1"
FT                   /db_xref="HOGENOM:HBG124048"
FT                   /db_xref="UniParc:UPI00003B708A"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJS3"
FT                   /transl_table=1
FT                   /translation="MRVESQQSAIVLLELMDKYKPHLKPYAYRLHSWERVLADYNSRLH
FT                   TKYRQIRTIKNKFERLKYMYLQDRGSEQFKGYSEAELVLLERLISESDGVSVKDPIVRD
FT                   NGMSQGALASGGRPPEPALVPRLPMLGGQLLKQSTINNIIEPTPPPLDTISIGMPKNAK
FT                   KPSIQDTGLAGQPTMEDSTVTAGTPLDTSIFDGDTRIPTRKNSLDVHTIQDLVRKLSDQ
FT                   QKQEDQLMIMKEAELSKKYMTQADFLSYKKQNRAIQLQILNVITSLLETPTKES"
FT   CDS_pept        448125..449054
FT                   /evidence="1: Evidence at protein level "
FT                   /gene_family="HOG000034183" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17437845"
FT                   /locus_tag="CAGL0M04037g"
FT                   /product="Similar to uniprot|P32453 Saccharomyces
FT                   cerevisiae YNL315c ATP11"
FT                   /biological_process="protein complex assembly"
FT                   /cellular_component="mitochondrion"
FT                   /protein_id="CAG62498.1"
FT                   /db_xref="GO:0005739"
FT                   /db_xref="GO:0006461"
FT                   /db_xref="HOGENOM:HBG058597"
FT                   /db_xref="HOGENOM:HBG397660"
FT                   /db_xref="InterPro:IPR010591"
FT                   /db_xref="PDB:2P4F"
FT                   /db_xref="UniParc:UPI00003B708B"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJS2"
FT                   /transl_table=1
FT                   /translation="MLTRSLVPALRRRITVVARQYSIEDRYKEKLLQKAKAEGVESIEE
FT                   LKKRLADQIEEKKKELNKIDPLRELEQHLNAGSRIHTNKEHKTTKMSNKSNEKSGNVLP
FT                   KDKPYKTLDDYLKLDKIKDLSKQEVEFLWRAKWSNRDDSLVAVVPYVKTFQGMYKYAVK
FT                   NPLFVLPLPRENAADGNKADKDSVPVELQYVQWQFAGPNTVHCLITSLAEYKLHQDFAK
FT                   PHTTIQFHLDLANDKDMVLMNGQVESDSNVSLQDAQLLLLNVQRFYGAMGSETSIAKER
FT                   IQLLEDFNKGSQNFDINKLIQLAQSMEN"
FT   CDS_pept        449398..450450
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000018970" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17437846"
FT                   /locus_tag="CAGL0M04059g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /function="prephenate dehydratase activity"
FT                   /biological_process="L-phenylalanine biosynthetic process "
FT                   /protein_id="CAG62499.1"
FT                   /db_xref="GO:0004664"
FT                   /db_xref="GO:0009094"
FT                   /db_xref="HOGENOM:HBG411300"
FT                   /db_xref="HOGENOM:HBG693866"
FT                   /db_xref="InterPro:IPR001086"
FT                   /db_xref="UniParc:UPI00003B708C"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJS1"
FT                   /transl_table=1
FT                   /translation="MTVKVLFLGPEGTYSHQAAIQQFSHLVDYNVVYEAVDSIPSCVDK
FT                   LIEHDNDIEDVDLYSVVPLENSTNGQVVFTYDILRNLMQGSNGTNMRIRENQVVAPITI
FT                   VGEQYVSILHCLISPDPSIGIESLQNYDTLKIYSHPQVWGQVSKYLVELQKRFPNLKLE
FT                   RINCNSTSEAVLQAAEEQSSSQSSGILNLAIASEIAASIYQCYIIQHSINDILGNTTRF
FT                   LVFKKKSNHRRLLAPPSATPQRVSLLTFTIKQDDPGSLVEVLSVLKDFSLNMCSISSRP
FT                   YLLRSEQISQQGENFRRRNWQYIFFIEFYIEQDKEFDKDKFCDRIDALCGDWCHWGRFP
FT                   RDICYYKNTA"
FT   CDS_pept        complement(450572..451939)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000213918" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21044616"
FT                   /gene_name="PFS2"
FT                   /locus_tag="CAGL0M04081g"
FT                   /product="Polyadenylation factor subunit 2 "
FT                   /biological_process="cell division"
FT                   /biological_process="chromosome segregation"
FT                   /biological_process="mRNA processing"
FT                   /biological_process="mitosis"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG62500.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006397"
FT                   /db_xref="GO:0007059"
FT                   /db_xref="GO:0007067"
FT                   /db_xref="GO:0051301"
FT                   /db_xref="HOGENOM:HBG268234"
FT                   /db_xref="HOGENOM:HBG736644"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="UniParc:UPI00003B708D"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FJS0"
FT                   /transl_table=1
FT                   /translation="MDQSAAVEGVPQKKYLTLRRSVDVSSSYNRLYYLKKHGLSLPPIE
FT                   PETSFTANIMPPDAYKRNDRIVNLPTKFTHLSSNKVKHVIPAIQWSPEGRRLIVATFSG
FT                   EFSLWNGSSFTFETIMQAHDTSVTTMKYSHAGDWMISGDADGTIKIWQPNFNMVKELDR
FT                   IHTEGIRDVAFSNNDSKFVTCSDDNILKIWNFSNGQQERVLSGHHWDVRSCDWHPELGL
FT                   IVSGSKDNLVKLWDPRSGQCVSTLLKFKHTVLKTRFQPTKGNLLAAISKDKSCRVFDLR
FT                   ASMNELMCVRDEVDFMELEWSTINESMFTVGCYDGSLKHFDLGQDTEKPIHIIPFAHEK
FT                   CISAIAYNPVGHILATAAKDRTIRFWTRARPVDPNAFDDPTYNNKKMTGWFFGINNDIN
FT                   AVREKSEYGAAPPPASTAFPQQTQYNNNISRVPEIKEPTPTTDKEQRTSILPGLSI"
FT   CDS_pept        452677..454272
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000202870" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19348987"
FT                   /locus_tag="CAGL0M04103g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /function="substrate-specific transmembrane transporter
FT                   activity"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAG62501.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0022891"
FT                   /db_xref="HOGENOM:HBG534647"
FT                   /db_xref="HOGENOM:HBG744444"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI00003B708E"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJR9"
FT                   /transl_table=1
FT                   /translation="MEQVTIGVISLDSSPTENYTLNTAETRQSFQLSGKSEVNTIPGEK
FT                   YEELKMKYIRQHTKAVVLCCLISFGGMILGWDIGTVGGVSIMPSFNNAFGDQTTIVSSA
FT                   KELSNMKRGLYISIFNIGCALGGIMFSRLSNTVGRRVGILTAIAKYTLVLTVQLFSNGN
FT                   FILLLASRFVLGVTVGAISVLVPMFVSESAPIKIRGALVVVYQLAITLGILFGNILNYM
FT                   TNKHLSMVDPMNNMAWKIPMLFGYLWAAIVAVGACITPESVHFLAKIRNDYESAKISYS
FT                   IMNNISVFDHETIDYVNNLLVKQDVYNENDLRNHKFEFLYGKPKYGKRLLIGIMVMAFQ
FT                   QLSGINYFFYYGTSLFKSVGIKDTYATAIILSSVNFISTFAGIYLVESLGRRSTLIYGS
FT                   FGMFICMIFYASFGTLSLRKDLLSFVLIIVTCLFISIFAITIGPVSFVVVAELFPTRTR
FT                   SVSMSICSSFNWLVNFAIALATPVIINRIGFLYGFFFAGCLLLATGFEAFFVPETKNKT
FT                   EEEIDYMFQNNLKS"
FT   CDS_pept        complement(454489..455361)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000007143" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20195772"
FT                   /locus_tag="CAGL0M04125g"
FT                   /product="Similar to uniprot|P42840 Saccharomyces
FT                   cerevisiae YNL320w"
FT                   /protein_id="CAG62502.1"
FT                   /db_xref="HOGENOM:HBG413371"
FT                   /db_xref="HOGENOM:HBG678036"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="UniParc:UPI00003B708F"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJR8"
FT                   /transl_table=1
FT                   /translation="MLYRTFKMIFGGVLALGTISVTAVYLVQNKLVYPSWAQGAREYVD
FT                   TPASKNIPYKEVTLTTKDGIELQAWDIRNEETKSKSTVLILCPNAGNIGYFIPIIDIFY
FT                   SQFGLNVFIYSYRGYGYSKGTPSEEGLKIDADRVMSYLATDDFHKTKKLILYGRSLGGA
FT                   NAIYIASKFSQLCDAVILENTFLSIRKVIPYIFPWISRFAFMCHEVWNSEEDMPHCNSE
FT                   IPYLFLSGLEDEIVPPEHMKDLYDICPSGSKQIYEFPFGTHNTTIIQDGYWEIVRKFLE
FT                   DNKFIEPAQ"
FT   CDS_pept        complement(455977..458901)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000170275" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18501151"
FT                   /locus_tag="CAGL0M04147g"
FT                   /product="Similar to uniprot|P42839 Saccharomyces
FT                   cerevisiae YNL321w"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAG62503.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG058591"
FT                   /db_xref="HOGENOM:HBG398302"
FT                   /db_xref="InterPro:IPR004837"
FT                   /db_xref="InterPro:IPR005185"
FT                   /db_xref="UniParc:UPI00003B7090"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJR7"
FT                   /transl_table=1
FT                   /translation="MSLRPTVSKDKSRPVLVKRVFSVDDDANEVQNDIRYFENLADGVK
FT                   IVLPGSENNIQDSAALSTGGNVAVPVPQGLRDEALVPVDSLRSLSTPDLMESITNLQQK
FT                   LVTPRINGVAAHGNVGSPRFIIHDHTHTHPGDKKSATHHDLYIEELPAQRSNSSQALPA
FT                   GSVAGGNGTSSLTDIPPVDLEASNLGETERLDPDNASRASSIESYTLRERQDAINETHP
FT                   FGIRIWKPALYKKKRSVEKAADEDIHETKLKKITWAVKATNWIWVATCGLFLFTVFASA
FT                   SITVLIAGLFTKSARDYSRLMLRLARYLLYPFGKVVYLIQDKQYLEEDRDEGISVQQFY
FT                   NWVTSYKSRLFFHESQTRPTESDALGNNMHHTSYGSIQKVVGEQTNTESNNPMLDNNGY
FT                   TELPHSTSFQNPSNDHQNSAATQRRLFGRGKWSLGRIVFYAIFHIVLQPIVLFLSLLTW
FT                   LAVFTIPMSNILWNLMYHCRRHPLALGFKSIKNSSNQIIEHYDDKNILLCTFRCAGWHY
FT                   YKFTIDGTNVIVVNLIAMVFFTIFDFYALKEFFNIDLWITSESTVFILCLASIIPLAFY
FT                   IGQAVASISAQTSMGLGAVINAFFSTIVEIFLYCVALQQKKGLLVEGSMIGSILGAVLL
FT                   LPGLSMCGGALNRKTQRYNPRSAGVSSALLIFSMIVMFVPTLLYMMYSGYDVICDDLDA
FT                   TLPLDLYSAYKVMSTSKCHFSHPPLKFDKLYTHVIEPMSIVCAFVLFLAYTIGLWFTLR
FT                   THAATIWQLPIADPPREIVNTEANGIDGILSHEEDHNDEGGGHDAPNWSRSKSTLILLL
FT                   ATLLYAIIAEILVSCVDSVLEDFPSLSPKFLGLTIFALVPNTTEFLNAISFAMHGNIAL
FT                   SMEIGSAYALQVCLLQIPALVLFSVITAIGVDKALISIRDQMFPLVFPTWDLVASMASI
FT                   FVFTYLYAEGKSNYFKGSILILLYVIIIMGFYYQGLIAEWGIIT"
FT   CDS_pept        459618..460739
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21044617"
FT                   /locus_tag="CAGL0M04169g"
FT                   /product="Similar to uniprot|P17260 Saccharomyces
FT                   cerevisiae YNL322c KRE1 cell wall protein "
FT                   /protein_id="CAG62504.1"
FT                   /db_xref="HOGENOM:HBG124049"
FT                   /db_xref="UniParc:UPI00003B7091"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJR6"
FT                   /transl_table=1
FT                   /translation="MRISRLLLIAGVAQAAIVTDFIITTLADGTLSTVTSIYDNAKPKT
FT                   DTDTDTDTDTDTDTNTATGTTKATTTNTNTNTNTNTGTNTGVKLITTSTVVTDAAGVIK
FT                   TVPTVITSGVKQTGTTTGTTTGTTTGTTTGTTGTKKSYVSTITTVDAAGRPVTLTTTIT
FT                   GTNTNTNTNTNTGTANTPYVTTITTTNINGVTVTLTQTVTPTKAAVDPAAANGALTAFV
FT                   VKSKPSDLVGTAPDGRPDPSLVSFTEVPATPVTTVPIDTYITITEGTTRTYTTLRVPTS
FT                   IWVTITNAAGQTVTFQTTYMQRFSSQYLEVASPSSGSIGLGSLQGEVGVVKSVMVMSQS
FT                   ANAAHNNARAGTPVTSICMSLAMAFLTMFTWFM"
FT   CDS_pept        complement(461446..463251)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000248646" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20195773"
FT                   /locus_tag="CAGL0M04191g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /function="aspartic-type endopeptidase activity "
FT                   /biological_process="proteolysis"
FT                   /protein_id="CAG62505.1"
FT                   /db_xref="GO:0004190"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="HOGENOM:HBG252945"
FT                   /db_xref="HOGENOM:HBG398805"
FT                   /db_xref="InterPro:IPR001461"
FT                   /db_xref="InterPro:IPR001969"
FT                   /db_xref="InterPro:IPR009007"
FT                   /db_xref="InterPro:IPR021109"
FT                   /db_xref="UniParc:UPI00003B7092"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJR5"
FT                   /transl_table=1
FT                   /translation="MKFSSLCMLASVAAHSKAAKNVADLSYVKLDFDKYYGETFETAKR
FT                   GRSQADIRVNKRANGYEEVQITNQNSFYSVTLEVGTPPQSVVVLVDTGSSDLWITGSDN
FT                   PYCRGSTGTSGKNMLLEAELKRALEDARDIAKERTTLAPRDDEHNDGLLSWLTGSDGLL
FT                   GGQGGTTITLTDSAQPTAAGTSNGARATINCAKYGTFDTSKSSTWHSNDTAFMIQYGDS
FT                   TFASGTWGMDNLHLSDLNVTGLSFAVANRTNSTVGVLGIGLPALEVTYSGRTAVSGQRP
FT                   YQYDNFPLVLLRNGAIKSNSYSLFLNNASAETGSVLFGAVDHSKYLGDLYTIPMVNTYA
FT                   SQGYKNPIQFEVTLNGLGISSSSDNTTITTTKIPALLDSGTTLTYLPQALVTRIVQKLQ
FT                   ATYSNRAGYYVFSCPSQSDDTEVVFDFGGFHINAPITNFIIGSSGDSCILGIMPQSGGG
FT                   IILGDSFLNSAYVVYDLENYEISMAQANYAGGQEDIEVISSSVPGAVRAPGFSSTWSTL
FT                   ATSFNTQGDIFTVQAAATVSGSATNTGTGRATATGNSNSTRSTTSRSRTSATSTRSDSQ
FT                   KKNDASRTSFTSTLLFVAGLLVSFI"
FT   CDS_pept        complement(463756..464523)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000001121" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20195774"
FT                   /locus_tag="CAGL0M04213g"
FT                   /product="Similar to uniprot|Q12288 Saccharomyces
FT                   cerevisiae YLR126c"
FT                   /function="catalytic activity"
FT                   /protein_id="CAG62506.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="HOGENOM:HBG097859"
FT                   /db_xref="HOGENOM:HBG202458"
FT                   /db_xref="InterPro:IPR000991"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="UniParc:UPI00003B7093"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJR4"
FT                   /transl_table=1
FT                   /translation="MTVAARKVAIFYTDHPNEWSRDDGTFATMAVELLEQAKEHEPYVG
FT                   AEGGIEYRVFDVYNGELPSVDELSSGDYLGLYITGSRYDSFDTETQWIVDLRKLLYRLV
FT                   NETTLPIVGICFGHQVLARSLGAQVGRNPKGLEAGVHGVQLNATGKTLFSRDRLYLSEL
FT                   HSDHVEEVPPGYENWGHTEKSHCQGLYKPQRVLTFQGHPEFTTQLAIKSTQHKHQTGQL
FT                   SDEEYAETIQRCHSNNDGVHAARNIWKLYHGKI"
FT   CDS_pept        complement(464973..467324)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000001122" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17437847"
FT                   /locus_tag="CAGL0M04235g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /function="ubiquitin protein ligase binding"
FT                   /biological_process="ubiquitin-dependent protein catabolic
FT                   process"
FT                   /cellular_component="cullin-RING ubiquitin ligase complex "
FT                   /protein_id="CAG62507.1"
FT                   /db_xref="GO:0006511"
FT                   /db_xref="GO:0031461"
FT                   /db_xref="GO:0031625"
FT                   /db_xref="HOGENOM:HBG124050"
FT                   /db_xref="InterPro:IPR001373"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR014786"
FT                   /db_xref="InterPro:IPR016158"
FT                   /db_xref="UniParc:UPI00003B7094"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJR3"
FT                   /transl_table=1
FT                   /translation="MILTGDTKTFKRAVLEYGVNGNKNSNAEEWNVLLQWLDPAGKKNH
FT                   QLKPPNLLVKTMIEKLLLGSNDYQLLSNIQDYYCWQCRVYFYNEYKRIETLNELKRIER
FT                   HVLFPLKYIPIFEGNNRVENEVRLFGNYLLKTNKKVMSRAVERLRNRMLEDDFELATEI
FT                   VDYFDYCQTDSTSIVLDIILDKIEQFCQLHYTRKWNKRYLIMETFNQFISQYWDQLSSL
FT                   LFCQEDNHTITNTLYKYFEKQFISIRTNEIFDICISNPASVQPTLLELRKEISTVNDFN
FT                   CVVVELLSKFNLKVINPSIVTADALFLYIRTIKTFSILDPSGRYLQTISSYVKPHFRQR
FT                   KDLVHLLLFSMLGLDETDQLNTMPSQVSEEKLTALTNELKDTEICSYTEESDDVVDPMI
FT                   GSFSKEEDSMVLEQVIKRYMEWIPEVPTSFGKGILSDHKLDLFDILLELLESKETLVIE
FT                   FKNLLTKKLLDLRGYTLDKKWSKFLSLLKKRFDNRSTETMDEEDLNNINTIDIMLRDIY
FT                   KSRQIATDMQLDLHNTNVKVYPKIVSALYWSNNSDTQSKAGDFEMDGELEHLLELYSRF
FT                   YSQKQIGQKLELRRDNGSVSLNLSFLDGRTVHCKASLRQYSVLTLFKSPKHDSNFPTEG
FT                   LTISELCARSGMQSKQMADILRYWVSKDVLYFSDGKYRTLEFLRWKGDSTYAAIPDVLE
FT                   ESVVERSSQHEDKQENHVERALPYIKDILLNLGTLKIDKLHALLQSAMPKDSHYSTVNQ
FT                   KQLQDYLDTLVEEGVLSSASNDSYKLPQIR"
FT   CDS_pept        467785..468606
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000112177" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17437848"
FT                   /gene_name="DCN1"
FT                   /locus_tag="CAGL0M04257g"
FT                   /product="Defective in cullin neddylation protein 1 "
FT                   /protein_id="CAG62508.1"
FT                   /db_xref="HOGENOM:HBG202460"
FT                   /db_xref="HOGENOM:HBG206132"
FT                   /db_xref="InterPro:IPR005176"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="InterPro:IPR014764"
FT                   /db_xref="UniParc:UPI00003B7095"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FJR2"
FT                   /transl_table=1
FT                   /translation="MVSRHEKELMKTFQSLTSCTDEGKAKRYLSANNWNINYALNEYYD
FT                   KEVGGFTEDHMIRHQFKYPDELVSLFGHYAALIEEDGTQSITPDGLIDYIQDLGYNLED
FT                   LVTISLAHFLQCKNLENPITEKQFLYFWYNEGCYTLEQMRHYLEDCERKLCNDWKYFTT
FT                   IYNYSFDLNASKQGVVETDIAIEYWKLFFEENRTKLSGIIKVDQAHLDLWCKFLQDEHK
FT                   KLIHKDTWQMLLLFFKKFPSLDAIKTEYNEADAWPYTIDEFYEYLEERNVL"
FT   CDS_pept        469040..471862
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000212524" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18501152"
FT                   /locus_tag="CAGL0M04279g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /protein_id="CAG62509.1"
FT                   /db_xref="HOGENOM:HBG379828"
FT                   /db_xref="HOGENOM:HBG522343"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR007148"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="UniParc:UPI00003B7096"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJR1"
FT                   /transl_table=1
FT                   /translation="MVKSYQRFEQANVFGVISSNSNSVWIEPEASKRKTGNLGQVIVGG
FT                   LENILVWDIKTGEQIAQLTDGLPPGASDAKLSKPAETTFLKYHPETNLLAAGYADGVIK
FT                   IWDLISKTVLISFNGHKSAITVLAFDTTGTRLISASKDSDIIVWDLVGESGLYKLRSHK
FT                   DAITGLWCEDENWLISTSKDGLVKIWDLKSQQCVETHLAHTGECWSLGIIEDMAVTCSA
FT                   DSQVKLWKLDLQAENGSKLTEKGIIEKQSKQRGVEIDFAVAPDGVKFFYIQNADKTIEI
FT                   YRLRKEEEISRALKKREKRLQDKGMSEEEIKEAMGSPVSLMYHLFQVVRSPYKIKSAQW
FT                   TVCSNSKLELVVTTSNNSIEYYSIPYSKREPTQPAPLKLHTIDLHGQRTDIRSTSISDD
FT                   NKLLATASNGSLKIWNIKTKRCIRSFECGYALTCKFLPGGALVVVGTRNGELQLFDIAS
FT                   STMLDNKEGAHDAAIWSLDLTSDGRKLVTGSADKTVRFWTFEVSEVPVSDESNKTMPML
FT                   QLFHDTTLELDDDILSVVISPDDKFIAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSM
FT                   DISYDSKLIVTCSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPESYNFFSCSKDAT
FT                   VKYWDGQKFECIQKLAAHQSEVWSISVSNDGTFVISTGHDHSIRVWEETEDQVFLEEER
FT                   EKEMDEQYEDTLLTSLEGGAGDEMLSVKKGDNEESEEVEGVHKQTVESLKAGERLMEAL
FT                   EIGVNDIIAMEEFNEQLNAWKKSKKGIQPIRPQENTLLVALKKTPEEYIIETLVKIKPS
FT                   QIEDALMVMPFSYILKFLKFIDVVTTKAALLQKHISLVCKTLFFVIRFNYKELVAQKNA
FT                   NLKLQITRVKDNLRKSLKSNVDELGFNIEGMKFIKQQWELNHHLEFNDEYEEKNFEEKH
FT                   SKKRVFGTLA"
FT   CDS_pept        complement(472227..473396)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000157076" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19348988"
FT                   /locus_tag="CAGL0M04301g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /function="zinc ion transmembrane transporter activity "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAG62510.1"
FT                   /db_xref="GO:0005385"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG380070"
FT                   /db_xref="HOGENOM:HBG598807"
FT                   /db_xref="InterPro:IPR003689"
FT                   /db_xref="InterPro:IPR004698"
FT                   /db_xref="UniParc:UPI00003B7097"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJR0"
FT                   /transl_table=1
FT                   /translation="MHNELLGRSVDTCSTENDYNGEQNLRILAVFIVMISSGLGAYFPI
FT                   LSSQYSFIRLPNWCFFVAKFFGSGVIIATAFIHLLQPAAEALTDDCLGGTFEDYPWAFG
FT                   ICLMSLFMLFLAEIVAHHFVDKKFNHSHAETDNANALPDIILKDIQISTDDLSEGMLNC
FT                   AGHQDSLQDSKKIETGVSTNLKRVDDSGFEGQYEYKRESTDETWIDENTLTTGNSEHKF
FT                   SADYVSKVFVLCVLEFGIIFHSVFVGLSLAVAGSEFKVLFIVITFHQMFEGLGLGTRIA
FT                   ETEWPPSKWYTPWIMAFAFTITSPIAIAIGIGVRHSWVPGSRKALIANGVFDSISSGIL
FT                   IYTGLIELMAHEFIFSNQFKGEHSLRNMLTAYFIMCCGAALMALLGRWA"
FT   CDS_pept        complement(474158..476269)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000001123" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18501153"
FT                   /locus_tag="CAGL0M04323g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /function="nucleic acid binding"
FT                   /function="zinc ion binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAG62511.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG124051"
FT                   /db_xref="HOGENOM:HBG202461"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="UniParc:UPI00003B7098"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJQ9"
FT                   /transl_table=1
FT                   /translation="MNTFQADWGEIPQMPKDQVFTPQDQLTNYNDNMMDNLLDFNYNDV
FT                   DALLSEELKDLDIPLAPSPRDLNMNAEQSLNWMQDIQGHRSNKPSMSHKRGMSGTAIFG
FT                   FKNHNKTLSIASFSKNTDIINEAENENVKGNTDNQNGFVLSQVLLKQQEELRLALEKQK
FT                   EVNRNLERQLRENRLQQEHIQRVLHDQEAVTSQLTAQNVTESPSKQRSPTKYQGDDAII
FT                   VTKNSSSGGYVFPPPPRVTLNNEAVTPPLSFSRFSNIDQMESSDPLNYLQPNADFTEAY
FT                   ASHKTPESSFGKEHASVLSTSEFLRPTNAARESSSKAMYSSPNSMISPHRKKDSVLSTV
FT                   STILQPQDDYQNTASPPSQMLNLEEANLENEQKNNGKMLRAPVEIMPTIPGSKNNTPMT
FT                   ANKSGFMPQKHTFQHTPVKAKNNVDMNERSLVRPELSGTPLNKSVQNGMHFREEDDSNI
FT                   LHHISEIPQGSTSHNNTTAGDDSNVSNRLQFSNTESSPSRQRKKPTTLPPGYIDRYVKE
FT                   LPDKNFECLFPNCGKFFRRRYNIKSHIQTHLEDKPYKCDFEGCTKAFVRNHDLARHKKT
FT                   HDKHFSCPCGKKFSSEQSMMKHKNRHNCTGPARVPDSKMVSKSPRKQSSPTKLSSAIMN
FT                   SPIKENYLKENTNLHIDQLRMDPKMRNALEDGGLLKPVERTEAMAFPSPLSGYSDLGSP
FT                   FRDLGTIEE"
FT   CDS_pept        complement(477731..478693)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17437849"
FT                   /locus_tag="CAGL0M04345g"
FT                   /product="Similar to uniprot|Q12208 Saccharomyces
FT                   cerevisiae YLR132c"
FT                   /protein_id="CAG62512.1"
FT                   /db_xref="HOGENOM:HBG124052"
FT                   /db_xref="InterPro:IPR019146"
FT                   /db_xref="UniParc:UPI00003B7099"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJQ8"
FT                   /transl_table=1
FT                   /translation="MNILAEYSSESEFESEENLKSQNSEEVIPPIENWEKSGEVSNLEE
FT                   WQRTHRDDIDTVIKLPPIPSSVYDKYQIPPNTDKYIERTDNGMSLGAIKGSDVFKRNIG
FT                   KWSCFLYIEYRPSSTEREMISKTLSQFNQSWQKKFPGTDIFEPLHYTTLGVPVPLHISL
FT                   TKNIPFDSETQRDRFYNILVPKVAQLRQHLVQFEDTLRFYGSPQTTSVFLGYNVAQSVK
FT                   DNIIKDITDNIESALIDSGLSESDKMVTVPSFSHMSIAKLSNAPKDILDKVGYADSNQM
FT                   AKQIQDYVEISPNQQPVFYVSSIKMNKNRELLTIPFATP"
FT   CDS_pept        479260..481074
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000246747" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18501154"
FT                   /locus_tag="CAGL0M04367g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /protein_id="CAG62513.1"
FT                   /db_xref="HOGENOM:HBG059778"
FT                   /db_xref="HOGENOM:HBG396752"
FT                   /db_xref="InterPro:IPR002573"
FT                   /db_xref="InterPro:IPR007521"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniParc:UPI00003B709A"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJQ7"
FT                   /transl_table=1
FT                   /translation="MPLSEIEPHSPSAKKASGHRRSRRHSSIGSSSRKPSLTRNRSTLR
FT                   LMRTISIESLNNDTFSASGGEDEDNSNSDYNDVSGTNQDLEDKIGNLSIKSGISQSSSD
FT                   IKTTPAKKGSGGVSASSTDNSIEVPFVKVALDITLPQDYFKKDVANMIQSLKVPRWYAR
FT                   GLVESPLKMESLRLTKIAGAMTNAIFKVEYPALPSLLLRVYGSNNDMIIDREYELQVLA
FT                   RLSVQHIGPSLYGCFLNGRFEQFLENATTLTKDDIRDWKTSQRIARRMKELHTGVPLLR
FT                   FEKEQGSMAWNKIDQWLKEIEMNGGDWISNDDNVQQVFGAPNWKEFKESIRKYREWLFE
FT                   NSKSPYVFCHNDAQYGNLLFSAPVINSEKNDLKKSLDESNLSTSSLFPSDSRVSLKEII
FT                   NPTKQEQSQDSKLVVIDFEYAGANVAAYDLSNHFSEWMYDYNSSTPHKCFSDQYPTTEQ
FT                   MLNFVYSYVSHLRGGVKTDIDDDARLLYNDIKKWRGTVQLFWSLWALIQSGKIQFQEQE
FT                   STKVDEGLVGEKYIIKTEDTAIDELVDDIDTNDVIEAPEGVSIDTFDYLGYCTDKISVF
FT                   WGDIIGFNIITKSECIENKVKYLSTDLL"
FT   CDS_pept        481522..483702
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17437850"
FT                   /gene_name="SLX4"
FT                   /locus_tag="CAGL0M04389g"
FT                   /product="Structure-specific endonuclease subunit SLX4 "
FT                   /biological_process="DNA recombination"
FT                   /biological_process="DNA repair"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG62514.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006281"
FT                   /db_xref="GO:0006310"
FT                   /db_xref="HOGENOM:HBG124053"
FT                   /db_xref="InterPro:IPR018574"
FT                   /db_xref="UniParc:UPI00003B709B"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FJQ6"
FT                   /transl_table=1
FT                   /translation="MDFERAQKNFDAFVINGETDETPNDELRHESQHSDFDTCGTQVPE
FT                   MNFSDDDNSDCGNNEIDRLAHNATETTDKEGDDSIIVTQERIAENRNNSVIEIEDEDQI
FT                   DLSVVNSKEEDNIFLNTQIQSRLDDHEKDLQQKAVLKSFNFEYVDKDESPNMMGSRYIR
FT                   KKSPKKRNSRKNTEEAIQASKSISKRQNNANSLLQILSGKKSKVNAIIKNQRFKYESKT
FT                   GVLKRASQVSNSTSTTYGKEEWKQIKNVLRTRYSKLENSDDRELENFINYLSEQLEKEP
FT                   NLWTSSQIAISTNENNESYRQDSIGSLLTLSQVMGDKSAILESDDEYPDVRPNGESFFK
FT                   CADDSQQLKDDLNIVSQTNSNTNVSGVESVHGLEGKNLYSMGEKEEVTNKMTDFVSKEV
FT                   EQSQVPLLSIHRRGRNNGSYFIFDSSDEYKTIIEIDSSIRQPMDNSNEPSITNHRRTPV
FT                   FSKSQSILDQECDSIEDISLSQGSFKAVTTLISPVKDGSTAQNSQAMDIPTQFSGIPRL
FT                   LDLKTVPKLPFESFNENSKDYRIIISKKKLLELKQAIKRLANIELTEEHEVLGNIDGQP
FT                   GEELFAVVLSISNNLELLSSPGVDTHTKEKSPSLAELRKDLDKIGLKPVRLKSQIIENL
FT                   ASASQVVTVDESNQKKVGVTSKSEVFEFLTHLVKQEPDLLTRIYCFQPITMNDLINKLR
FT                   NKDSFVDLIDDGTIREWTDKLGICIRSNNLKD"
FT   CDS_pept        483972..485030
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000001124" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17437851"
FT                   /locus_tag="CAGL0M04411g"
FT                   /product="Similar to uniprot|Q12367 Saccharomyces
FT                   cerevisiae YLR137w"
FT                   /protein_id="CAG62515.1"
FT                   /db_xref="HOGENOM:HBG059792"
FT                   /db_xref="HOGENOM:HBG202464"
FT                   /db_xref="UniParc:UPI00003B709C"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJQ5"
FT                   /transl_table=1
FT                   /translation="MPFSLVRIDEDDVLEYVFERYTAINSDADSIRQDLGIQDSKSTTL
FT                   NIEIAPPKSLINDTNITKKGKKKKGNKSSSDYDFYSFEIKQNVTSLHSTRDNDNSTTGY
FT                   VLWSLTPVFCEWLLYNEQASPLHRAQMVNICSLEKKIIHDIEFPSLLNEDTTVIELGSG
FT                   ISSVLPILCSNFVGTYICTDQRGILNGLKQNIANNLDLVNKRTIVSETLDISNIQEQPT
FT                   NSDDETIPIKPTTQLEVAILDWETFPKSIKSGSSNILTDFVKPHGTIFLLALDVIYNEY
FT                   LINPFLHTLHSIMFYYKNQREIVALVGIHLRSDDIVQEFLEKVTTEFPFKLHVVDDPQW
FT                   SHSRYDIYYITL"
FT   CDS_pept        485936..488773
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000168542" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17437852"
FT                   /locus_tag="CAGL0M04433g"
FT                   /product="Similar to uniprot|Q99271 Saccharomyces
FT                   cerevisiae YLR138w NHA1"
FT                   /function="sodium:hydrogen antiporter activity "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAG62516.1"
FT                   /db_xref="GO:0015385"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG059794"
FT                   /db_xref="HOGENOM:HBG397235"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR013928"
FT                   /db_xref="UniParc:UPI00003B709D"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJQ4"
FT                   /transl_table=1
FT                   /translation="MAVWEQLEVSKAHVAYACVGVFSSIFSLVSLFVKEKLYIGESTVA
FT                   GIFGLIVGPVCLDWFNPLEWGNSDVITLEITRIVLCLQIFAVAVELPRKYMKKHWLSVT
FT                   MLLVPVMTAGWLIIGLFVWIIIPHINFPAALLVSACITATDPILAQSVVSGKFAKKVPG
FT                   HLRNLLSAESGCNDGMAFPFIYLSLNLVLHPGRGGLIVKDWICITILYECLFGCILGVV
FT                   IGYVGRISIRFAEEKNIIDRESFLAFYVVLAFICAGFGSLLGVDDLLVSFAAGAAFAWD
FT                   GWFSQKTEESNVSTVIDVLLNYAYFIYFGAIIPWDQFNNGDIGLNVWRLIVLAIIVIFL
FT                   RRIPAVMILKPVIPDIKSWREALFVGHFGPIGVGAIFAAILARGELEHEFLEEPTPLNV
FT                   VPPEVETEHWQLIAILWPTICFFIITSIIVHGSSVAVITLGRHLNTVTLTKTFTTHTTN
FT                   GNGKSSWMQRLPSLDKSGRSFSLHRVDTSATNETIHHETEPDELKQNDTMEDYSGVTTS
FT                   GKPVRAAGGMRRRVTRKKKKSRGRKHAERLMRKTEKLNPMFGGYDDELNDLGREKLQLE
FT                   KEAEAGTFALGRKNWPNADNDDDADGSPHTVIGTSISGSDQYDEEKVDSRHSLESTQSE
FT                   KERKLAELKEQEETPHVAYAEGNKIIFENKQGEIIDEAKLNSPSDEEAQQSFRSPSSLK
FT                   KTRSNDSTSRSMTSMNSLKRIITPPSVKKVHSLIDRSHPKYIAYKIDNQLIIEDDEGEV
FT                   LRRYKINTHDKEESKTSPKVQTRNERSSSIVSRALSAVGLRNGSKTTLASDEVTGVAEG
FT                   ERQFVLTPVPTHMYDQNENQINEEDEEGTSYSGSENDNEEENSQSDDSYEYDSNQLSGE
FT                   ESNERSEDEESEDYDEDSDNYSETQIERDRRLNALGHISLPAEADDEEPAPYIPQLDQN
FT                   NSRNKMKSTFARFKK"
FT   CDS_pept        complement(489048..491183)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000141887" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18501155"
FT                   /locus_tag="CAGL0M04455g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /protein_id="CAG62517.1"
FT                   /db_xref="HOGENOM:HBG124054"
FT                   /db_xref="UniParc:UPI00003B709E"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJQ3"
FT                   /transl_table=1
FT                   /translation="MLRALPLLRKRILPAFRTRIRLYSDDSLKEKLLSTRGKKKMPEKQ
FT                   KIVVLNPGQVTSFKRRRRGPVTDHANTHTTTDSLITRHNRPISAPRTKLSILEGVDLGI
FT                   STNGSKEEDKEKLTDTVLEEIDQKRRKLMVFRSTVSEEQAVKAIGYQKPVKPIMSQKRY
FT                   EQLENLLKSAYTVNQLRAYSKKMFGPSLFKKSKAFIIKKIMNEYWQCQVDENINEKDDL
FT                   IIERELDIKTRDTYLLLLTDNGKILHNLARIGAILAVAPEENKIIIRASANVIRYVEIS
FT                   LNRILENVKTEIVPIEKLIRDHSIDGKLDGDMNVEQIIDLVQKQASVYIDLISDSSEEK
FT                   QYNISAFGKKRIDTAKLYLTWASKYTPHVQEEYITTGDKCMKEKCKEYPYTDMDSFNWL
FT                   DKNKLWYRLQLPENKLLGKTDKLEYPPTIEMLDVKRIYDFLTDKNISLKQKLLPVKGTR
FT                   QHVISVTMGQLLKAGNSMIRTFLPRIPTISNFLMDLPYFEETHEGDLSVLGENDDYYVQ
FT                   LKFKPDLSSIPPGIKSYPPNMELWFELDDRDNAIKASMDCIFSVSEKAVMLEAPQHPFD
FT                   FKIVSDAVVSLNPSLENDDPGQWLEGQDELKHYVDQAKLDFGQGNKMLLGNSVCVNIPT
FT                   EEEGTVQVRYDFVNTYRHRITRLKFRDRFLVQYSNINGGARGGQTNRIDLICDDNPDYN
FT                   DFSNFIQQSLEFGKKKI"
FT   CDS_pept        491638..493329
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17437853"
FT                   /locus_tag="CAGL0M04477g"
FT                   /product="Similarities with uniprot|Q02983 Saccharomyces
FT                   cerevisiae YLR141w RRN5"
FT                   /protein_id="CAG62518.1"
FT                   /db_xref="HOGENOM:HBG124055"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniParc:UPI00003B709F"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJQ2"
FT                   /transl_table=1
FT                   /translation="MSDDRTHKKQKRIRVRTDVVADYFDLYNREVRRVLMPEFGLTEEL
FT                   TRSKVHVNSRVRCLEPDHFSGQVLRRDDYDDYDDDNDEEHDDSESDGDYTTDDEVEPAE
FT                   DDDMGTEWTRYEKEQFFYCMSRYSIHRVDEWCQTFTNKSKYEILVYYQVLRSNLEQLKT
FT                   TRYKRLLPRSRFPIAYEMSPEFIRLEEMLCEQVNDVVLHKAGSDEGSVEDNEDSIIDIE
FT                   KWNARWEPLYANTHIEELRPISIEPLPIAPEAIRYLTELVKRHTRKLLWHSVLPSLESA
FT                   RISKAALLGRQAEKRQAEKRPLAEEDIIEIQAHPRKKHHRDYYPHEITREDVLQAVITL
FT                   KQEGSTQTYPLTLGECVLDTIKKYEIETSTQGRLFHSKDIAKQSVLSNLVSSHQRHHNA
FT                   EDDSALALTGELATRYYDGISYMDRKYMSRMNRLLTSTYADSELWHVTESTTASQGPPD
FT                   LFVQYYSHSVPTPHENNVTEKLALQLHDTQLANAVLDNPCEVALACEESRRLDLEDLAR
FT                   SRKHENMLLRYLVGVSERAQPMRVITDQTRSTAVSNKLLQWFQVSP"
FT   CDS_pept        494202..495611
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248390" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17437854"
FT                   /locus_tag="CAGL0M04499g"
FT                   /product="Similar to uniprot|P09368 Saccharomyces
FT                   cerevisiae YLR142w PUT1 Proline oxidase "
FT                   /function="proline dehydrogenase activity"
FT                   /biological_process="glutamate biosynthetic process "
FT                   /biological_process="oxidation-reduction process "
FT                   /biological_process="proline catabolic process "
FT                   /protein_id="CAG62519.1"
FT                   /db_xref="GO:0004657"
FT                   /db_xref="GO:0006537"
FT                   /db_xref="GO:0006562"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG059800"
FT                   /db_xref="HOGENOM:HBG397339"
FT                   /db_xref="InterPro:IPR002872"
FT                   /db_xref="InterPro:IPR015659"
FT                   /db_xref="UniParc:UPI00003B70A0"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJQ1"
FT                   /transl_table=1
FT                   /translation="MLRIYRPRVMAIARRYVSQTAQTSNAMVADTTDPMMNPMQPKLSS
FT                   HSQLPPSSVAYLKTLSRAEVFSLGMIGLATTSKPVLNLVIKLFPYVPMPLIKMFVSRLY
FT                   CGGDNINEVKTFGEKLQKRGISNMMLSLTIEDSEGTKNIDINYIVEETIKSVHGVLKPN
FT                   LVNQLEKCGNDAKKINEIAPGYIALKPSALVSNPHDVLMNFNNPDPHWVAQREKLIDNC
FT                   SRIAQEIYDLNNDLLKKYPSRTAPFCVATIDAEKYDLQNSGVYELQRILFQKFNKLSSP
FT                   MVSVIGTWQLYLVDSAAQLAREHARAMKEGYKLGVKLVRGAYIHSETKRDSIIFKTKEG
FT                   TDENYDAVMTTVIQDLLKNGTKSYYGHLVVASHNYGSQMLATKILKDAPENVGKANIVL
FT                   GQLLGMSDNVTHDLITKHGAKNIIKYVPWGPPLETKDYLLRRLQENGDAVKSDNGFPLV
FT                   KAVIKSLFSRA"
FT   CDS_pept        496157..498223
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000247962" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17437855"
FT                   /locus_tag="CAGL0M04521g"
FT                   /product="Similar to uniprot|Q12429 Saccharomyces
FT                   cerevisiae YLR143w"
FT                   /protein_id="CAG62520.1"
FT                   /db_xref="HOGENOM:HBG034749"
FT                   /db_xref="HOGENOM:HBG396212"
FT                   /db_xref="InterPro:IPR002761"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR013813"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniParc:UPI00003B70A1"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJQ0"
FT                   /transl_table=1
FT                   /translation="MKFVALISGGKDSCYNILHCQRQGHELVALANLRPIDTDKQELDS
FT                   FMFQTVGHDIVSLYENCTGLPLFRKEIHPKTSKNVELNYTPTKDDEIEVLYQLLSEVKQ
FT                   SIPDLQAVSVGAILSSYQRTRVEDVCGRLGLVVLSYLWQRSQLELMTEMCSMSKQEDEL
FT                   NTSESCKLDARIIKVAAIGLDNTDLGKSLPQLFPKMLKLNTRYEVHICGEGGEFESMVL
FT                   DAPFFRKGFLKLEEVIDTTDNENDGVYNAQLIVKFQKRELPDDIFQSELSRLPVPPLFD
FT                   PAWNELYELIDNENFEDTKTINTMNIRLPSVKTHTNRIGNLLYISNIQPQYKDGTVQEQ
FT                   VKDVLQQLDNILKDNHLTAKNVLYSSLLLTDMSLFASVNQEYSKFFDIWKNGPLPPARA
FT                   CIESNIINDGSALQLSVVVKYADQTLGNDIEKCEKSGLHVQGRSYWAPCNIGPYSQSIW
FT                   LSNDLNQLSYLSGQIALEPSQMEMIDTNDAKQQAVLSLKHLDSIKQVINARNQVQLTCF
FT                   ISNNSIVPLLTQTWAQYSEDIIYSSEMEEWCGKPSESQDCLIIVKVSNLPRNALCEWGG
FT                   IAAKSLEVEHDDHDLTAELRKLNLDGGINIINHHDLTLRRFKTTFANTAEQLITQIRGV
FT                   TSKNTHCIIFFSEYLCVDKLQDTSAEFIPVEKVYNYKGEEVKFAAHIVNHTKF"
FT   CDS_pept        498691..499533
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19348989"
FT                   /locus_tag="CAGL0M04543g"
FT                   /product="Similar to uniprot|P25623 Saccharomyces
FT                   cerevisiae YCR030c"
FT                   /protein_id="CAG62521.1"
FT                   /db_xref="HOGENOM:HBG124056"
FT                   /db_xref="UniParc:UPI00003B70A2"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJP9"
FT                   /transl_table=1
FT                   /translation="MDFTSQARRIIKFAEKALQDETLDSDTVQRAIIERNLRIEFRRQN
FT                   IVSNALKDCHYHQITDEELQSNLTNYPFMASIQARVAWRSILSSPTDPDKDYHNQTSTS
FT                   INRKRSIYNSGHIPNKRLRNEKDRVDKLNQMVRDIENNTKVVETLLNESDITTSVDRPA
FT                   INVHPFVEDEAPPPTITMDDLEIVSNATKNISNTNTVEKPYVSVSSNSRNEYETRHLKY
FT                   DSTISRFGKIDHRRHSKENILIRNDNETHTIRRNSKSNKNPKSIRKMRAVAKKYHLEE"
FT   CDS_pept        complement(499618..501930)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000211468" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20195775"
FT                   /locus_tag="CAGL0M04565g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /function="endo-1,3(4)-beta-glucanase activity "
FT                   /biological_process="cell wall macromolecule catabolic
FT                   process"
FT                   /protein_id="CAG62522.1"
FT                   /db_xref="GO:0016998"
FT                   /db_xref="GO:0033903"
FT                   /db_xref="HOGENOM:HBG059774"
FT                   /db_xref="HOGENOM:HBG398584"
FT                   /db_xref="InterPro:IPR005200"
FT                   /db_xref="UniParc:UPI00003B70A3"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJP8"
FT                   /transl_table=1
FT                   /translation="MSYNRPPMPLPKDANPNRSTSGLFYPNEPIMPPRNEEPDSMISSL
FT                   VLDTATPTIDAMNSINITNDMVQEAEYVTVNDLPINTSAPPAMFTRTGHEIPIPDGVER
FT                   NGRPVATNKFYGNFLLGSQTCATWTHPYSVWISKDNAFPGFAANHVRASQRVFGDGNPA
FT                   PFFFSPIGIRSFVFGANELPSFESMSLRFTDLSHMSIHVWLKKSESEHIRFPIVQGMGF
FT                   ITANYSNLTPRLQSAVGFRNLNSMASPRTDMQKYQVLLENDVKWTIYVKLDSKCNNFQL
FT                   FIANGNTIQANQRVSSATIQVVADTVEAIDQAAGCYPVNCDVVNAVNKDKGIYRLAYKT
FT                   EGYSNKGTTLLYGLRHHMVSMTIPTALTSINSELDSTVMGVMRGFITNTLEMQVQIPAN
FT                   VDFIPATTIPGRRVLYSHEVLEKVRDAARKEVNGDVINESNVNSMYFSGKVLAKYAWIL
FT                   FCCQYIVNDRGLVDILLPKLKEAFARFSQNQQQLPLRYDTTWGGVISSGTSGDDFGNSY
FT                   YNDHHFHYSYHIIAAAILTKVDRDIGNGSWFTENREWVETLIRDYANPSENDPYFPMYR
FT                   SFDWFTGHSWAKGLFESGDGKDEESSSEDVNSCYALKLWGMVSGNVALVNRSNVQLGIL
FT                   NTSLNQYFLYDDANKTEPPQFIGNKVSGILFENKIDHTTYFGNYLQYIQMIHAIPITPM
FT                   SSFIRHPSYVEQEWIQKLQGIVNDVNDGWKGIMMLNLALFNPRASFEFFSSPNFSGNFL
FT                   DNGQSLTWSLAYSGAFI"
FT   CDS_pept        502567..503199
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000066119" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19348990"
FT                   /locus_tag="CAGL0M04587g"
FT                   /product="Similar to uniprot|Q12530 Saccharomyces
FT                   cerevisiae YLR145w"
FT                   /protein_id="CAG62523.1"
FT                   /db_xref="HOGENOM:HBG059802"
FT                   /db_xref="UniParc:UPI00003B70A4"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJP7"
FT                   /transl_table=1
FT                   /translation="MSLVVDKYIQLHQEYRILHLLNHRNKNQHRVATWWKWFNMLRRSV
FT                   GDVVEILQPLGRRKNQKLKDKKDGRFLYRTLHKFFQMESKLYYSFNNIIKLGQFITLGV
FT                   VLVGILGRVHSIYHEIFELYKEQFISMGCLRVPKKNAQIEEAHVTNNDNEELGELINDA
FT                   DVLIEPSALLKQDVILSKNIKNESKSSKDKKKKKKKKKGSAIDDLFG"
FT   CDS_pept        complement(503641..504537)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000256147" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17437856"
FT                   /locus_tag="CAGL0M04609g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /function="spermidine synthase activity"
FT                   /biological_process="spermidine biosynthetic process "
FT                   /protein_id="CAG62524.1"
FT                   /db_xref="GO:0004766"
FT                   /db_xref="GO:0008295"
FT                   /db_xref="HOGENOM:HBG011091"
FT                   /db_xref="HOGENOM:HBG635113"
FT                   /db_xref="InterPro:IPR001045"
FT                   /db_xref="UniParc:UPI00003B70A5"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJP6"
FT                   /transl_table=1
FT                   /translation="MAEQKYIKDGWFYEMSDEHFPGQALALKVKQVLYQSKSEFQDILV
FT                   FESTNHGVCLVLDGIIQCSERDEFAYQEMIAHIPLYCHANPKKVLVIGGGDGGVVREVV
FT                   KHDKVESVTMVEIDKTVIELAKKYLPGMSCAMDHPKLKLNLCDGFKFLKEASMLSNDDK
FT                   YDVIITDSSDPDGPAEAFFQKEYFELLQNALKPDGIVIAQASENVWLDINYLASLRKTA
FT                   NEVFTNTMISYTTVPTYTSGQLGLIVCTNSNDYDLTTPQRQPSVSEQNQLRYYNSQIHS
FT                   ASFVLPNWADMLIYDKK"
FT   CDS_pept        complement(505301..505600)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000182712" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17437857"
FT                   /locus_tag="CAGL0M04631g"
FT                   /product="Similar to uniprot|P43321 Saccharomyces
FT                   cerevisiae YLR147c SMD3 spliceosomal snRNA "
FT                   /protein_id="CAG62525.1"
FT                   /db_xref="HOGENOM:HBG353275"
FT                   /db_xref="HOGENOM:HBG749684"
FT                   /db_xref="InterPro:IPR001163"
FT                   /db_xref="InterPro:IPR006649"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="UniParc:UPI00003B70A6"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJP5"
FT                   /transl_table=1
FT                   /translation="MSNIPVKLLSEAQGHVVTIELNNGDTYRGKLVESEDNMNVQLRDV
FT                   MVTSSTQKLSRMDHVFVRGSHIRFFVVPDMLKNAPLFKKNQSRQPPPVRGPRRR"
FT   CDS_pept        505982..508861
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000001125" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17437858"
FT                   /locus_tag="CAGL0M04653g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /function="zinc ion binding"
FT                   /protein_id="CAG62526.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG059805"
FT                   /db_xref="HOGENOM:HBG202471"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR007810"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR019453"
FT                   /db_xref="UniParc:UPI00003B70A7"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJP4"
FT                   /transl_table=1
FT                   /translation="MEVEIEHVELGFINELNKNICGLQVEGNLMCFALRTGSLFLIDLD
FT                   TPSNVIRCQIPLVRDGGVNAEKVLKIWLNPSRSLILVKTNFAKYYLCDVDVIVKTNGES
FT                   MTQNAIASVKQLSKKNCDVRSVAWVRNAKATGMHDKFNLLIGTARGQVYYIEINSKLSE
FT                   QNATLLYESPDSIDGIYWNDANGDIIIASKNKLIYWDGLQSSSNNNKNDREISPKITLS
FT                   KKRKSNEVEEYEHMHMEYTNKFAVYKNSFAWVTESGIVFSNVEQVKKSNKKVLGSSKVI
FT                   LNVELPNSKKPIRDIILSDYHILILRESSITIVNQLDNSVIYNQSIWSNDNEHILGFAS
FT                   DVHYKQATFWCFSASNIFEIILKKESNSVWRLLCDQQRYDDALNLQDLSLFEQSSIQYL
FT                   KGMHLLEENVYSDAAKCFGKSDTVSIPEIALKLLDGDDGMLKIGEQKLNALQFFLSEKL
FT                   LNYRHKDSLKYTIILDWIMWNYVRLFCLIDEKACSEREPDRLKYWDQRKEEISASVKKL
FT                   IDDNINLLERGTFYQLLEKSGRRIELLYLAEKLNDHQYLMNYWIRNENWYESLKVLQKA
FT                   KDPQLAYKHANILLVNCSQSTINTWMTMENLNPVFLIDAILTYFSIYQKSTKGSKVLQE
FT                   NYALTYLKWYVGNNDVNDKIIYNTIVYMMITTPIIQEGNDAMQTDHNNDNDVIEFMENY
FT                   SSKSHLEFVLRLSLKFERIKVAIYLLKLSDQYEDAVDLALSNGLVDEAKEIANMESLAK
FT                   DFTIKRKHWIKIAQVVLSQHLEKPDIKQNIRSIIRESEGTVKINDLLPFFNEFTTVANL
FT                   KDELVRSLEEHNHEIITIRDKIKHSLELKKDIIHETEKFKERYRILEPGKSCDQCQKML
FT                   QTRKFLVFPCGHCFHTDCLIRAILSSNDYNLKGKIENFQKRLNKDRKSVNPKELEELMA
FT                   TKCCLCSDIAINKIDEATIDDKERSQWVI"
FT   CDS_pept        509383..509799
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000247776" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21044618"
FT                   /locus_tag="CAGL0M04675g"
FT                   /product="Similar to uniprot|Q12305 Saccharomyces
FT                   cerevisiae YOR285w"
FT                   /protein_id="CAG62527.1"
FT                   /db_xref="HOGENOM:HBG059630"
FT                   /db_xref="HOGENOM:HBG202902"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="UniParc:UPI00003B70A8"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJP3"
FT                   /transl_table=1
FT                   /translation="MWKRIVDAWNGNATSPSTPGVNTYDFEGMKKVAMQHDPSTVLVDV
FT                   REPSEFSVVHIPGSINVPYRSHPEGFSLDPVTFKQTFGYEKPPVSNHLIFYCASGRRGS
FT                   MAREVAAKNGYTNLSEYPGSMNDWVAKGGDRLAL"
FT   CDS_pept        510203..510664
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000247776" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17437859"
FT                   /locus_tag="CAGL0M04697g"
FT                   /product="Similar to uniprot|Q08742 Saccharomyces
FT                   cerevisiae YOR286w"
FT                   /protein_id="CAG62528.1"
FT                   /db_xref="HOGENOM:HBG202902"
FT                   /db_xref="HOGENOM:HBG507413"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="UniParc:UPI00003B70A9"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJP2"
FT                   /transl_table=1
FT                   /translation="MFKRVVSISRGRVSPIRLVGLNRSANMIRYLSTNGPKAYNFEDIK
FT                   QLVQHPDPKKVLVDVREPEELKECKLPNSINIPLKSAPGALGLPEEEFQELFHIEKPPK
FT                   DKELIFFCALGVRAKTSEELARSYGYESTGVWEGSMKEWKEKGGDKIKV"
FT   CDS_pept        complement(510921..511862)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000094487" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20195776"
FT                   /gene_name="RRP36"
FT                   /locus_tag="CAGL0M04719g"
FT                   /product="rRNA biogenesis protein RRP36 "
FT                   /biological_process="rRNA processing"
FT                   /cellular_component="nucleolus"
FT                   /cellular_component="ribonucleoprotein complex "
FT                   /protein_id="CAG62529.1"
FT                   /db_xref="GO:0005730"
FT                   /db_xref="GO:0006364"
FT                   /db_xref="GO:0030529"
FT                   /db_xref="HOGENOM:HBG351277"
FT                   /db_xref="HOGENOM:HBG398117"
FT                   /db_xref="InterPro:IPR009292"
FT                   /db_xref="UniParc:UPI00003B70AA"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FJP1"
FT                   /transl_table=1
FT                   /translation="MSYYFKNIKPSYDDDSDEVSDEQDLDAILASKMRGRAESDDESSE
FT                   EEDDGLSKLSFGSLKKAEDQLEEEERGELRKKRKPQHSKPINDEPEVRHKVYKEEEQEE
FT                   SDSESGSDDGAFFEEDERDNHSRPKNKNSKKRKHAPTEHSSKKRVSKIRDIPGLEIARQ
FT                   AKSGIYQDVRFTKATGEATDFSVIRRRYKFLDEYREKEIEEMERLLNDKKFVNKAESRE
FT                   IENMKEKVRSMKSRLQSVKNRELEQQIVKDYEGKLNEGNKNRFHLKKAEKRKVIQKWKF
FT                   DHMKAKQREKVMERKRKKKLGKEFKQFEFHNR"
FT   CDS_pept        complement(512229..513143)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248396" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17437860"
FT                   /locus_tag="CAGL0M04741g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /biological_process="cell redox homeostasis"
FT                   /protein_id="CAG62530.1"
FT                   /db_xref="GO:0045454"
FT                   /db_xref="HOGENOM:HBG059632"
FT                   /db_xref="HOGENOM:HBG397428"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017936"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="UniParc:UPI00003B70AB"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJP0"
FT                   /transl_table=1
FT                   /translation="MKVYLLTLLVYIASVFAQDQSFYKDDPNIIELTPSNFDRVVHNTN
FT                   YTTLVEFYAPWCGYCKQLKNTIHSLGKASDSIFQVAAVNCDKASNKQLCGEYGVEGFPT
FT                   LKVFKPGKAGKTAVKKHASETYMGERKLAPLINFIKAKIKNHVKKLTSADMVSKLVNSQ
FT                   SSNKYAVVLFSKQSSIPVTYKSIAIDWLDRVKFYCYLNTKKTLVESLKSFESESAEIIG
FT                   PLVDRIGKLSAGKDKSLLVLIDKENQKISVLEDKITKSNVAKFIIDNTSLKPKEGPYSK
FT                   RDDYLAKLKLNKKKKTQVQNDEL"
FT   CDS_pept        513555..514259
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000223418" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17437861"
FT                   /locus_tag="CAGL0M04763g"
FT                   /product="Similar to uniprot|Q12012 Saccharomyces
FT                   cerevisiae YOR289w"
FT                   /protein_id="CAG62531.1"
FT                   /db_xref="HOGENOM:HBG177354"
FT                   /db_xref="HOGENOM:HBG627271"
FT                   /db_xref="InterPro:IPR002733"
FT                   /db_xref="UniParc:UPI00003B70AC"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJN9"
FT                   /transl_table=1
FT                   /translation="MVGKNNELYAFYAFLQLYKHMGHVQRDYSLRQVAEALYDTTLIIK
FT                   EDTSLFITWKRLDSQKTSIDSDDDDGYALRGCIGTFAKLPIEAGIQRYSLIAALEDSRF
FT                   TPISERELKTLKCSCNILRHFEKIYSSGDDHGDIDNWEIGKNGIELLFKHPKSGKTCSA
FT                   TFLPDVMVEQGWDKKETFLNLIQKAGCWNEAGQILNDYEKYFLEVIKYEGKKSEITYDA
FT                   FISGFEKLETLV"
FT   tRNA            complement(514590..514662)
FT                   /gene_name="tRNA-Ala (TGC)"
FT   CDS_pept        complement(514847..520039)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000172362" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17437862"
FT                   /locus_tag="CAGL0M04807g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /function="ATP binding"
FT                   /function="DNA binding"
FT                   /function="helicase activity"
FT                   /biological_process="regulation of transcription "
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG62532.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0004386"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0045449"
FT                   /db_xref="HOGENOM:HBG436481"
FT                   /db_xref="HOGENOM:HBG720361"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001487"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014012"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="InterPro:IPR014978"
FT                   /db_xref="InterPro:IPR017956"
FT                   /db_xref="InterPro:IPR018359"
FT                   /db_xref="UniParc:UPI00003B70AD"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJN8"
FT                   /transl_table=1
FT                   /translation="MDVPMPQRQLTKEEINRCYLKWQQLRNEHGKNAANVPEFIHLTKI
FT                   LHVAAKQQQEQKQKLQQQQQQQQQQQQVHVGTPQNDNKNNSEPWRVDNPNGSTFSHNKE
FT                   QLETSTDQRPPNFTMNGTEGSASSASPATNPQVQFYKKENSNNGASQRDNFQSRTISDN
FT                   SNSPATSPKSQVVTQNMPVRNNSQPNKSINSPHTINKPNDRQTQPAPLNPTQQRPVPQN
FT                   SIFTPQQSELLRAQISALKSLVNNQPVPQEYQKVIQQSINNPPDFKRMLLSLSDFVKKK
FT                   QLNQQSGSPASEIPEPQPQAQPPVQPPTEPQVQPQATPQAQSQPHAQSQQQDKNSTSDN
FT                   AKIDTNTASANTSMTEEKPIIKTGTNTPNVTHEQIPPVGVQGTSSNTLREETHKTDTPS
FT                   PRTIPGSVTHQIATPNLNKQENQNPETQNQYALKPPTERVPDPLVDGELKPAQQLPPVP
FT                   IQKFVEKYPYVKNVVSIEDPDLMVDTFSIPTIPEEPVDYYSLFPNTANPKLVMEPGMLP
FT                   AGVDIHTATDIYQTLIALNLDTSVNECISDMLDDSKDENTKEETLYDYFALQLLPLQKA
FT                   VRGHVLQYEWYQNSLLTNAHPNFLSKIRNINFNDVLLTIELYRKREVIRQEEESKRYQQ
FT                   KLTRIRNSVVNTFNHKVHRRNKRIKLGHKLVATHANIEKEEQKRAERKAKERLQALKAN
FT                   DEEAYIKLLDQTKDTRITHLLKQTNAFLDSLTKAVKDQQKYTKDMLNQHLMEKKEESAE
FT                   PVVYNDDQMLTMSMNDDDDDEENIDYYNVAHRIKEEVRQQPSILVGGTLKEYQIKGLQW
FT                   MVSLFNNHLNGILADEMGLGKTIQTISLLTYLYEMKNIKGPFLIIVPLSTLPNWSSEFA
FT                   KWAPKLRTISYKGSPNERKMKQAQIKSGEFDAVITTFEYIIKERAILSKVKWVHMIIDE
FT                   GHRMKNAQSKLSLTLNTFYHSDYRLILTGTPLQNNLPELWALLNFVLPKIFNSAKSFDE
FT                   WFNTPFANTGGQDKIELSEEETLLIIRRLHKVLRPFLLRRLKKDVEKELPDKVEKVIKC
FT                   KMSALQHAMYQQMLKHKQLFIGDQKKNKLVGLRGFNNQLMQLKKICNHPFVFEEVEDHI
FT                   NPTRDTNMNIWRVAGKFELLERILPKLKASRHRVLIFFQMTQIMDIMEDFLRYIDIKYL
FT                   RLDGHTRSDERGELLKLFNDPNSEYFCFILSTRAGGLGLNLQTADTVIIFDTDWNPHQD
FT                   LQAQDRAHRIGQKNEVRIIRLITTNSVEEVILERAYKKLDIDGKVIQAGKFDNKSTAEE
FT                   QEALLRSLLEAEEGRRRRREAGIEEEEELRDNEINEILARSEDDLALFSKLDTEREEAD
FT                   KAMHINSRLMTLDELPEIYHRNIDEELKKEESESAETYGRGTRERKQMIYSDNMSEEQW
FT                   LKQFEVSDSEDKDPNKIMELKDDETDVNSNTIKTESNEAIRSSSISIPSSPTQTMNNTP
FT                   ETNDLDSDSGEYAKKRKAPSTRPRGRPKKIKTDDGENNPTESITGDVGDNTEDVVKRAG
FT                   KTSIKSANTSSRGRGRGRGRGKPRGRAGMRGRGRPPKSKNGMVYVRMLPEDPVSEEERK
FT                   GIAEQATKLYDFALNYVNSDERRLSDIFLVKPSKHLYPDYYLIIKYPIAFDTIKDAIDR
FT                   LQYNSITEVMEDFHLMFANARVYNTEGSIIYEDAIELEDAMLQKYVEITNDTATLDFTE
FT                   FDAKYGTKPLHIQEPETHSTNENTPQDSSKDII"
FT   CDS_pept        complement(524685..529805)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000167551" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19348991"
FT                   /locus_tag="CAGL0M04829g"
FT                   /product="Similar to uniprot|Q05022 Saccharomyces
FT                   cerevisiae YMR229c RRP5"
FT                   /function="RNA binding"
FT                   /biological_process="RNA processing"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAG62533.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0006396"
FT                   /db_xref="HOGENOM:HBG052303"
FT                   /db_xref="HOGENOM:HBG328193"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR003107"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR016027"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniParc:UPI00003B70AE"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJN7"
FT                   /transl_table=1
FT                   /translation="MSTSSDFPLSKEDGTRQPEKSTLVRTTEEISFPRGGSSALTPLEL
FT                   KHVANEAAHDVLFGNEKRPLTEDDAGKPKKKKKRSSKKDTETVTDDTTEQRSAIIEHLN
FT                   FNNVKEGTILLGQIDSITKNDLRITFTDGLSGFVDLTHISEQLTSLLEDIDEDMDSDSK
FT                   EDDAEYESSDDESEQKSLPNLRHYFKVGQWLRCAVTKNTALKPKNAKQKKRIELTIEPS
FT                   VVNNFDVEDINKNTIIQCSVESIEDHGATLDLGVPSLTGFIAKKDCTNFDELKPGSVFI
FT                   SCITKKTDRSIVVSQDFSVKKNKMTSISSIDSVLPGQVVDLLCEEITDSGIVGKVFGSI
FT                   SAFIGKPHLQTFSEEDIKHKFSLGSNIPCRILASVINKSGDRVLILSTLPHVISLNNTL
FT                   GSIESLEAFPIGFIIDESVVKGRDSSYLYLAISDKFIGRVHQSNLGEIIKQDKLKSRVI
FT                   GYDVADCIFELTTDPEKLKLKYIRSKDIPVGEVFNNCEILKASSSGVELKLLGGQFTAF
FT                   VPPLHISDIRLIYPERKFKIASKTKCRILNVDNHGHIIATMKKSLVNDEELEKPVIESF
FT                   ETAKSIKNKNEKTVGTVQSFNGHGCVIMFFGGVTGFLPKSEVSEVFVKRAEDHLRLGQT
FT                   VQVKVLEVDEERRRIIVTCKVSNEEAQQQKSIIESLKIGQSIIETVVVEKTKDSVIVEI
FT                   PDVGIRGVIYVGHISDERIEQCRAEIKKIRIGSKLTGLVIDKDSRTQIFNLSLKKSLMK
FT                   DAQNKRLPTTFAEITKFKKTDPLHGYVKSISSTGVFVAFTGKFVGLVLPSYAVESRQVD
FT                   IEKAFYSNQSVTAYLLRTDDDNERFLLTLKAPKVEKAAETISAENIIDTSIKSVKDIKL
FT                   GKILDAKIKGVKKNQLNIILADNVHGRVDISEVFDNYNDIKDKKHPLSHYKANDKVRVK
FT                   IIGHHDLKSHKSLPITHNFVKGTVFELTMKPSQLKSKDVKELDIRDITVGDEIIAFVNN
FT                   YQNSTLWLTVTPTIKAKLSIFDLSEETLMNIKNVEDDFPLGSVLKVNVTGKDQNKSILQ
FT                   VTQRNGKINSIDDLKVGGHTIGKIVKVTPKYLLIELENKITGISTALEALNDFTEPLDQ
FT                   VFAGKENEFVKAKITSVIADEKKVQLQLAEDESTVQKITSHSDLKVGEVVNGLVKTVTD
FT                   KGLFVFLGKSVEAFVPVSKLSDSYLKEWKKFYKPMQPVVGKIVSCNEDDRILLTLRETE
FT                   VNGDLKVLKNYSDIKPGDIFNGTVRNVTDFGVFVKLDNTANVTGLAHITEIADEVPEDI
FT                   QSIFGVGDRVKAYVLKSNPEKKQLSLSLKASHFNTNETITEKAESQPQPRKIDEDQDEL
FT                   MDDEVVYNSESEASDDEEAHSSKSTTVISNDGGLSLSAGFDWTTSILDQANASSDSESD
FT                   EEDFMESKRSKNKKKKSKNLVEDKTIDINTRAPESVADFERLIIGNPNSSVIWMNYMAF
FT                   QLQLSEIDKARELAERALKTINYREEAEKLNIWIAMLNLENTFGSEETLEDVFTRSCQY
FT                   MDSFTMHSKLIGIYQLSEKFDKASELFKITTKKFGSEKTSIWVSWASFVLSQNEPDQVG
FT                   TILSSALKSLPKRNHIEVVRKFAQLEFSEGNPERGRSLFEGLLADAPKRIDIWNVYLDQ
FT                   EIKQKDNKSRVEELFERVIKMKITRKQAKFFFNKWLQFEESNNDEKMTDYVKAKASEYV
FT                   EKHTQKDEQ"
FT   CDS_pept        532127..532318
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17437863"
FT                   /locus_tag="CAGL0M04851g"
FT                   /product="Similarity"
FT                   /protein_id="CAG62534.1"
FT                   /db_xref="HOGENOM:HBG124058"
FT                   /db_xref="UniParc:UPI00003B70AF"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJN6"
FT                   /transl_table=1
FT                   /translation="MGLRRNKTLVLEYKRNSCTALSQSTYCTAGFHTNSQNYDNFSENY
FT                   RRVQDYKILVLHYFCKQR"
FT   CDS_pept        532872..533189
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000216624" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17437864"
FT                   /locus_tag="CAGL0M04873g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /protein_id="CAG62535.1"
FT                   /db_xref="HOGENOM:HBG059636"
FT                   /db_xref="HOGENOM:HBG499888"
FT                   /db_xref="InterPro:IPR005326"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniParc:UPI00003B70B0"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJN5"
FT                   /transl_table=1
FT                   /translation="MLMPKEERTKIHRHLFQEGVVVAKKDFNQPKHDEIDTKNLYVIKA
FT                   LQSLTSKGYVKTQFSWQYYYYTLTEEGVEYLREYLNLPEHIVPGTYIQNAQQAQRPNRR
FT                   Y"
FT   CDS_pept        534252..537362
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000074719" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17437865"
FT                   /locus_tag="CAGL0M04895g"
FT                   /product="Similar to uniprot|P12868 Saccharomyces
FT                   cerevisiae YMR231w PEP5"
FT                   /function="zinc ion binding"
FT                   /protein_id="CAG62536.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG023983"
FT                   /db_xref="HOGENOM:HBG396924"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR001965"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR016528"
FT                   /db_xref="UniParc:UPI00003B70B1"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJN4"
FT                   /transl_table=1
FT                   /translation="MSLESWRHFQFYDNLPIPDPLLGNDIRLYSDPTLSAAATVNEDLF
FT                   FIAVRSNYIRHFSLKKAEIIKEFKAFADGFQISYLMVVGQSFLLAVGEKVNYPSQLKLF
FT                   KINDLPTNEFHYHSLVEIKNSDNAFPISSVSVSNELNCIVVGFVNGKILLIKGDLSRDR
FT                   GSQQRILYEDSTGDPITSLFLNSDASSCFATTTSRIMMFNLMRKSKSIPEQVLSSKEGV
FT                   ALNCASFSKFTNENICCMNDCIQFYHGNGERHDIPIKISNPKKLMPINKTELLIIFEEE
FT                   RQKTTSIEYESGASNNICKAIVIDLENSILSFSFYTTSNIVDVLPVRSKDDSILYLVTA
FT                   EGLMYKVSKKSLDERLSIVMNKEMFPFALQLASDCNLPDNKIQKINKLYGDYLYSKGLH
FT                   TEAAQQYMKCIDILDISDIITKLGANDVFDVKAMRNLADFVWELIRKGRADHDTVTLLL
FT                   SVLIKLKDEDGLKRFVSYFRRSGKYIETENYKDLDDESYFFSDLRLFDLELIRSLLIDS
FT                   KLNQLCYQFVFKFSKDPIMITDVLLNVLKETEATLKYVKSLSVDDILRVLVRFSKQLLY
FT                   LSPNETNLLLIEVFTGKYRPSSYVSDINNVVNTKTGTKSEKNPVFYSYTAFLKYMNPLA
FT                   DASVLDASENGDRLDVDRPTYHPPKPSLVFNAFLSRPFEFVVFLEACLESYKQFDGFKN
FT                   DRQEILTTLYDLYLTLSKQDVGERKSEWTEKANLVLNESNELANELDQNSNNNLNKVDN
FT                   SLMKLIAHMNGLNVADISSPINENKEFSNDVTDNARIINGFRNLTYMGEVSECMKFFEE
FT                   HSKNNIDLFPMALSYFISKKEILEFIGGEDQLVKKIIKPIIENNIMSILDLLQILSSRD
FT                   FITYGCVKDILLDRMKEEDAVAKRTKKLIASYSEELQDKKTQLRTYLSPDHEQHIAIKD
FT                   KKCDLCHITLELPVIYFKCEHIYHQKCLNEEADLKNEGDLLYKCPKCVIDIETSSKRIS
FT                   KERELASRKELLDLAFKEEGNNSDRFRIVSDFIGRGALENSYITIES"
FT   CDS_pept        537760..539520
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20195777"
FT                   /locus_tag="CAGL0M04917g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /function="Rho guanyl-nucleotide exchange factor activity "
FT                   /biological_process="regulation of Rho protein signal
FT                   transduction"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAG62537.1"
FT                   /db_xref="GO:0005089"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0035023"
FT                   /db_xref="HOGENOM:HBG124059"
FT                   /db_xref="InterPro:IPR000219"
FT                   /db_xref="UniParc:UPI00003B70B2"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJN3"
FT                   /transl_table=1
FT                   /translation="MYEQFQMISKNSLTPIRDYNNDFFHANDSKLPNLTRVKDGYGGAR
FT                   ASYSDSIGGDLDTMDNKIDDRVKKSSNSSVLTDMKNINLREMLKKFIFSEEKYIEMTEK
FT                   ALTSYRFNMQNKKMRSKKIFDPNSKEDVILFGNLETICAVSYLYLNSLSKIVTKLELNP
FT                   SSIDVIYDELVELHVTLFNRMKQPYTSYIIAYQNQTHLVKILENSTSKIVASWYHRSYD
FT                   DARQIKLSEILQCPYKHVHDWLENIKILKEWLVVGTSVEEFQKLIETFTDYISHLNIDN
FT                   EDNVRSSQHRHPISSIQISKSSDLNPESSGPSDDGNFVAYIPSVASSVYTEVIKPRMSP
FT                   KISLDEKPCNADSNHALMLLVRLFKEKLYHLTQLRKLLVKHDITNLADNFIMQIHSWTS
FT                   LLSIEKDSVFQNIHEQLNNKINLCVKLYKEKKEELGAFKFLKLESFIIKKLETVLALMK
FT                   TVKGYINDLKVLHKDYLIFKKEKQMKLQDIKRTLLGTHYEQIQNKLVEQLPRFLTYINQ
FT                   FMVLFLLSFNAYLRDALDILISVQADLLHTEEGVNEIEKDYDKRRNVMKKTVNSHYEKS
FT                   NNNIVLRRLF"
FT   CDS_pept        539988..540689
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000765" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19348992"
FT                   /locus_tag="CAGL0M04939g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /protein_id="CAG62538.1"
FT                   /db_xref="HOGENOM:HBG058151"
FT                   /db_xref="HOGENOM:HBG203497"
FT                   /db_xref="InterPro:IPR003121"
FT                   /db_xref="InterPro:IPR014876"
FT                   /db_xref="InterPro:IPR019835"
FT                   /db_xref="UniParc:UPI00003B70B3"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJN2"
FT                   /transl_table=1
FT                   /translation="MDQNIDLNNYVSMLDAIISVSDPDKVSPKKIRKALEQLFSVSLEN
FT                   KKKEVNELIVARFQILQADPHILVSNEEFQNLKMIRGNYDALLSSKSMEKKHKLTESSK
FT                   KTRIQVKKKKSKKSSKDGEKKVANPNSNAINSMKLRLSDDLYKFLGERELPRTQVVKQV
FT                   WDYIKEHNLQSPEDRREIICDDRMRPIFGDKMTMFALNKILSKHLTKIEPKSEEADNSR
FT                   LSVKLEDGTQA"
FT   CDS_pept        complement(540950..542158)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000195026" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20195778"
FT                   /locus_tag="CAGL0M04961g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /protein_id="CAG62539.1"
FT                   /db_xref="HOGENOM:HBG330467"
FT                   /db_xref="HOGENOM:HBG350158"
FT                   /db_xref="UniParc:UPI00003B70B4"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJN1"
FT                   /transl_table=1
FT                   /translation="MATLHFTPKYEDDEVFSIAGKALKLTTKEDIQPHLDDLAKLKKCK
FT                   KLDFSGNTIGTEASKALADFLGSTESVRDVVEEINFADMYTSRLVDEVVDSLKALLPVL
FT                   LKCNKLTILNLSDNAFGLRTIDYLENYIANAVHLKHLILSNNGMGPFAGERIGKALFYL
FT                   AQNKTKAKESMLETFICGRNRLENGSALYLALGLKSHGDGLKVVKLYQNGIRPKGVATL
FT                   IHYGLKYNTKLEIIDLQDNTFTTAASLVLAKNLPLWKNTLVELNLNDCLLKAKGSKEVF
FT                   KVFEDNTFENLETLRFEYNEMEQDTLETVFLPAIEDNKFPKLKNLEINGNRFEEDSDPV
FT                   NALMDHFEDLELDDLEEPDSEEEEEEEEEEEKMEEIETSKIENELIELQIDNLAQELSK
FT                   ASI"
FT   CDS_pept        complement(542562..543017)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000195726" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18501156"
FT                   /gene_name="MBF1"
FT                   /locus_tag="CAGL0M04983g"
FT                   /product="Multiprotein-bridging factor 1 "
FT                   /function="sequence-specific DNA binding"
FT                   /biological_process="regulation of transcription "
FT                   /biological_process="transcription"
FT                   /protein_id="CAG62540.1"
FT                   /db_xref="GO:0006350"
FT                   /db_xref="GO:0043565"
FT                   /db_xref="GO:0045449"
FT                   /db_xref="HOGENOM:HBG023009"
FT                   /db_xref="HOGENOM:HBG521662"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR013729"
FT                   /db_xref="UniParc:UPI00003B70B5"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FJN0"
FT                   /transl_table=1
FT                   /translation="MSDWESHTVIGQKARAGGSGPRANVARTQGQINAARRQGLVLSVD
FT                   KKYGTANTKGDAEGQRLTKVDRETDIVKPKKLDANVGKTIARVRTEKKMSQKDLATKIN
FT                   EKPTVINDYEAGRAIPNQQVLGKMERALGVKLRGKAIGEPLGGPKKK"
FT   CDS_pept        543281..543781
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000204913" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17437866"
FT                   /locus_tag="CAGL0M05005g"
FT                   /product="Similar to uniprot|Q05027 Saccharomyces
FT                   cerevisiae YMR236w TAF17"
FT                   /function="DNA binding"
FT                   /biological_process="transcription initiation, DNA-
FT                   dependent"
FT                   /protein_id="CAG62541.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0006352"
FT                   /db_xref="HOGENOM:HBG320253"
FT                   /db_xref="HOGENOM:HBG501873"
FT                   /db_xref="InterPro:IPR003162"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="UniParc:UPI00003B70B6"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJM9"
FT                   /transl_table=1
FT                   /translation="MEEVDSQGDLPRDVRLLHLLLASQSIQQYEDRVPLQLMDFAHRYT
FT                   RGVLMDAMVYNDYASENAPGGSNAAANATNAKNAPKANTLGSGMTSNGGKNINVEDVRL
FT                   AIAARTQYMFKPTAPKELLLQLAAERNKKALPQVMGSWGVRLPPEKYCLTAKSWDLDEK
FT                   EEK"
FT   CDS_pept        544448..546676
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000198711" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18501157"
FT                   /locus_tag="CAGL0M05027g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /function="binding"
FT                   /protein_id="CAG62542.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG059617"
FT                   /db_xref="HOGENOM:HBG735608"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR015374"
FT                   /db_xref="UniParc:UPI00003B70B7"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJM8"
FT                   /transl_table=1
FT                   /translation="MITQASIPEVREDVIGFALGERKAILPQCQDLGPPDLITMVKYVP
FT                   TPNSNATAGTTSGNGAGGANNGTAGAANGNNSLSTADPAALLAEIHSHDKLKGAIGTFF
FT                   YTLGIDTSDPTSISISLKQIADAIAEKPQKWFGKFKNFSIARISLSTYNIFRRCDVNVI
FT                   VHIPGAVQTYVLDSNGEHLPVSGNQTTPTVASTASANPIDQASEMDVIWAETFISGVIR
FT                   SIMFMKDNADDGEAQPLVETLILNPLTAGKLDDVANTFIKLFPTVYERGVLTEAPCHVL
FT                   VPTRTNNYLVDTLVELVRLTKSVDICRPMLEELIKSYPDASIVLARVLMACDYEIDAID
FT                   IINRELLPHGEEDDTISPIFRAELLCLQTQFLMNVKNDYKLALEVALSAVKFSPSEFIP
FT                   WFLLTKIYIKLNDIENALLALNSCPMAQSHERYVLKRAVPIGSEDNLHLPLPENIGVDE
FT                   ILQLNPSDVNKEQLNSDPSLTRSAALNLKSTYLLAYRLLTEIVQITGWETLLKCRSKIF
FT                   VMEDEYQISTDEVSLTNQSNRNEDTPSELNMRTKRLCDRWLDNLFMLLYEDLKIYTLWQ
FT                   TEQLYFEAQNSKYKKLTYEWEAFGLCAQRLGHLPEAASAFQRGLSQRFAPMSARMLLNY
FT                   YIQEHHRVRNQSLSPNSELTSSQIISRINDLDSRIIDLCVKLCCWNHRWYIEFSIQLID
FT                   ALSVAVQDMGIMKVINEIASRYPDAVVSIMKENFLDFLENYTNGFFDA"
FT   CDS_pept        547489..548850
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000178818" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17437867"
FT                   /locus_tag="CAGL0M05049g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /function="mannan endo-1,6-alpha-mannosidase activity "
FT                   /biological_process="carbohydrate catabolic process "
FT                   /protein_id="CAG62543.1"
FT                   /db_xref="GO:0008496"
FT                   /db_xref="GO:0016052"
FT                   /db_xref="HOGENOM:HBG051292"
FT                   /db_xref="HOGENOM:HBG324877"
FT                   /db_xref="InterPro:IPR005198"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR014480"
FT                   /db_xref="UniParc:UPI00003B70B8"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJM7"
FT                   /transl_table=1
FT                   /translation="MKLLFSLQLWVLIGTLFPDAGAINLQDNKDSICAATALIQGGMLD
FT                   YYEGTRYGGTVGMFQPPYYWWQAGVAFGGMLENWFLCQNDTYKDLLMNALVAQTGPNYD
FT                   YIPANQTTVEGNDDQGVWGLTILDAVERNFSAPIDGKPGWLAMSQGIFNTMYARWDMQS
FT                   CNGGLRWQIFTWNSGYNYKNTISNACLFQIAARLGRYTGNTTYLDVAERVFDWLVGVGY
FT                   IVLSEKGNVYDGAKVEDNCTDITAIEWTYNHGVVLGGLAYMYNATNGSSVWQSRLTSVL
FT                   GGATAYFFQDDIMYESACQPYKTCNNDQRCFKSIFSRMLGFTSVLAPFTSDTIDPLLKA
FT                   SAMAAAGSCDGGTDGHTCGLDWQLKTNDGYYGLGEQMSALEVIQQLLIHERPAPYRADN
FT                   GGTSVGDAAAGLNSTTTNVLKNNLKITGGDRAGAAIVTTIVLGIIIGGAAWMMF"
FT   tRNA            complement(549092..549163)
FT                   /gene_name="tRNA-Asp (GTC)"
FT   tRNA            complement(549525..549596)
FT                   /gene_name="tRNA-Arg (TCT)"
FT   CDS_pept        549946..551247
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17437868"
FT                   /locus_tag="CAGL0M05115g"
FT                   /product="Similar to uniprot|O42838 Saccharomyces paradoxus
FT                   retrotransposon Ty5-6p"
FT                   /function="nucleic acid binding"
FT                   /function="zinc ion binding"
FT                   /protein_id="CAG62544.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG124061"
FT                   /db_xref="InterPro:IPR001878"
FT                   /db_xref="UniParc:UPI00003B70B9"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJM6"
FT                   /transl_table=1
FT                   /translation="MELVYPLLCQTIANGELASLKQQVMSLAANTYDASTTIKLTEVGD
FT                   YKKWIQMLESTLTMAHSAWSEFYHAGPYDVKTISDPTVKIQLSFLNDALVCLIKKRVSD
FT                   DAVKNINKIILSLTNFSNSAFKILDYLKGRYDRNNSRTSFKQNYGWITNYQSMTHEDLF
FT                   REITSMMEALLNYDEYELALLNTIPKDDQAKFIVRKENLIKQSAAGMMLGYLPEHLREG
FT                   YFKQWGHTAEFQTYEIVDIVVGSNVNNSQSVNHGSLANAENKNYKKQNRDKKPHFRKQK
FT                   TKPKCLYCGKPHKLSECKILFQDNPDAEVFKTFGPPSIDEELSGAYEYTIQEKPETLIW
FT                   NSGASTHMCCNKQFFIEYKDLKAHTSEISQYPTTSCREAREASIHAYKEPASRHHDQDH
FT                   TQNPARGLKELDSVAIIKSGGSTTYSVQAVWRGC"
FT   CDS_pept        552160..556215
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17437869"
FT                   /locus_tag="CAGL0M05137g"
FT                   /product="Similar to uniprot|P21827 Saccharomyces
FT                   cerevisiae YGL097w SRM1"
FT                   /protein_id="CAG62545.1"
FT                   /db_xref="HOGENOM:HBG124062"
FT                   /db_xref="InterPro:IPR000210"
FT                   /db_xref="InterPro:IPR000408"
FT                   /db_xref="InterPro:IPR009091"
FT                   /db_xref="InterPro:IPR011333"
FT                   /db_xref="InterPro:IPR013069"
FT                   /db_xref="UniParc:UPI00003B70BA"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJM5"
FT                   /transl_table=1
FT                   /translation="MPKSYNENDIWKIRDVFGRDLSYISSCLPSLEDYKQINLNSSDLE
FT                   SGYSPLHVTLRERLLQKSFLLYKRWVDDEKQMSYKIGQHILARKDREGLTPMDLYNIEF
FT                   QRALKVKPQLLEYTIDNGNLKPKVIFEKVNHLDSEGIATTKSCSNNELLRSTSFLEIPQ
FT                   NYSDMAKIRNLGGSHLLTFGSNVNAQLGTGNKDDRQHFHETDYQQLGGDLPLDPKKFSI
FT                   KEVLMSRYHCLVINSFGEVFTCGNSNRGRLGNGETNTTVSVFTKIATFETGVRHVSISN
FT                   HHNLLVDGNGYIYSWGWNQYYQLGYTSSNKQGDSKHTLCKSSPKRIPYFDNINIKYVAC
FT                   SKVHSCALSQDNKLYLWGLNLGQMGNKKPLHVNLDISHDHNNGYIIESPLVIDLSHLQV
FT                   EQVLALELVTFIRCSGNTLIVLTDFCMRTFKISTPKPKNPTRIDIFSHYTPKTISADVV
FT                   DMKCSNKVGNHLFFKYASGRVGYLSLKKENVESWSKLSNELPISFSWKPNFARNNCTDF
FT                   AVGYNGDIIICTYGGEIFISRNHAEFERIYSNKLITGRAVKISSDTSLGSVAIIKQDYL
FT                   FMPAKYLKDTFDFDLAIYSPIYQNVGDTLSLGSLGLQCHVKETDSQLFLSSKSNISNLR
FT                   YSEINGSSVNENQIKCSSYDVILNNDRGIIECYSFKSLFSLRCSKFLNAILNDGKFTVN
FT                   NELFFTANETANGILQIKTHDLTTSAVYYKISVDLVHFLLTDVKPANQQRSIAILSITD
FT                   NYAHGTTLRNALSSYLLGMLTNDTDENRIKSPGNHLLGDTILRLKDKTLIVDSFLLSAR
FT                   SNYFKGLLSNSVFCEKDNDGKYLINLEIYSYKQFDIILKYLYGVDFSDLHPHYESEDGG
FT                   LTNFLESLVLADELCLEPLKCYMQVLLSQFIDGNSIIPLFIYSVRSNAEMLCLLCSTFI
FT                   AIHIGVLFVKDNVQLISQNFDDSHWKILQNNISYITSEQLNHELWYNNSTDNWRSLFKN
FT                   DINKFNSKFISPKDKFSPIFDIKDTLEVSSKKTSTDRRRSSTSTRPIKFKNTTMNNTSD
FT                   NPHRRQSNGSVSIAEKLSASNSSDEDSQFIEVTRKPKRKSVSNIQESQTPVPKLHPPKP
FT                   NILIHRKLSGDEKLLPSLISNEPIVEIPNQKKNQSEIGPKKPISFKKTSQKERIKTTTQ
FT                   ADKQKENKTKESAWTNQKQNSSLSNPKDNQTSKLAALPSLNDSKLQKQDLKPNKKSKKK
FT                   ANNKQSAEFISSGNFAGLTPYLSTVHKESVTTDTTPSWTASTVSDFKQKVEAQEFEKWF
FT                   QEESKRVQLELERRGSSHHDELKVLYDSSQNIPGFVIDSNVKKAGRKIKGKFKAKLKNK
FT                   DENINSIQ"
FT   CDS_pept        complement(556347..557696)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000766" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17437870"
FT                   /locus_tag="CAGL0M05159g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /function="double-stranded RNA binding"
FT                   /function="ribonuclease III activity"
FT                   /biological_process="RNA processing"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAG62546.1"
FT                   /db_xref="GO:0003725"
FT                   /db_xref="GO:0004525"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0006396"
FT                   /db_xref="HOGENOM:HBG059624"
FT                   /db_xref="HOGENOM:HBG203499"
FT                   /db_xref="InterPro:IPR000999"
FT                   /db_xref="InterPro:IPR001159"
FT                   /db_xref="InterPro:IPR014720"
FT                   /db_xref="UniParc:UPI00003B70BB"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJM4"
FT                   /transl_table=1
FT                   /translation="MGKIGKVGKASKKKSRLTSELVDLYEKNSTEQVGTYQYSNAIQIE
FT                   HAVHKLVEAYQRILKLSPNIVQYYETLNSLSDPEKVPPQLISLFTRYPLKLAAEIKTLH
FT                   DLNKSTLLDDISGYEAKFDASNREPVLGDLELSDLQDLEDDDIGRLDLDLSVAKSSESS
FT                   ECITSKEKSSKWPPEMPEIKDHVIRARVFMHKSLVNDKVYLNESDIIKSNNERLEFLGD
FT                   SILNTVMTMIIYNKFPSLNEGNLTELRKKLVKNETLREWSELYELPKQLKSNLSPDVDL
FT                   STSKTSADIFEAYIGGLMEDDPKTNLVKIRKWLKKLAKPKIEEAMKTSIQLEPTNNLDM
FT                   NAKRKLYSLIGYAALKLHYHTVQRPTNENPVTIVQCRTGDGTILGVGKARNIKLAGVKA
FT                   AEDVLRKEDVIEKYAKLRASIPREQSVSKNEQPRTTNKEQGEKDICELSG"
FT   CDS_pept        complement(558426..559691)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000768" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18501158"
FT                   /locus_tag="CAGL0M05181g"
FT                   /product="Similar to uniprot|Q02554 Saccharomyces
FT                   cerevisiae YMR240c CUS1U2 snRNP protein "
FT                   /biological_process="mRNA processing"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG62547.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006397"
FT                   /db_xref="HOGENOM:HBG203500"
FT                   /db_xref="HOGENOM:HBG253372"
FT                   /db_xref="InterPro:IPR006568"
FT                   /db_xref="InterPro:IPR007180"
FT                   /db_xref="UniParc:UPI00003B70BC"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJM3"
FT                   /transl_table=1
FT                   /translation="MARSKRKRSGVSDVKASIIDAIETTHKQPAKKKKRVNATPNLESE
FT                   YRELFKKFNGVEERDVEEDRNPKVASHEPTLRDDHVADAKSADAKSADAKSADAIPQPL
FT                   SNRKARLMNKPTLAELKSSVLTPQLIEKHDCDAKEPYFLASVKTSFNVVQVPSHWQSKR
FT                   DYLSGRSLLEKKPFELPDLIKQTGVDSMRNTLPEDEEQEKLKEQTRNAVRPKLGKLDLD
FT                   YKKLYDVFFKLGKKWKPDTMLPYGDVYYENRNLQGEARWRKLVKDRIPGRLSDDLRHAL
FT                   GLQPGQLPPWCLRMKDLGMPPSYPNMKIAGLNWDISNFKDNKYGKVSKSNWTNTPLFGA
FT                   ILQFDDHQQAPEVEVPEVEVEVEVPVPEVPVPEEVKKPEPVTSIPESHSAKPVNTIRGS
FT                   VEHGGIQDNVESAQDELANYKF"
FT   CDS_pept        join(560321..560506,560842..562494)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093739" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18501159"
FT                   /locus_tag="CAGL0M05203g"
FT                   /product="Similar to uniprot|P36070 Saccharomyces
FT                   cerevisiae YKL125w RRN3"
FT                   /protein_id="CAG62548.2"
FT                   /db_xref="HOGENOM:HBG058144"
FT                   /db_xref="HOGENOM:HBG396061"
FT                   /db_xref="InterPro:IPR007991"
FT                   /db_xref="UniParc:UPI00017BD8F5"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJM2"
FT                   /transl_table=1
FT                   /translation="MMVFESNNKRPATEELPDIESKKPRVDIVGSTEIYVEAGNDAHFS
FT                   DEMYRKFIKNALDELEKNDPMQINAITSQISLSAKNPDRISTKNFTILLEVLSNNINKV
FT                   DSSKGLPLIQCIINFEKWWELPDPALGKYIFFIKVLCSSIPKWWQDVAMIMISSFILSS
FT                   EKTTQHHELLKYFLRMIPSSMSYIDSYLIRYFPNKNDSKKNIVNYISNVLMLTSYCQEL
FT                   KFQAWSLIMERVISIDVELQNELDELDDDIDDEMVDDDGDDSDEDEDDEDEDHSGAEDD
FT                   AEDDEDEDDGDDFDDADGQEEYNIDLTQGIKELSNKLDAILSLLSSEIIKDMTPEKLES
FT                   GEGIGTFNTLTTLFKTHILPTYYTRSVQYIMFHLSQQQLELMDSYLVTLIDISFAANET
FT                   SEKRIKSLQYLGSYIARAKKLSRTQIVFVASYLTSWLNRYVIEREEEVNQPGGMDRFKH
FT                   FYAAFQALCYIFCFRHKDLRDVDGSWECELDKFFTRMVISKFNPLKYCNENVMLMFARI
FT                   AQEEDVAYCFSIIENNNNELLRGIMGKADSSRGGTPTPMGPATSWSLATRQQFIDLQSY
FT                   FPYDPLFLKNYKNMMKEYYIEWSEAGGEYESDGSDE"
FT   CDS_pept        563163..564308
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000188210" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20195779"
FT                   /locus_tag="CAGL0M05225g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /function="binding"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="mitochondrial inner membrane "
FT                   /protein_id="CAG62549.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0005743"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG541806"
FT                   /db_xref="HOGENOM:HBG735918"
FT                   /db_xref="InterPro:IPR001993"
FT                   /db_xref="InterPro:IPR002067"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="UniParc:UPI00003B70BE"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJM1"
FT                   /transl_table=1
FT                   /translation="MPKRTLEEWEEDAMESVPYLASDEKGSNYREATQPVILEDSKIVQ
FT                   PKLEVHKTVKPWVHFLAGGIGGMAGAVVTCPFDLVKTRLQSDIYQNMYKSQAEALMMNT
FT                   TRPRIVNLTLQAATHFKETVSIIGNVYRQEGFRSLFKGLGPNLVGVIPARSINFFTYGT
FT                   TKDIYSKAFNNGQEAPWIHLMAAATAGWATATATNPIWMVKTRVQLDKAGKTRTYKNSY
FT                   DCLKSILRNEGIYGLYRGLSASYLGSVEGILQWLLYEQLKHLIKKRSIEKFGAHDESTM
FT                   TTTDKIKQWCQRSGGAGLAKFMASIVTYPHEVVRTRLRQSPLENGKVKYTGLVQSFRVI
FT                   IKEEGLASMYSGLTPHLMRTVPNSIIMFGTWEVVIKLLSDI"
FT   CDS_pept        complement(564780..565481)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000111183" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17437871"
FT                   /gene_name="MED8"
FT                   /locus_tag="CAGL0M05247g"
FT                   /product="Mediator of RNA polymerase II transcription
FT                   subunit 8"
FT                   /biological_process="regulation of transcription "
FT                   /biological_process="transcription"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG62550.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006350"
FT                   /db_xref="GO:0045449"
FT                   /db_xref="HOGENOM:HBG191925"
FT                   /db_xref="HOGENOM:HBG204194"
FT                   /db_xref="InterPro:IPR019364"
FT                   /db_xref="InterPro:IPR020178"
FT                   /db_xref="UniParc:UPI00003B70BF"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FJM0"
FT                   /transl_table=1
FT                   /translation="MSGINGALVEDIKPDYSGVPGPALDSVRMRLAQLTHSLRRIRDDL
FT                   SRADLTQWYSLQSQINVTLSQLMSVTSTLQHFEDTLDSTIVYPLPKFPTTSHESLLTTL
FT                   LRKKNIPEVEEWIKDAIEASGVDTNMMRDDEIEKILEKNNEDSKWALEVFAKEFEKRES
FT                   NGDTADDLDVLGNALKPVKTSVRQRAQSPFQVEDVLKYMSRGEVDRGSSSQEGLSTNNE
FT                   QSGDKDIIMAD"
FT   CDS_pept        565772..566170
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000072577" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18501160"
FT                   /gene_name="AIM4"
FT                   /locus_tag="CAGL0M05269g"
FT                   /product="Altered inheritance of mitochondria protein 4 "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAG62551.1"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="HOGENOM:HBG124063"
FT                   /db_xref="HOGENOM:HBG512096"
FT                   /db_xref="UniParc:UPI00003B70C0"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FJL9"
FT                   /transl_table=1
FT                   /translation="MVHSDNNIIKDPKRNGEKPVEMILNGNRKESKRYNEQLSSLEERK
FT                   QKKKLKVVQEDSAYMDQSANQTSSAGLDKDTNELGPKSIFYDPDWNPKGEAPDGFRNVP
FT                   YNPKTFKRLHNQIEEDLGSLSGKLKYPE"
FT   CDS_pept        complement(566250..567509)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000160330" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21044619"
FT                   /locus_tag="CAGL0M05291g"
FT                   /product="Similar to uniprot|P13712 Saccharomyces
FT                   cerevisiae YBR195c MSI1"
FT                   /protein_id="CAG62552.1"
FT                   /db_xref="HOGENOM:HBG021032"
FT                   /db_xref="HOGENOM:HBG396292"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR013979"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="InterPro:IPR022052"
FT                   /db_xref="UniParc:UPI00003B70C1"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJL8"
FT                   /transl_table=1
FT                   /translation="MDADNIEDIEEQPVSTIPEDVQTRYIHWKKNTKLLYDYLNTNSTK
FT                   WPSLTCQFFPDLDTSSDQHRLLLSSFTSSQLPEDESVYISKISTLKHLNWSSLNNFDMD
FT                   EMEFKPDPSVKLPPKNLTTEVSIRFPNGDCNRSRYLPQNPDLIAAASSDGSVYIFNKTK
FT                   HGNSVLRSKSSDDFQARLFSGSHDAQNLDNFNEAVSLSWNKHKEGILGVSYSQGQCNIW
FT                   DVKKFSRSNILISQPELTVTFDSNGCNDLDWMPMHDSMFIACGESNKLGLFDMRLNGEK
FT                   EVNSISNYKHEDGINTCKFNPGNSLLVASADTCGRINLWDIRKLDQEPISTMQHGSSIS
FT                   TIEWNPNIGVVFASAGQEDGLVKLWDASVGKEIFVHGGHMLGVNDISWDMHDPWLMASV
FT                   SNDNTIQIWRPAKNIVSKPS"
FT   CDS_pept        complement(567906..568646)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17437872"
FT                   /locus_tag="CAGL0M05313g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /protein_id="CAG62553.1"
FT                   /db_xref="HOGENOM:HBG124064"
FT                   /db_xref="UniParc:UPI00003B70C2"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJL7"
FT                   /transl_table=1
FT                   /translation="MDIEFGSPLKPSKSEDLERAAKQPEDVKNEFHAPVKSFPDLKNIA
FT                   AEADAAMVADLKKKLKGKTKKLKHKDKDRAKRIDQPTLSTATSYSTIHGFSNRRGNMED
FT                   QTSSHRSGSPPFFNNSLSSRGDLQSRQSHKPDSKWTEIDMLDDVRRMAKDKFFEGGFPE
FT                   EFEENLTKNRMSQAKLFQIMRDRNEKLAKTKRRTIRASHVDTRSQSHVEDEGMEPFDQD
FT                   ELESTKQEEKAYVKEIIDTISSLR"
FT   CDS_pept        complement(569132..571552)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000212424" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19348993"
FT                   /locus_tag="CAGL0M05335g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /function="transcription regulator activity"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG62554.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0030528"
FT                   /db_xref="HOGENOM:HBG027600"
FT                   /db_xref="HOGENOM:HBG559818"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR006594"
FT                   /db_xref="InterPro:IPR007582"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR013720"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="UniParc:UPI00003B70C3"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJL6"
FT                   /transl_table=1
FT                   /translation="MSGKEKDQKNVKGAAAGAKSGAKAPANGSRPSGQFSASDLNRIVL
FT                   EYLNKKGYHRTEAMLRAESSRTATPVNKNSPANTKDGSLPEPSTVPPAQDANAKPVSNP
FT                   VDSASAKRDASGEVVLKDKVRQDMSPEHYIRAYTMLKNWVDSSLDIYRSELSYIMYPVF
FT                   IYLFLYLVSKDPIYARRFFDKFSSDFRVKHGSEINRLFSVNSVDHIKENEVAKAFNGNR
FT                   YRVTISRAAFYLMLYFLTDNEGVGGSLIIGIINDHIQPNVMDTVRSKDRISDGVEIAAD
FT                   TAGTDGLAEINNAPVTLGPFPKDEEFVKEIETELKIKDDQEKKQIEQSKKGDGSKEGSV
FT                   ASEDVAKEPTADLDDTNDRPTLLQEYRKMNGDESSATPQEESDAAADKQDGKSGDSTKV
FT                   KSEDKKTAVAVVKTEEVAAMMSSPSKDTLPLPPKTALDIKIEIQKVKESRDAIKLDNLQ
FT                   AALPSVCMYTFHNTNRDMTSLEFSDDCRLAAAGFQDSYIKIWSLDGSSLINPKYSSSQF
FT                   DRFSQDNTCSTLVGHSGTVYSTSFSPDNMYLVSGSEDKTVKLWSMDTHTALVNYKGHNH
FT                   PVWDVKFSPLGHYFASASHDQTARLWACDHIYPLRIFAGHTNDVDTVSFHPNGCYVFTG
FT                   SSDKTCRMWDVSTGDSVRLFLGHTAPVLSTQVSPDGRWLATGSEDGVICLWDIGTGKRI
FT                   KQMRGHGKNAVHSLSFNKEGNVLISGGADHSVRVWDVKHGTTEQGPEPEQPFNAHVGDI
FT                   TASINQDIKDYGRRRTIIPTNDLVASFYTKRSPVFKVKFTRSNLALAGGAIRE"
FT   CDS_pept        572309..573982
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000246638" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21044620"
FT                   /locus_tag="CAGL0M05357g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /function="phosphatidylinositol binding"
FT                   /biological_process="cell communication"
FT                   /protein_id="CAG62555.1"
FT                   /db_xref="GO:0007154"
FT                   /db_xref="GO:0035091"
FT                   /db_xref="HOGENOM:HBG174475"
FT                   /db_xref="HOGENOM:HBG397148"
FT                   /db_xref="InterPro:IPR000270"
FT                   /db_xref="InterPro:IPR001452"
FT                   /db_xref="InterPro:IPR001683"
FT                   /db_xref="InterPro:IPR011511"
FT                   /db_xref="UniParc:UPI00003B70C4"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJL5"
FT                   /transl_table=1
FT                   /translation="MLKNFKLGKEKHSRITSADISTPRQDGNNVIKHVKTVPVQVLNQR
FT                   STPSRHASNSSRPQMQSPEKVIKARDSYKAKRANELSFNKGEFFYVTGEDTSYYKASDP
FT                   SAGKNGVVPKSHFDVIDRTRPSSSDALGRSVSTSSRNGEKMGTLYAIVLYDFKAEKSDE
FT                   LDTFVGENLFICAHHNYEWFIAKPIGRLGGPGLVPVGFVSIIDIGTGYATGNDVKEDIA
FT                   SVNLPTVQEWKSNIAKYKASNINLGAVEVPPNGEFGTRQKIQQQIMEEERLRQQQIEAQ
FT                   MTPKVPEPPEIIYASVDAYGLENEKYWYTVSCILDNGRARRLKRYYQDFYDLQVQLLDA
FT                   FPAESGKLRDANGNWTRRIMPYIPGPVPYVTDTITKKRREDLNIYVADLIRLPKYITSS
FT                   RMIQNIFRVKNNGYDTEFDKKDASIHTDNSSTHSKSRTSKIHDKDSTLTGEELNLYEKM
FT                   SELSVSTPGSRPHSRPPSSLPPQLKSIKVKFYYKDDIFALMLPQHISLDELKNKIGPRI
FT                   DTEDFILNIKLKDGLGEEIKTDDQVSYIIQSKQKIAVTDA"
FT   CDS_pept        574752..575390
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000142324" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20195780"
FT                   /locus_tag="CAGL0M05379g"
FT                   /product="Similar to uniprot|P38307 Saccharomyces
FT                   cerevisiae YBR201w DER1"
FT                   /protein_id="CAG62556.1"
FT                   /db_xref="HOGENOM:HBG124066"
FT                   /db_xref="HOGENOM:HBG204200"
FT                   /db_xref="InterPro:IPR007599"
FT                   /db_xref="UniParc:UPI00003B70C5"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJL4"
FT                   /transl_table=1
FT                   /translation="MDAVLLNIVNDVPVVTRYWTMGCIAVSALVRFNMINSIKMLYSYE
FT                   IVFQKGHYERILYSLFDYGLFNWMSLMNIVIAANHLSFLENSFSLKRRYVWILFLTLCS
FT                   LLGMSYFGQPVASLGVLLQENLSYYYLKKNNEQMNIRLFGNIAVSPLLVPFYLNCLLLF
FT                   VYHMDVVEVAMFFLPGHIMFYMDDMLKRIYGVDLTKTPYDWWLGLKETQ"
FT   CDS_pept        complement(575740..575952)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19348994"
FT                   /locus_tag="CAGL0M05401g"
FT                   /product="Similarity"
FT                   /protein_id="CAG62557.1"
FT                   /db_xref="HOGENOM:HBG124067"
FT                   /db_xref="UniParc:UPI00003B70C6"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJL3"
FT                   /transl_table=1
FT                   /translation="MSLLKFSANQKLQTALQFTYLGLCLVGPFMMPAKQANTGFLALSK
FT                   SLLSEDHMNSHSLVKGKRHPRAYFR"
FT   CDS_pept        577097..579535
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000224125" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21044621"
FT                   /locus_tag="CAGL0M05423g"
FT                   /product="Similar to uniprot|P38132 Saccharomyces
FT                   cerevisiae YBR202w CDC47"
FT                   /function="ATP binding"
FT                   /function="DNA binding"
FT                   /function="nucleoside-triphosphatase activity"
FT                   /biological_process="DNA-dependent DNA replication
FT                   initiation"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG62558.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006270"
FT                   /db_xref="GO:0017111"
FT                   /db_xref="HOGENOM:HBG409874"
FT                   /db_xref="HOGENOM:HBG546212"
FT                   /db_xref="InterPro:IPR001208"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008050"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR016027"
FT                   /db_xref="InterPro:IPR018525"
FT                   /db_xref="UniParc:UPI00003B70C7"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJL2"
FT                   /transl_table=1
FT                   /translation="MSTALPSIQLSVDYQTLLSEISDFLQHFKVDEVGAADDSATIDAD
FT                   VNIDDAEELMKRGPKYMYLLQQIANRERDTIEIELNDVLRFQNEKFLEGGVAQDLVALI
FT                   QKNANHFIDLFSRCIDSVMPLPTKEISYKDDVLDVILNQRRLRNERMLSDRTNEIRSEM
FT                   DTDTTSNDIMRELAQDETETFPANLTRRYTVYFRPLTRSYAVRYNSKKYLTGSIPLSVR
FT                   QIKGELLGELITVRGIITRVSDVKPAVTVIAYTCDQCGYEIFQEVNSKTFTPLVECTSR
FT                   ECSQNQTKGQLFMSTRASKFNAFQECKIQELSQQVPVGHIPRSLTIHVNGPLVRSVTPG
FT                   DIVDIAGIFLPSPYTGFKALKAGLLTETYLEAHHVRQHKKKFASFQMTPQVRSNVDALA
FT                   QSGNVYERLAKSIAPEIYGNLDVKKALLLLLVGGVDKRVGDGMKIRGDINICLMGDPGV
FT                   AKSQLLKAICKITPRGVYTTGKGSSGVGLTAAVMKDPVTDEMILEGGALVLADNGICCI
FT                   DEFDKMDESDRTAIHEVMEQQTISISKAGINTTLNARTSILAAANPLYGRYNPRLSPLE
FT                   NINLPAALLSRFDVMFLLLDTPNRENDEQLANHVAYVHMYNKQPDLDFEPIEPTMMREF
FT                   IAYARTMRPVMTAEINDHVVSAYIRLRQDSKREMDSKFSFGQATPRTLLAIIRLSQALA
FT                   KLRLSETVDIDDVEEALRLIRVSKESLYQENRKRDEDSNPTTKIFTIIKKMSQEGDYKG
FT                   SLPYDSIVKTVRSRGFTMLQLNNCIQEYSFLNVWHLINEGNTLKFVDDEDQSSQDIEMA
FT                   "
FT   CDS_pept        580648..583446
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000112003" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17437873"
FT                   /gene_name="COS111"
FT                   /locus_tag="CAGL0M05445g"
FT                   /product="F-box protein COS111 "
FT                   /protein_id="CAG62559.1"
FT                   /db_xref="HOGENOM:HBG124068"
FT                   /db_xref="HOGENOM:HBG204203"
FT                   /db_xref="InterPro:IPR022364"
FT                   /db_xref="UniParc:UPI00003B70C8"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FJL1"
FT                   /transl_table=1
FT                   /translation="MQSVNIVSTNYSRYGVSVYDRLYRKDKNVSAKHRPSSTGVYGHDA
FT                   STVDHASRSNNNLNLTRSTSAISESDDVATISTNNSRRSVIKRKYKSLITASSKKLITK
FT                   LYEHGSNSDSFSIFSHKTSQSHHPAQRLGTEEDLIINDLFKRKEISDLPDEVLRNILSN
FT                   VKDDQRTLVNCLYVNKAFYNATKPTLYERPKFTSTYRVAQFVTSIRTNPQNGLYVRELD
FT                   LSKLKNGSLNGKSTSNTGVVADSPDVDEYNPMRTRTGSVTSFTSVTSTANSNTALSITT
FT                   NNKDVALAGWRDWRYRHDPLYSSPVLNSYNAKRTVSRAPSIKSSHSSSSLTLFPGLKSK
FT                   ESFAQLSEGKSSDNGNNGKRQRSNSSVSSITNSLMSSLYNGSHISLNTTLSGSDNNSSK
FT                   TQSKGKSSSSPGNPNDSSGEQDSIISSSSQIDTNTFGMTSSKSTSSTSNWFRMKLHGNG
FT                   TRKLRLRSNKAISSKKDEQQNEESAQTAQKIETPIIKRTEPFSTPHPYTNKFLLKYAQY
FT                   KDLPLGYILHILDHCPYLYILDLSNLTLCTDFEIIEGRRYKGRKQRFGSSRALPVVQES
FT                   VISTDVPNDLDVIYLTDSSKTYEYYDRLRNTNKHKRSSSSNNLWSIPNQGWSDAPAPIG
FT                   SHKNDLRRTHSQTIGRSNVELRKLNASEIFEHIATNQKSAYNTHLRVYMKNVLWCTQDM
FT                   VKSFVLENFDQQAENLGEDKSSEMFIHDMNFSFENSGLNRNFVWTCEGNLQEFIAMVVL
FT                   DEVNRKDDLEIENLFNIKAERILTPTNGPERAPEVHYISNVFTVSYGFQSNKKREMKFR
FT                   VTILKTDTPMYFSIKKLADDYTSVVIKLQTNKNVALHGSETADIITTDQGSVLPEDVPE
FT                   DNNADDTNNGENTIAQPFSNDPKERIERITQEIVARLKDLRGSDLRRNIGENNYVRERF
FT                   LL"
FT   CDS_pept        complement(583722..584786)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000141808" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17437874"
FT                   /locus_tag="CAGL0M05467g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /protein_id="CAG62560.1"
FT                   /db_xref="HOGENOM:HBG124069"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="UniParc:UPI00003B70C9"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJL0"
FT                   /transl_table=1
FT                   /translation="MEVLREACSLEGELVNGRVDDILAKYEQVPQRELSRVIDSRDFEV
FT                   RFLKERTRVVTLDGIDMRCFDNIRDGERRDSVFLLIHGLGGSMDQFQPLMKLLTLLKYR
FT                   VIALDLPGFGQSGSSTNGYDMLYVTSVVKKVVDNNIENKTDIDFKVVGHSMGCYIASHF
FT                   VQMYHEEYNIDKLVLTCPPPPSISTLRQDNYIMKMAMRGLMWAPFIFNIYRVWFDQSKG
FT                   LNSSGIMNFFSANTETFQDEETENKNLKFRKLWQFSNNIKIDTSTIFSYFLGWKFPDWE
FT                   DLDNIINTNNVELVVIYAEHDKITPKQDAQLIFDAFKNVAATKKKLLEITNCGHNIFFN
FT                   CPEKACKLFQEQVF"
FT   CDS_pept        585392..586672
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000160667" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17437875"
FT                   /locus_tag="CAGL0M05489g"
FT                   /product="Similar to uniprot|P38130 Saccharomyces
FT                   cerevisiae YBR205w KTR3"
FT                   /function="glycolipid 2-alpha-mannosyltransferase activity "
FT                   /biological_process="protein glycosylation"
FT                   /cellular_component="membrane"
FT                   /protein_id="CAG62561.1"
FT                   /db_xref="GO:0004377"
FT                   /db_xref="GO:0006486"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG192431"
FT                   /db_xref="HOGENOM:HBG396033"
FT                   /db_xref="InterPro:IPR002685"
FT                   /db_xref="UniParc:UPI00003B70CA"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJK9"
FT                   /transl_table=1
FT                   /translation="MGAVKKKLMPKSAMFVRKYEKTIRVGFASFLMALTVLFLMHKPDA
FT                   GTTAMAPQQTMAGFTSVVKNGQPGYVIPASDLLQDVKEHPLDDGVKEKAAFITLARNGD
FT                   LWSLVNTIRHVEDRLNHRYHYDWVFLNDKGFTDEFIRLTSALVSGKAKYGKVPKEHWEV
FT                   PSHIDKEKYEISRRKMVLDKVPYGDSTPYRHMCRYQSGLFYRHELVQEYDYYWRVDTDI
FT                   TVFCNFQYDIFKFLRQNKKKYGFVISLTEYEETIPTLWATVKEFMKKYPQHIHKNNFLN
FT                   FISDDGGETYNGCHFWTNFEVGDLNFWRSQAYTDFFNFLDQKGGFYYERWGDAPVHSIA
FT                   AALLLDKDEIHFFDGFGYHHPDFQSCPHEEEVRLQNKCTCNFSKDKIWMTYYFCNLRYF
FT                   EAKEIGLPPKIEANLDEEYKKKLKVSS"
FT   CDS_pept        587202..588509
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000159782" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17437876"
FT                   /locus_tag="CAGL0M05511g"
FT                   /product="Similar to uniprot|P38310 Saccharomyces
FT                   cerevisiae YBR207w FTH1"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="membrane"
FT                   /protein_id="CAG62562.1"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG055792"
FT                   /db_xref="HOGENOM:HBG325002"
FT                   /db_xref="InterPro:IPR004923"
FT                   /db_xref="UniParc:UPI00003B70CB"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJK8"
FT                   /transl_table=1
FT                   /translation="MAFEDYFSFQVFFIFLRESLEIAVIISILLTIVKQGLSVGDDSED
FT                   TGNQISHGIDDGIPINDVNAERIPLTVEEEEEAFNIEGESMVPSTDESLSYADNLKLYK
FT                   KLKIQIVSGGALGLIICAFIGGAFIAVFYHIGTDLWTMSEHYYEGILSLVASVIISVMG
FT                   LFFLRMGKLREKFRVKLASIIYSDRGGMISKVNSSKAVSFSEKYAFFILPFVTSLREGL
FT                   EAVVFIGGVGLDQPMSAIMVSMACAVCISGVFGVFFFRYSSSLSLKICLVVTTCFMYLI
FT                   ASGLFSKGVWQLELQDYVNKCNGQDMSEVGSGPGSYDISRSVWHVNCCNGETDGGWMIL
FT                   TAIFGWTNSATYGSVLSYIIYWLILIGCLKLLTLEEQYGYIPGLPVSWQKKRIIKRLKI
FT                   AHASLKLKQNIGSTSMSNGVQSQRVSKDSTTPLISH"
FT   CDS_pept        complement(588667..594171)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000251581" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17437877"
FT                   /locus_tag="CAGL0M05533g"
FT                   /product="Similar to uniprot|P32528 Saccharomyces
FT                   cerevisiae YBR208c DUR1 urea amidolyase "
FT                   /function="ATP binding"
FT                   /function="biotin binding"
FT                   /function="carbon-nitrogen ligase activity, with glutamine
FT                   as amido-N-donor"
FT                   /function="lyase activity"
FT                   /function="peptidyl-prolyl cis-trans isomerase activity "
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /biological_process="protein folding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /protein_id="CAG62563.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0003755"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="GO:0009374"
FT                   /db_xref="GO:0016829"
FT                   /db_xref="GO:0016884"
FT                   /db_xref="HOGENOM:HBG304781"
FT                   /db_xref="HOGENOM:HBG567256"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR003778"
FT                   /db_xref="InterPro:IPR003833"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR013024"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR013816"
FT                   /db_xref="InterPro:IPR013817"
FT                   /db_xref="InterPro:IPR014084"
FT                   /db_xref="InterPro:IPR014085"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR020899"
FT                   /db_xref="UniParc:UPI00003B70CC"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJK7"
FT                   /transl_table=1
FT                   /translation="MTATNICPSIGWSIQDWIDFHFKSTPKDSYESLLELVKNQRIAPE
FT                   DPAWISVATESLLEQQWQLLQSRHEKEKLPLYGVPIAVKDNIDAKGFPTTAACPSFSYM
FT                   PTRDSTVVELLKQAGAIIIGKTNLDQFATGLVGTRSPYGRTPCVFSDKHVSGGSSAGSA
FT                   SVVARGIVPIALGTDTAGSGRVPAALNNIIGLKPTRGIFSCSGVVPACKSLDCVSVFSM
FT                   NLSDAEKCLKIMTKLDIENDEYSRSFPANPLQSFNKNLTVAIPKNVMWYGEKENPLLYD
FT                   RAIDNFKQLGAQIKIIDFEPLLELARCLYEGTWVAERYAATRKFLETSPQQSTLDPVVY
FT                   GIIKSATKFDAADAFEYEYKRQGILRKVEVLLQDIDVLCVPTCPLNPSFEEVDKEPILV
FT                   NSRQGTWTNFVNLADLSALAIPVGFRSDGLPNGVTLIAKKFEDYALLQLAKRFLAQLYP
FT                   SGTRPYGMFLDRYVGLKDDSLEGPIVSSDDSIVLAVVGAHLRGLPLHWQLEKVNATFIC
FT                   STKTAKKYELYALPKNGPVLKPGLRRITSGTGSQIELELYSVPKEKFGEFISFVPEPLG
FT                   IGSVELENGKWVKSFICEESGYNSTGSIDISHYGGFRAYIESIIPSNESKKGHFKTVLV
FT                   ANRGEIAVRIIKTLKSMQIKSLAIYSATDKYSQHVLDVDMAQALDGHTVEETYLHVEKI
FT                   ISIAKKYDVDAIIPGYGFLSENASFADRCEQEGIQFIGPRGETIRKLGLKHSAREVAKS
FT                   AGVPLVPGSPLVKNADEAFTIAKNIGYPVMVKSTAGGGGIGLQKVDNEQDMRKAFETVK
FT                   HQGSSYFGDSGVFMEKFIDNARHVEVQIMGDGKGKTLALGERDCSLQRRNQKVIEETPA
FT                   PNLPRETRQKMLTAAERLGAYLNYRGAGTVEFIYDEQRDQFYFLEVNTRLQVEHPITEM
FT                   VTGLDLVEWMIKISAGVMPSLDEFNISQNGASIEVRVYAENPLKDFRPSPGELVDVQFP
FT                   NDCRVDTWVKKGTKISPEFDPTLAKIIVHGKDRNEAILKMKKALNETKIYGCVTNVDYL
FT                   KSLISSEMFRNAQLSTNYLNTYEYSPSAVEIIEPGALTTIQDYPGRVNYWRIGVPPCGP
FT                   MDNYSFRLANRIVGNDERTPGIEITLTGPTIKFYSDSLVSIAGGEVCCKLDEKKIPMFE
FT                   PISVKTGSVLSIGKIVKGSRAYLAIRGGIDVPKYMGSFSTFTMGNLGGFNGRALKRGDV
FT                   LSLPQQFDSEHGIPSPCFSPEKAPIYVRPDIPNDGVWTIGVLAGPHGAPDIFESEGMME
FT                   FFKSEWKVHYNSNRFGVRLIGPKPKWSRTDGGEGGLHPSNTHDYVYSLGAINFTGDEPV
FT                   IITCDGPSLGGFVCQAVVSEAEMWKVGQLKPGDTINFTPIDWQSARNLKENQDVIINDM
FT                   SSCALQKLSDQPLLKSPEDPILFQKDGQELQSPKVVYRQAGDRYILIEYGDDIFELNLC
FT                   YRIKSLIDIISQRNTKGIKEMSQGVRSVLVEYDGYEISQKELLKTLIAYEEQLPQEKNW
FT                   SVKSRIFRLPMAFEDKETLACVKRYQETIRSKAPWLPNNVDFVAEVNNLTHDDIRQLIY
FT                   TTRYMVLGVGDVFLGSPCAIPLDPRNRLLGSKYNPSRTFTKRGVVGIGGSYMCIYAADS
FT                   PGGYQLVGRTIPIWDRLMLQSKKDEPWLLSPFDQIEFYPVSEEQIDEYTDEWDNGNYKI
FT                   DVDDVVFDHGSYLKWVQDNIEAIEEHQRAQRGDNYSKFAQKIQEANADLKQTTTEVIEQ
FT                   NILEDDCEYIFSEYAGRFWKPIVEIGASIEKDQGVAVIEAMKTEMIVSSSVVGKLKKFL
FT                   FKNGDMVDAGDPVAIIQCL"
FT   tRNA            complement(595677..595748)
FT                   /gene_name="tRNA-Cys (GCA)"
FT   CDS_pept        complement(596196..597707)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000112193" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18501161"
FT                   /gene_name="DEM1"
FT                   /locus_tag="CAGL0M05577g"
FT                   /product="Defects in morphology protein 1, mitochondrial "
FT                   /biological_process="regulation of cell shape"
FT                   /cellular_component="mitochondrion"
FT                   /protein_id="CAG62564.1"
FT                   /db_xref="GO:0005739"
FT                   /db_xref="GO:0008360"
FT                   /db_xref="HOGENOM:HBG124070"
FT                   /db_xref="HOGENOM:HBG204182"
FT                   /db_xref="InterPro:IPR016610"
FT                   /db_xref="InterPro:IPR019190"
FT                   /db_xref="UniParc:UPI00003B70CD"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FJK6"
FT                   /transl_table=1
FT                   /translation="MTLRDVEKLRLWRLKIFRNQQPILRAKPPHASRKTQYLFQKIDNV
FT                   KSQFGTDGKGDLLWQRDGMNPYHDLYDPGDLKTHRLSVTKLLTKSWCELRFAYDLYSRL
FT                   PLFREAHLAAGERTHQKLENSEHTPVIRPQDIPQFSETVEIVEDDLHVLAASWAETITR
FT                   LIHLFSSGDAREILCHGYLNKETNQLYDPMETEVWDPSQHILISGIIDHLTLTSKNGNL
FT                   PLNNHHRSIDDSIAKLKNTRNEFAKNGLTIQISDVKTRTRKFIPPQESVQNATKLQLMY
FT                   YRHFLLSLGTDSDNTYEMLLYNARIRGVDVDQPLNPANCLLIMIQMDGFVGDFVKLQNG
FT                   DGFQFPKFDNAPISHSFTLADAKHHQFLQNINSHELAGQLLNGTFAKPITLRYFAMRLA
FT                   QMYSMLTPLISEKLKVEYYHNNECFQEVEFVNDKKSLGESCRSASSFWFGKRAIEPVEA
FT                   TTFNYNQYCKHCDYRDHCAWIKDSLAKSTKLGDELTQIARRIHNI"
FT   CDS_pept        complement(598033..598227)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000072576" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17437878"
FT                   /locus_tag="CAGL0M05593g"
FT                   /product="Similar to uniprot|P38374 Saccharomyces
FT                   cerevisiae YBR162wa YSY6"
FT                   /protein_id="CAR58074.1"
FT                   /db_xref="HOGENOM:HBG398765"
FT                   /db_xref="InterPro:IPR010580"
FT                   /db_xref="UniParc:UPI00017BD8F7"
FT                   /db_xref="UniProtKB/TrEMBL:B4UN58"
FT                   /transl_table=1
FT                   /translation="MAVQTPKQRLANEKFNKNVEKQRKFGKKKQDKQKTELPISKSWVY
FT                   FILFLLIGGGVLELFSLLF"
FT   CDS_pept        599520..600860
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093832" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17437879"
FT                   /locus_tag="CAGL0M05599g"
FT                   /product="Similar to uniprot|P38288 Saccharomyces
FT                   cerevisiae YBR162c TOS1"
FT                   /protein_id="CAG62565.1"
FT                   /db_xref="HOGENOM:HBG058721"
FT                   /db_xref="HOGENOM:HBG398421"
FT                   /db_xref="InterPro:IPR018805"
FT                   /db_xref="InterPro:IPR018807"
FT                   /db_xref="UniParc:UPI00003B70CE"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJK5"
FT                   /transl_table=1
FT                   /translation="MFQLLTLLLPLVSKVSADCQMIAGNYYCSKTDAAIYSNVGFSGSY
FT                   QDVTSMDEQSCVCSQQPFSFGGALAPFDEELSVHFRGPLKLSQFAVYYPASSNSKRAVA
FT                   EEDCDSVVAKPVHKHKRDVAVEVIEVTETVFIDENGNTVTASGTSTSMSTPTPSNPSQV
FT                   QSSQAPSQAPVSSSNKGTTTLSSTSKNTPSSSSSFQAASSSAAPIQDGGDWSRVAYFSP
FT                   GTASGCTFMNHQGGTAGSGVWSSCFGNSISFANSDGVTGAGSPQPLGDVTIKSGQEYMI
FT                   FSSTQCSANNAECGYYREGIPAYKGFGGNRKIFYFEFSMPSDTNGNGYNQDMPAIWLLN
FT                   AKIPRTLQYGLSTCSCWATGCGELDLFEVLSPGSDKMITHIHDGQGGGTQDFFQRPTDG
FT                   IFRAVVIFNASDKTIHLVQVDSAPAGGLSNDQVQQWLNKAGSAAALP"
FT   CDS_pept        complement(601941..603266)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000200927" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18501162"
FT                   /locus_tag="CAGL0M05621g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /protein_id="CAG62566.1"
FT                   /db_xref="HOGENOM:HBG433971"
FT                   /db_xref="InterPro:IPR007577"
FT                   /db_xref="UniParc:UPI00003B70CF"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJK4"
FT                   /transl_table=1
FT                   /translation="MKKELKLLIYANFMLVVFILYYTFDLLMLCIDDTFQDALLDFELN
FT                   PPRDRVTGLEVHDGKPELIPKIIHQTYKTEDIPEQWKESQKKCIDLHPDYEYILWTDEM
FT                   ALKFIKEEYAWFLDTFENYKYPIQRADAIRYFILSHYGGIYIDLDDGCERRLDPLLKVP
FT                   AFVRKTSPLGVSNNVMGSVPRHPFYLKLLNSLKHYDKYWFIPYLTIMGSTGPLFVSVIW
FT                   KQYKRWGVPENGVVRIMQPADYKKHTYSFFSISKGSSWHMDDAVFMKSLENHILSCVVA
FT                   GFIVGFIILYGEYVFYCWLCASWLGSSNDPEAESQDDEDDFIYNKGSQYYQQGHGSIFL
FT                   GTSISPLRKLNKSLFSTLYTKLVPSSSSSSASACSVSEKYSTPKLSRSVAEYYSLRKEN
FT                   SVHFNSPTPKGKRSRKDSNVRFTNFLLSDIEKLDPNVEDLTN"
FT   CDS_pept        603919..604449
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000190729" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21044622"
FT                   /locus_tag="CAGL0M05643g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /protein_id="CAG62567.1"
FT                   /db_xref="HOGENOM:HBG174727"
FT                   /db_xref="HOGENOM:HBG396998"
FT                   /db_xref="InterPro:IPR002908"
FT                   /db_xref="InterPro:IPR017789"
FT                   /db_xref="InterPro:IPR020895"
FT                   /db_xref="UniParc:UPI00003B70D0"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJK3"
FT                   /transl_table=1
FT                   /translation="MIRNILRRSAARVRIPVTSATCASRLVMSIRLATSTRYYSNGNEG
FT                   GPAMTNGVQIPKEVLELPLQQYHQHSESFLEGLFDNLEELSENYPQHIPEVEYSHGVMS
FT                   LTVAGVGTYVINKQPPNKQIWLSSPNSGPNRFDLYKGEWISLRNNETLLSVLDKELHDA
FT                   LPNDAEFKVESDQ"
FT   CDS_pept        604987..605217
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000165553" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21044623"
FT                   /locus_tag="CAGL0M05665g"
FT                   /product="Similar to uniprot|P01095 Saccharomyces
FT                   cerevisiae YNL015w PBI2"
FT                   /protein_id="CAG62568.1"
FT                   /db_xref="HOGENOM:HBG060096"
FT                   /db_xref="HOGENOM:HBG738171"
FT                   /db_xref="InterPro:IPR009020"
FT                   /db_xref="UniParc:UPI00003B70D1"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJK2"
FT                   /transl_table=1
FT                   /translation="MANSFIVTLKKSVPEREVKEFIDSVNGVGGQIVHEFSLIKGYTIK
FT                   MPEKVSLSSFKDKHNNVIESVEEDKEVKIAK"
FT   CDS_pept        605540..606652
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000247937" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17438959"
FT                   /locus_tag="CAGL0M05687g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /function="hydrolase activity"
FT                   /function="metal ion binding"
FT                   /protein_id="CAG62569.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="HOGENOM:HBG124071"
FT                   /db_xref="HOGENOM:HBG397583"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015376"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="UniParc:UPI00003B70D2"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJK1"
FT                   /transl_table=1
FT                   /translation="MSTFFGDVGLNRVSFLREDTEFIKLAFTSSEAKFIVFVNGEAFYD
FT                   ISSDGKPQLHIETSTSLKGIITTLSPLLETKDLRVDVSGVSITFLGLDDRIDGFSYKGK
FT                   YKGAPYFGLEFKVDDKTLLTPKDIEFTTSLQRMDRESLFMIDNHSATLYSHAKMYLDWL
FT                   NKYKFCPGCGSVIYPVHGGTKLQCSSAPEVNCNVRNARVNNVCFPRSDPVIIIAMANED
FT                   YSKICLARSFRKHGNFVMYSTIAGFMEPGESIENACAREIWEETGVHCDVDNVKIISSQ
FT                   PWPYPANLMIGCLGIVKFNNKDEIIDLGNDPELMDAQWFDTNEVRAAMDSYKTGWLVPF
FT                   KDEINFPGETAIAHHLIRHVCKQHQRLQKL"
FT   CDS_pept        607368..608978
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20196064"
FT                   /locus_tag="CAGL0M05709g"
FT                   /product="Similar to uniprot|P53165 Saccharomyces
FT                   cerevisiae YGL066w"
FT                   /protein_id="CAG62570.1"
FT                   /db_xref="HOGENOM:HBG059291"
FT                   /db_xref="HOGENOM:HBG103491"
FT                   /db_xref="InterPro:IPR013243"
FT                   /db_xref="UniParc:UPI00003B70D3"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJK0"
FT                   /transl_table=1
FT                   /translation="MEVQAQIKGIKESYIRDLNSGTSWKDLIDVAKNNPQEYSSDINSE
FT                   TVSKYFEPNTRIIIDALDKQTNFRVCKGCGKPILLEAIVDHIENHCSNSRDQKEGTVGD
FT                   MDSFSESLINSPTNGSIDGSLQTKENLKRSLDNESSDIMSSPGKQDAKKMKSETPGNSN
FT                   RKPKKVKQRNPTDKHLIDFDKQCGVKLPEGGYCARSLTCKSHSMGDKRSVVGRTEPFDT
FT                   LLAEYHRKHQTKIGAAAEKRAKQQEMQKMQKQTQRDHKDQKKTTQTKTDKRKKASTTTN
FT                   KTVRGTGSNRGKNSSTQNTMNYPVLTPEEETTQVLNGVSRSFPLPLESRVLSSVRYRTK
FT                   YVRMREMFASAFSVKPGFSNPGYGAIHSRVGCIDIDRTTDYKYRIRTPQPVNQQGTQNL
FT                   TPQQIQKMQQQRMIQNQMLQQKQAQNAQQMGFNNNNNNNQNIGSPGANMVNSPSINNQD
FT                   QLLRQTKQTNSNDLNHIGGQHPIPNVQGPSSPENNLINGVGVGSPVNNPQSPGMGNLQM
FT                   GTQMVGKDSSPSQFGGRVN"
FT   CDS_pept        complement(609160..610536)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000177048" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21044865"
FT                   /gene_name="ALG2"
FT                   /locus_tag="CAGL0M05731g"
FT                   /product="Alpha-1,3-mannosyltransferase ALG2 "
FT                   /EC_number="2.4.1.-"
FT                   /function="transferase activity, transferring glycosyl
FT                   groups"
FT                   /biological_process="biosynthetic process"
FT                   /cellular_component="endoplasmic reticulum membrane "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAG62571.1"
FT                   /db_xref="GO:0005789"
FT                   /db_xref="GO:0009058"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0016757"
FT                   /db_xref="HOGENOM:HBG027993"
FT                   /db_xref="HOGENOM:HBG320579"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniParc:UPI00003B70D4"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FJJ9"
FT                   /transl_table=1
FT                   /translation="MVPAKKLKIAFVHPDLGIGGAERLVVDAALGLQEAGHEVIIYTSH
FT                   CDKTHCFEEVKNGTLKVEVFGDFLPTDLGKRFFIVFANLRQLYLTAKVVLSGRSKDKDV
FT                   FIIDQLSTCVPFFKLANNKVLFYCHFPDQLLAIRTNWIKSLYRIPFDLLEQFTMYCSDE
FT                   VVVNSNFTKSMYKKTFKYLQKNPNVIYPCVDTDTETLINDRDMQIGNLLVGKCPNFYLS
FT                   INRYERKKNIELAIQAFAKASVENTNLVVCGGYDPRIHENVQYLQELTCLCKELDLSYT
FT                   VNHYSDFIEDSYSVNEIEKLFGAKVIFLTSISSSLKEFLIQNMQLLLYTPSYEHFGIVP
FT                   LEAMKYGKPVLAVNNGGPVETVVSYQKEDNEKSTTGWLRSADADEWASALIESKEVLNQ
FT                   NPELFKNNGPKRVIELFSRKAMTQEFETNIKLALRHTSNISIIYVVSIIFAVLLKVFVF
FT                   "
FT   CDS_pept        complement(610837..612543)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000065970" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17438960"
FT                   /gene_name="MRH4"
FT                   /locus_tag="CAGL0M05753g"
FT                   /product="ATP-dependent RNA helicase MRH4, mitochondrial "
FT                   /EC_number="3.6.4.13"
FT                   /function="ATP binding"
FT                   /function="ATP-dependent helicase activity"
FT                   /function="RNA binding"
FT                   /cellular_component="mitochondrion"
FT                   /protein_id="CAG62572.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005739"
FT                   /db_xref="GO:0008026"
FT                   /db_xref="HOGENOM:HBG059289"
FT                   /db_xref="HOGENOM:HBG397584"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="UniParc:UPI00003B70D5"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FJJ8"
FT                   /transl_table=1
FT                   /translation="MVSILAIRTFNPLGHFVSTQCVRAYAINSVRAGSKSSSVRAGSKN
FT                   DTTRASSKKNKAGKSKLQLSARFKQNANKSQKADKFKSQKQFKYGLYGGLKENENKFLE
FT                   TNANLVEKITEFEELKLLPEVRKHVINLIKKDSLNTTEEIHPSPIQTIAIKRLSKNLME
FT                   PKLQVHAIAAETGSGKTMAYCAPLLDYLKRQEIETPEKWESIKDKAIIRSVILVPTLEL
FT                   VDQIYTTLTCIPDTLGIHVHKWTTGVDYQQLLENLKSRTDILITTPSKLLSLQRVRMIS
FT                   RADLILKRIEFVVLDEADTLLDKSWLEDTHKALKAMSDVNHLVLCSATIPNEFDRTMTK
FT                   MFPNAIPLTTPRLHKLPKGINFRIINAAVSPYKGSKIKALAQTLYAIAYDGTDPGFEKR
FT                   CIVFINEKKNVDNVVQKLRNEYGHDVVGLTGDMEGRTRLELIRPFISPPEKLTEQEKQI
FT                   DKDLNDQETVNISGSNISIGNIENSNKASNFIPKLRVLVTTDLLARGLNFKGVRNVILY
FT                   DVPITAIDLVHRAGRTARMRQSGRVFMIIDKKTQSWAKAVPTILKKNKALT"
FT   mat_peptide     complement(610840..612393)
FT                   /gene_name="MRH4"
FT                   /locus_tag="CAGL0M05753g"
FT                   /product="ATP-dependent RNA helicase MRH4, mitochondrial "
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FJJ8 "
FT   transit_peptide complement(612394..612543)
FT                   /gene_name="MRH4"
FT                   /locus_tag="CAGL0M05753g"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FJJ8 "
FT   CDS_pept        complement(612846..613391)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000168475" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19349243"
FT                   /locus_tag="CAGL0M05775g"
FT                   /product="Similar to uniprot|Q08962 Saccharomyces
FT                   cerevisiae YPL211w NIP7"
FT                   /function="RNA binding"
FT                   /biological_process="ribosome assembly"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG62573.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0042255"
FT                   /db_xref="HOGENOM:HBG198350"
FT                   /db_xref="HOGENOM:HBG377944"
FT                   /db_xref="InterPro:IPR002478"
FT                   /db_xref="InterPro:IPR005155"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR016686"
FT                   /db_xref="UniParc:UPI00003B70D6"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJJ7"
FT                   /transl_table=1
FT                   /translation="MRQLTEEETKVVFEKLAGYIGRNIAYLVDNKEVPHVFRLQKDRVY
FT                   YVPEYIAKLATSVARQNLMSVGICLGKFTKTGKFRLHITALSVLAKHAKYKIWIKPNGE
FT                   MPFLYGNHVLKAHVGKMTDDIPEHAGLIVFSMNDMPLGFGVSAKSTLESKNLQPTAIVA
FT                   FRQADIGEYLRDEDTLFT"
FT   CDS_pept        613807..614760
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20196065"
FT                   /locus_tag="CAGL0M05797g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /function="RNA binding"
FT                   /function="pseudouridine synthase activity"
FT                   /biological_process="pseudouridine synthesis"
FT                   /protein_id="CAG62574.1"
FT                   /db_xref="GO:0001522"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0009982"
FT                   /db_xref="HOGENOM:HBG124072"
FT                   /db_xref="InterPro:IPR001406"
FT                   /db_xref="InterPro:IPR020094"
FT                   /db_xref="InterPro:IPR020095"
FT                   /db_xref="InterPro:IPR020097"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniParc:UPI00003B70D7"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJJ6"
FT                   /transl_table=1
FT                   /translation="MALVLGYLGTGYQGIQYNPPAHTIDNELFKALVATNCISQSNSDD
FT                   FSKSSFSRATRTDKGVHALTNLVALKMQRYEVPQQVKAELNEILPDDIRIWDVVPVKKK
FT                   FNARVMAGTRHYRYVIPTFLLQCGPHSDLSTSQLARFKNIWNMFLGTHNYYNFTPRRKD
FT                   TNADSPQNMRHMYSIQVSDPFTIAGSTQWLSIAIHGQSFLLHQIRKMVHYALSEYHRSS
FT                   SDTKSMELLETVDPDLTSATALDTPTEQYIPLAPAAGLYLHHPTFEGYNNQPAARRLQV
FT                   LDLSGYPACATFEDRIHTEIARSEHVFHEYMAVIRQ"
FT   CDS_pept        615435..615635
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20196066"
FT                   /locus_tag="CAGL0M05819g"
FT                   /product="Similarity"
FT                   /protein_id="CAG62575.1"
FT                   /db_xref="HOGENOM:HBG124073"
FT                   /db_xref="UniParc:UPI00003B70D8"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJJ5"
FT                   /transl_table=1
FT                   /translation="MQCQLERERDFFHAFMEYLYASLSANIPIAWDLEMYWAMKCRRLV
FT                   RTILWINGSELDTEAIFLDLA"
FT   CDS_pept        615972..617207
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000160667" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17438961"
FT                   /locus_tag="CAGL0M05841g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /function="glycolipid 2-alpha-mannosyltransferase activity "
FT                   /biological_process="protein glycosylation"
FT                   /cellular_component="membrane"
FT                   /protein_id="CAG62576.1"
FT                   /db_xref="GO:0004377"
FT                   /db_xref="GO:0006486"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG192431"
FT                   /db_xref="HOGENOM:HBG396033"
FT                   /db_xref="InterPro:IPR002685"
FT                   /db_xref="UniParc:UPI00003B70D9"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJJ4"
FT                   /transl_table=1
FT                   /translation="MKEWLIWVVEVFIWWGQLWFCGDIDRNYFERSVAVKTKYDGVRRR
FT                   EYFVPLKLATNSYDDMAVFTELEYSPKRENATLLMLVRNWELSGALASMRSLEDRFNRK
FT                   YNYDWVFLNDVPFDEDFMLATSAMASGMTYYGMVPPHEWSTPTWINEDQYAQCLRDMEG
FT                   SGVIYGGSRSYRNMCRFYSGFFYKQDLLKNYDYYMRVEPNVEYFCDFPYDPFKVMRANK
FT                   YKYGFLMSLYEYENTIPHLWHAVEDYINEYGHKLNFENNSYSFLVDKDHFSPNTMGIIE
FT                   SHTDYNLCHFWSNFEVGDLSFFRSKEYEEFFDFMDQKGGFYYERWGDAPIHTIAASLLL
FT                   NTSEVIHFDELGYRHEPYLSCPRSLGIQLQQRCLCDVNSDVNLDISLASCLPRWWRNGS
FT                   GKTFVKPKQFTD"
FT   CDS_pept        617997..618944
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000216656" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17438962"
FT                   /locus_tag="CAGL0M05863g"
FT                   /product="Similar to uniprot|P36145 Saccharomyces
FT                   cerevisiae YKR062w TFA2"
FT                   /function="RNA polymerase II transcription factor activity "
FT                   /biological_process="transcription initiation from RNA
FT                   polymerase II promoter"
FT                   /cellular_component="transcription factor TFIIE complex "
FT                   /protein_id="CAG62577.1"
FT                   /db_xref="GO:0003702"
FT                   /db_xref="GO:0005673"
FT                   /db_xref="GO:0006367"
FT                   /db_xref="HOGENOM:HBG020932"
FT                   /db_xref="HOGENOM:HBG395704"
FT                   /db_xref="InterPro:IPR003166"
FT                   /db_xref="InterPro:IPR016656"
FT                   /db_xref="UniParc:UPI00003B70DA"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJJ3"
FT                   /transl_table=1
FT                   /translation="MSKSNPLLANLKAFKSKVKSAPVLGVPRSNSNSRANSNTSVNNSD
FT                   NIVEIKDEDDTSATPKKRNRAATEDEVDLIDDDSDYDSSPSKRVKPGSLAAAALQASQA
FT                   DISKSHDSSKLLWATEYIQKKGKPVPLTELMDYLSMKRDDKVIGLLKKLERIEFDEKKS
FT                   TFKYLSTYDVHSAQELLTLLKNQVTFKGISFKDLKDGWPQCEETINDLEEESQILVLRT
FT                   KKDKTPRYVWYNRGGNLNCIDEEFVKVWENVQLPQFTELPRKLQELGLKPASIDPSSVK
FT                   RQTTRVEVKKKRNRRGKITNTHMAGILKDYSNKA"
FT   CDS_pept        complement(620069..621535)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000113285" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20196067"
FT                   /locus_tag="CAGL0M05885g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /protein_id="CAG62578.1"
FT                   /db_xref="HOGENOM:HBG124074"
FT                   /db_xref="InterPro:IPR007174"
FT                   /db_xref="UniParc:UPI00003B70DB"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJJ2"
FT                   /transl_table=1
FT                   /translation="MSHGRVVPWKDEKELDELKQWFYSVSDGNDLRLKAISRVKSYKLK
FT                   GSQYLPHVIDSTAQLTSAILADEKHGGSDDLFDKMNIRMTYTMAMIRFVNGVLDPSQQT
FT                   QFAIPLHTIARNVGLPSWFVDLRHWGTHERDLPNIDMLRMAAKDALQWLWKNYWDNDEL
FT                   DDSLNEDDALDEETIRQQEYLDRLRLKIELWKNNNTELRDNCNIWLEEKNSIISSDNFV
FT                   VDDGGKTNSSKADQLVKFIDETITEVKYLWKVIRDKNLFMRTFLKFYDDLFLSLLVRKL
FT                   PGFDLELIKWMFSAYTVLYQDGNLELKQDLYAIRSRFSKWIVLEKELLSPLVSLLNIRS
FT                   RISELSELFNPDMTFMQFKLLSLLVKKLEEDIGNHNWRRKKRRKDNNDTTAKLNDTQRQ
FT                   WNQLVADYLKSHVMLEEEKQFSMYGAKAKAVVKKAKEASVHNNELSDDLQKLKQRLLNL
FT                   KSKESVKPPSIETFNWDSHDDWQPKPFGIL"
FT   CDS_pept        622029..624704
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19349244"
FT                   /locus_tag="CAGL0M05907g"
FT                   /product="Similar to uniprot|P36023 Saccharomyces
FT                   cerevisiae YKR064w"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG62579.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG124075"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="UniParc:UPI00003B70DC"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJJ1"
FT                   /transl_table=1
FT                   /translation="MEEPKKVTKSRRRPMLVCVNCRKRKSKCDRQLPCSKCIQHGDTDT
FT                   CTYLNDVPIGKKNNVPNTQVTPNSSSPSIVINLHQNGNDYKTKNLNGQDNTLLKEINNN
FT                   IWGRNSPIFPDSSDHSPPTQVFGDGPNLKPKVIGHCRYSGENQYINMVPKGYLIEVKRS
FT                   SVTRYAMWTSTSVEYRDPYLSCMLMFKKGAVKATTEQMKKKMKFKNLPNSFALFTAFDN
FT                   ADDGKDKPNLNHAKIFNKFAEYRQQKSIGDLSEDHILDTKDLPRRQAVENCVLMFAKFH
FT                   LCPLLPLFNLPHLMEEVKIFYDNVEKTGKVSTKNGDNWIYCIILLLTKICKLAICMSNI
FT                   PGDDVSPIAQLDTTRFIPLVHKYIMNHNLFRKCTLHQLQVLLLLRFYNWCAPEDGDGQQ
FT                   GQQNSILMGMIISSAKELGIGWDLFTPGFPVGIDISDGSRPSAQHMNAEEYTTLYQKIW
FT                   CYILFWDRKMLLVNGQNCIIQRSRDTDYSLLEATFSKEDGSEFFRYFIHLDSLLLEIND
FT                   LISSNPTKVNITALNNCMTSLEEEFRNIHTIVNSREILQSNDDPRFFEVSWNIKIARAC
FT                   ILHAEVVSYEKECDFVRCHYAIQKLWEIVLSMCSDCMEYWSQRSEAFLGSLNNFYTNRI
FT                   VEIAADRLVHFVKAIILRLHRFHNVKAEDKQILVQFMHKFCSLYFTNFGREYFRCFKSL
FT                   FNLKMDYRVLSYSSVKDPWTVMLTFILHEMSYGEQPEGKLSLRDRLPLIAKLHDKLSYM
FT                   PSSFKNHDLILDAWQTSIYPICRYDEHFQLNLYISEIKKLDEHYKIDKDKNLFESFYNN
FT                   EVKLFGEEFGTQESCNSAFQKDSSEPPQETITLDEWGTLSGPYEGNDILLASETDSKAL
FT                   RYNDQLIQEIFNPKDFLPFL"
FT   CDS_pept        complement(624997..625557)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000213138" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20196068"
FT                   /gene_name="PAM17"
FT                   /locus_tag="CAGL0M05929g"
FT                   /product="Presequence translocated-associated motor subunit
FT                   PAM17, mitochondrial"
FT                   /biological_process="protein transport"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="mitochondrial inner membrane "
FT                   /protein_id="CAG62580.1"
FT                   /db_xref="GO:0005743"
FT                   /db_xref="GO:0015031"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG058858"
FT                   /db_xref="HOGENOM:HBG396609"
FT                   /db_xref="InterPro:IPR013875"
FT                   /db_xref="UniParc:UPI00003B70DD"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FJJ0"
FT                   /transl_table=1
FT                   /translation="MLSITQGIVRRSVARPGLIRPLVKCNARYYSDKPEDSLTWTDFFQ
FT                   LRKQERRINVGSSVFTALVGANVSWAYLSTMEIDPTQMIFGFDPLVVVTAGLMASGALG
FT                   YLMGPAVGSQVFKLTKGNKLAQYNLKNKEFLKHVIQNRVDASSQSFSNPVPDYYGEKIG
FT                   SVKEYRQWLRDCHAYAKKAKEFL"
FT   mat_peptide     complement(625000..625467)
FT                   /gene_name="PAM17"
FT                   /locus_tag="CAGL0M05929g"
FT                   /product="Presequence translocated-associated motor subunit
FT                   PAM17, mitochondrial"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FJJ0 "
FT   transit_peptide complement(625468..625557)
FT                   /gene_name="PAM17"
FT                   /locus_tag="CAGL0M05929g"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FJJ0 "
FT   CDS_pept        626330..626719
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000001095" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21044866"
FT                   /gene_name="FMP46"
FT                   /locus_tag="CAGL0M05951g"
FT                   /product="Putative redox protein FMP46, mitochondrial "
FT                   /EC_number="1.-.-.-"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /cellular_component="mitochondrion"
FT                   /protein_id="CAG62581.1"
FT                   /db_xref="GO:0005739"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG059347"
FT                   /db_xref="HOGENOM:HBG202378"
FT                   /db_xref="HSSP:1WPI"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR012882"
FT                   /db_xref="UniParc:UPI00003B70DE"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FJI9"
FT                   /transl_table=1
FT                   /translation="MSMFRTLQRQPRTISLFTHDLENSRPCLSILEYLKSHTTNRFDLE
FT                   LSTKFPTLDQVHYMNAINPMILRAQIPHLTKIMKLKSYDPLFGSQLSDCVTKGFWNKEA
FT                   PLWVDWEKKALGTDLQSIKELLEKD"
FT   transit_peptide 626330..626392
FT                   /gene_name="FMP46"
FT                   /locus_tag="CAGL0M05951g"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FJI9 "
FT   mat_peptide     626393..626716
FT                   /gene_name="FMP46"
FT                   /locus_tag="CAGL0M05951g"
FT                   /product="Putative redox protein FMP46, mitochondrial "
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FJI9 "
FT   CDS_pept        627289..628521
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000171827" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17438963"
FT                   /locus_tag="CAGL0M05973g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /biological_process="nucleosome assembly"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG62582.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006334"
FT                   /db_xref="HOGENOM:HBG390350"
FT                   /db_xref="HOGENOM:HBG619916"
FT                   /db_xref="InterPro:IPR002164"
FT                   /db_xref="UniParc:UPI00003B70DF"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJI8"
FT                   /transl_table=1
FT                   /translation="MSAPIKTKPKSSMKIDNAPTPHNTPASVLNNSYLKNGNPVGKSKP
FT                   PPTISEEDIQTALSSQQPLLLGAIQEKLGSLVGQDSGYVDSLPQVVRNRIFALKKLQSD
FT                   LFGIEKDFQVELFELEHKYLQKYAPLHARRSEIISGKQEPTSEEVAAGKEIQEKEEGEE
FT                   EEGEKPTDIQLTEEDIKGIPSFWLTALENLPIVSDTITDRDAEVLEYLQDVSIEYLTEG
FT                   KPGFLLKFKFSEENPYFKTPELTKTYYYQSELGYSGDFIYDHADGCSIDWVDNDSNVTI
FT                   AVEMRKQRNKTTKQVRTIEKITPIESFFNFFDPPKMAGDEEDEEDLEDLEERLALDYSI
FT                   GEQIKDKLIPRAVDWFTGAALEFEFNDAPEDEFDEFEDEDEDEDEDEEEDEDERDDFAN
FT                   KKEEPPECKQS"
FT   CDS_pept        629453..630400
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000001094" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17438964"
FT                   /locus_tag="CAGL0M05995g"
FT                   /product="Similar to uniprot|P36139 Saccharomyces
FT                   cerevisiae YKR046c"
FT                   /protein_id="CAG62583.1"
FT                   /db_xref="HOGENOM:HBG124076"
FT                   /db_xref="HOGENOM:HBG202377"
FT                   /db_xref="UniParc:UPI00003B70E0"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJI7"
FT                   /transl_table=1
FT                   /translation="MTEGNYAEVASNGQEKKVAKEELHSSLVTYSSPTLQHLHRYPVVD
FT                   KLIKRAVSVPVVSKAIAVSLLAVTGLKHKVWDSGKFPAVAKPVVSSSFKLLHKFDELVN
FT                   LLVFSEGIDALFYAAKEHKNRPGVWLVWFLLDYFANVFNIILKEFVLKPFKLGNVAIKD
FT                   ASDATHKVTDVKELPHVSELSDTTKRLSQDLQSKVSESYIQPTKESAMQKYDTYIKPTA
FT                   EKLHNVYAGNAKEKIDTYVKPKYDSYVKPGYDTAKETYKTITATYEQKLNKTESIPRAI
FT                   VDTGYEVGVTTIGKLRGSTPPKEQQRPQTTEVSS"
FT   CDS_pept        complement(630670..632010)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000163305" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17438965"
FT                   /locus_tag="CAGL0M06017g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /function="binding"
FT                   /function="prephenate dehydrogenase (NADP+) activity "
FT                   /biological_process="tyrosine biosynthetic process "
FT                   /protein_id="CAG62584.1"
FT                   /db_xref="GO:0004665"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0006571"
FT                   /db_xref="HOGENOM:HBG053009"
FT                   /db_xref="HOGENOM:HBG330953"
FT                   /db_xref="InterPro:IPR003099"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR012385"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI00003B70E1"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJI6"
FT                   /transl_table=1
FT                   /translation="MMEEQWQANKVIGIIGLGDMGLLYATKFSSAGWKVVACDREELFD
FT                   SLSERKRQNAWKFDIVKNGHYVSRISDYIIYSVEAENIDKLVKLYGPSTKVGAIVGGQT
FT                   SCKTPEIKAFEKYLPEDVEIITLHSLHGPKVNTEGQPLVLINHRSKTDESMKFIESLVS
FT                   CLKSKQVYLTYEEHDRITADTQAVTHAAFLSMGRAWAKLKVYPWTLGVNKWYGGLENVK
FT                   VNISLRIYSNKWHVYAGLALTNPMAHKQILQYATSATELFTLFLDKKKDELTERLNKAK
FT                   EFVFGNHTGLLLLDDTIFEKYSLSKDSASSDSKESTSLPNSHLSLLAIVDSWHQLGINP
FT                   YDHMICSTPLFRIFLGVSEFLFLSPDLLEKTIDAAIDDHSFRRDDLEFVVAAREWSSIV
FT                   TFGNFDLYKRQFEDVQKFFEPMLPEANQIGNEMIKTILMHSQDSKEA"
FT   CDS_pept        complement(632430..632798)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248080" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17438966"
FT                   /locus_tag="CAGL0M06039g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /function="nucleic acid binding"
FT                   /protein_id="CAG62585.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="HOGENOM:HBG060005"
FT                   /db_xref="HOGENOM:HBG397189"
FT                   /db_xref="InterPro:IPR002775"
FT                   /db_xref="InterPro:IPR020241"
FT                   /db_xref="UniParc:UPI00003B70E2"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJI5"
FT                   /transl_table=1
FT                   /translation="MAEKLVRKLPTVKTMSHKKIKSTMYVKSGTPFKSATKRIDKLLNQ
FT                   CQRYVTVLGMGHSVTKTLAIATTYQEKLHKVQVMTKTIEVLDEVVEDTESIDDSDSDIE
FT                   TKLKKRLLSGVEVRIFKV"
FT   CDS_pept        633324..634628
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000115508" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17438967"
FT                   /locus_tag="CAGL0M06061g"
FT                   /product="Similar to uniprot|P38292 Saccharomyces
FT                   cerevisiae YBR168w"
FT                   /protein_id="CAG62586.1"
FT                   /db_xref="HOGENOM:HBG060004"
FT                   /db_xref="HOGENOM:HBG104015"
FT                   /db_xref="InterPro:IPR010482"
FT                   /db_xref="UniParc:UPI00003B70E3"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJI4"
FT                   /transl_table=1
FT                   /translation="MAYHAKFINSHGQKPSLTLVTPVMLSMSLAKIYPLLIIADAALDN
FT                   LMWICEDPNLPFLYVVLTYLSLSLYSWSWEYPVAGSQMANIILLWLELSSGVFLLFAAS
FT                   YFISSVYYNISTSEPPTVDDIILNLESLLDKLETLRNEIMFRRWFKKPISKVKMLQIFV
FT                   RLVLVLTPVHYVLMKVITVHNYSKLLILFALFYHSDWMQVVLRLCWRLLIVRRFYFRVF
FT                   NYIFGDEYTLLGNNSKFGLKTLNLQHIMHLTSNCYLQIPLPLNAVTKMKENHLLEILLL
FT                   RYLNKNSKALENDDNIIKEFDSKTTADVVPKENTTDESATTSYNSSKVKIKEIVVFENQ
FT                   RKWKYKGWISKMLPYERPQFTTNCNNKYNDPGAYITESPEQLDLQVPPDWSWIEKEWTV
FT                   SSWVYSDTDWNVTGTMDSLEGYTRSRIWKRKMFTL"
FT   CDS_pept        complement(634963..637047)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000228138" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20196069"
FT                   /gene_name="SSE1"
FT                   /locus_tag="CAGL0M06083g"
FT                   /product="Heat shock protein homolog SSE1 "
FT                   /function="ATP binding"
FT                   /biological_process="response to stress"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAG62587.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006950"
FT                   /db_xref="HOGENOM:HBG315155"
FT                   /db_xref="HOGENOM:HBG396971"
FT                   /db_xref="InterPro:IPR001023"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="UniParc:UPI00003B70E4"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FJI3"
FT                   /transl_table=1
FT                   /translation="MSTPFGLDFGNDNSVLAVARNRGIDIVVNEVSNRSTPSMVGFGQK
FT                   NRFLGESAKTKQTSNIKNTVGNLKRILGLDYDHPDFQEESKFFTSKLVKLEDGKIGTQV
FT                   RFAGESTTFSATQLNAMFINKVKQTVETETKANITDVCIAVPTWYTEEQRYAAADAARI
FT                   AGLNPVRIVNDITAAGVSYGVFKTDLPEGEEKPRIVAFIDIGHSSYTCSIMAFKKGELK
FT                   VLGTAWDKNFGGRNFDRAITEHFADEFKTKYKIDIRENPKAYNRVMTSAERLKKVLSAN
FT                   TAAPFSVENVMNDVDASSQLSREELEELVKPMLERVTEPVTKALAQAGLTKDDVDFVEI
FT                   IGGTTRIPTLKNSISEAFGKPLSTTLNQDEAIAKGAAFICAIHSPTLRVRPFKFEDIHQ
FT                   FSVSYKWDKQVEDEDHLEVFPANSNFPSTKLITLHRSGDFSMEANYTNKEELPPHLDAN
FT                   IAKWDITGVQIPEGETSVPVKLKLRCDPSGLHIIEEAYSLEDIVVKEEVPLPEDAPEDA
FT                   VPEVKEVTKTVKKDTLEITAHTFTLADDKLNTLIEKENDMTAQDRLVAETEDRKNNLEE
FT                   YIYTLRGKLDEEYSDFASDAEKTKLKDMLAKAEEWLYEDGFDTIKAKYIAKYEELAAIG
FT                   NVIRGRYLAKEEEKKQALRAKQEAANLAALSEKLAAQRSADSEAKKDATPEGDAQMDLD
FT                   "
FT   CDS_pept        complement(637479..639221)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000008139" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18501418"
FT                   /gene_name="NPL4"
FT                   /locus_tag="CAGL0M06105g"
FT                   /product="Nuclear protein localization protein 4 "
FT                   /biological_process="mRNA transport"
FT                   /biological_process="protein transport"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="endoplasmic reticulum membrane "
FT                   /cellular_component="nuclear membrane"
FT                   /cellular_component="perinuclear region of cytoplasm "
FT                   /protein_id="CAG62588.1"
FT                   /db_xref="GO:0005789"
FT                   /db_xref="GO:0015031"
FT                   /db_xref="GO:0031965"
FT                   /db_xref="GO:0048471"
FT                   /db_xref="GO:0051028"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG051418"
FT                   /db_xref="HOGENOM:HBG330015"
FT                   /db_xref="InterPro:IPR007716"
FT                   /db_xref="InterPro:IPR007717"
FT                   /db_xref="InterPro:IPR016563"
FT                   /db_xref="UniParc:UPI00003B70E5"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FJI2"
FT                   /transl_table=1
FT                   /translation="MIIRFRSPVGMHRVRCEGSETLGQVLPQLQTILNEHGITPRAIEL
FT                   GKEANGKDKTNVESLLEKTIEALGFRHGDIVYVHYQVDSSETKGSANDNNGSVAVNIPN
FT                   NLVPGKSQKADELEVDKELEKLDGLIPRQKTKLCKHGDRGMCEYCSPLPPWDANYANEN
FT                   NIKHISFHAYLKKLNESTNKRESGSSYIAPLSQPNFKINKHCTNGHEPWPKGICSKCQP
FT                   SAITLQQQEFRMVDHVEFQSSELINQFIEFWRASGTQRFAYLYGKYEKYDATPLGIKAC
FT                   VHAIYEPPQHDEQDGITMDMEQVTQELNTIDLLAKEMGLLRVGMIFSDLTDAGNGDGTV
FT                   LCKRHKDSFFLSSLETIMAAQHQTRHPNVSKFSEQGIFSSKFVTCVVSGNLKEEIDIAS
FT                   YQVSIDAEALVSADMIGGSTHPSMAYINDTTEDRYVPEIFYMKKNEYGLTVKENAKPAF
FT                   PVDYLIVSLTHGFPKDEDTTTQLFNSVTGFPWSNRQAMGYSQDYHELKRYLHSTAASGN
FT                   FNDLHDKLANFHLLLYIHSLQILSQEEWELLVKGALSQDYQEPLYKLSASPGWQTLLMI
FT                   IESA"
FT   CDS_pept        640057..640749
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000728" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19349245"
FT                   /locus_tag="CAGL0M06127g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /protein_id="CAG62589.1"
FT                   /db_xref="HOGENOM:HBG060002"
FT                   /db_xref="HOGENOM:HBG396992"
FT                   /db_xref="InterPro:IPR018624"
FT                   /db_xref="UniParc:UPI00003B70E6"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJI1"
FT                   /transl_table=1
FT                   /translation="MDQEFFNATDFNGTNGTQFENNGTRFDNGTHGNGTFFEEPQVEMK
FT                   AVSFYTPLLYVSLLVISLFIFASQYRKNKIKKISELPSIFDESDAKDLYMDLLKLQKSG
FT                   DKKIHEKVLKAGLLNRCAEAIRRSLKLKEMAPQVEILYKNGSIGDDYWQRYQTEVKLVD
FT                   VEFKECIQESERLQPGWVPTFVPLAREICLNQALSRRYNAIATRREVCIEEWGLKLDKD
FT                   GKLISSKN"
FT   CDS_pept        complement(640964..642556)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20196070"
FT                   /locus_tag="CAGL0M06149g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /protein_id="CAG62590.1"
FT                   /db_xref="HOGENOM:HBG124077"
FT                   /db_xref="InterPro:IPR003169"
FT                   /db_xref="UniParc:UPI00003B70E7"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJI0"
FT                   /transl_table=1
FT                   /translation="MDFSSSQKYIQTQTLLDNINGLQNLHVQDREGSKNNLTYAKNAAS
FT                   DVDGSQPLLNTDMIFKANNKNHTRYIDNTGILPDFSAHSSGNLNDLHAELSSPFYNIPT
FT                   IQNTTDMFDSHSHVSKTPLSIHQDVGTPTPTNKNSKVMETYGFVNTFLSPPVWRYIDIQ
FT                   GNTQGPFSSSDMTGWYLQGYFQPTLQLFRDSTSHDNSNSTSQMCNQLITLMDILNHTQN
FT                   YQDPFNKFDEMLMTKTPVTEMVNPIPNHINNNAVTLAEECSNKDVNIESQIVESSIQKE
FT                   DVQAIASKHNAIENTTLEKPKLPSLMESHTNSINNLNNTTKESSTTISIGGSNLNKQKS
FT                   FTSSNQSQLRNDEKYNGENTTRNSSNKWSEIAKKNAPQNNPVAPVQKKTIAVQKTSLTT
FT                   AKSTEIDEKKTLLSATEPISIVNEDPQLSVDEFFFWCRKQIKLNDGHSLKDVLELILSL
FT                   PTDSESESIISETIYASSDTMDGRRFTKEFNQKRRECEKSNSGIQLTELVSSYITDEDD
FT                   WDFQVVNRKGKKN"
FT   CDS_pept        complement(643102..643542)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000175329" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17438968"
FT                   /locus_tag="CAGL0M06171g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /protein_id="CAG62591.1"
FT                   /db_xref="HOGENOM:HBG059999"
FT                   /db_xref="HOGENOM:HBG325020"
FT                   /db_xref="InterPro:IPR008012"
FT                   /db_xref="UniParc:UPI00003B70E8"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJH9"
FT                   /transl_table=1
FT                   /translation="MSIVPKGHQDRVSTSQGVTSNAASLPDTLRMQEGGAVPLSSQLND
FT                   RHPLMHRVQNWEETQHRRQLEQYRNIFGLAEPMRRMMEIGIVDATDFNPVSQGQSSIHR
FT                   DILMNKETSVDWEDIYPENNGLLSGNMVGDDVHTQIERKVGI"
FT   CDS_pept        643917..644867
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000091642" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21044867"
FT                   /locus_tag="CAGL0M06193g"
FT                   /product="Similar to uniprot|P38123 Saccharomyces
FT                   cerevisiae YBR175w"
FT                   /protein_id="CAG62592.1"
FT                   /db_xref="HOGENOM:HBG051997"
FT                   /db_xref="HOGENOM:HBG627825"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="UniParc:UPI00003B70E9"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJH8"
FT                   /transl_table=1
FT                   /translation="MMEVLKQIEIPGGGPSTCGVFSRDGQWLAVVRGIEVYIYETSGYQ
FT                   LRETLVLEHAAGVSQICWSPDGKCIASCSDDFTVVVTHRQLGLLHRLVGHTAPVISLCY
FT                   NNKGNLLFTSSMDESIKVWDVLTGTVMKTMSAHSEPVVSIDLSDNDGSILSSGSHDGLI
FT                   RIFDTATGHCLKTLTYDKDWQSETGVVPIAKVKFSANTKYLLVKSYDGVVKIWDSVSGD
FT                   VVRTFKPSNKKYNLTHCCGMDFMYPQSTQSPLILSGYEKGEIYCWDSNTKAELQVLKIE
FT                   ECDSAIISIDCHNNLMCSLSLAGNCTIWKYVTETT"
FT   CDS_pept        645200..646153
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000078427" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17438969"
FT                   /locus_tag="CAGL0M06215g"
FT                   /product="Similar to uniprot|P38122 Saccharomyces
FT                   cerevisiae YBR176w ECM31"
FT                   /function="3-methyl-2-oxobutanoate hydroxymethyltransferase
FT                   activity"
FT                   /biological_process="pantothenate biosynthetic process "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAG62593.1"
FT                   /db_xref="GO:0003864"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0015940"
FT                   /db_xref="HOGENOM:HBG287245"
FT                   /db_xref="HOGENOM:HBG299908"
FT                   /db_xref="InterPro:IPR003700"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="UniParc:UPI00003B70EA"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJH7"
FT                   /transl_table=1
FT                   /translation="MMMLNRLKCLGKGPLRFYSVHSDTAGATKTILDLQRKYVERKPLT
FT                   MCTAYDFITASWVQKADTDILLIGDSMGMTSLGYDSTSSLTLDEFKYHVKSVCRAEGPS
FT                   FIVSDMPFGSFETSISQGIQTAIDLMRSSSKVKSMKIESGSCHSDHHTYKLIGELCSRG
FT                   IPVMGHIGLTPQRQHSLGGFKVQANKSVQEIHDLLASAKKLEELGCWGIVLECIPQRVA
FT                   GFITKALSIPTIGIGAGNQTSGQVLVVSDLLGFLDSTPPKFVKEYDNLGQRAIDSIKAY
FT                   NSDVTTKAFPETGKHNFKIKEDIWNQFLSEVKVDKT"
FT   CDS_pept        complement(646413..647774)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248589" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17438970"
FT                   /locus_tag="CAGL0M06237g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /function="carboxylesterase activity"
FT                   /protein_id="CAG62594.1"
FT                   /db_xref="GO:0004091"
FT                   /db_xref="HOGENOM:HBG058437"
FT                   /db_xref="HOGENOM:HBG395376"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000952"
FT                   /db_xref="InterPro:IPR012020"
FT                   /db_xref="UniParc:UPI00003B70EB"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJH6"
FT                   /transl_table=1
FT                   /translation="MSVNTWPLINPFNWGYNGTIKHVTHDEGTVKLQLKNGEEPLQFEE
FT                   FLNKYVPELKNDAKFKLNPALFTGILQTMYLGSADYSREFQVFYGREIVKFSDGGVCTV
FT                   DYVMKDWENEYKLNETTKKFDVEKFKQDEADTHAEGWPRLQPRTRYLRDNELQEVHSDD
FT                   RPLVLVLHGLAGGSHEPVIRSLTQQLSRIGGGKFQVAVLNSRGCARSKITTRSLFTAFH
FT                   TGDTREFLQRVRNHHPNKKIYAVGFSFGATMLANYLGEEGENTPLSAACTLSNPWDMVM
FT                   SSVKTSNDWWSKNLFSANITQFLVRLVKVNMGELEVPEGTEPDHPPTVKNPSYYNFTKS
FT                   NLQKAFKFKTIADFDSTYTAPCLGFKSAMDYYKSASSINRLPNIKIPLLSINARDDPVV
FT                   GPEGVPFDLMKQNPHVVHCETDIGGHLAYLDLEWKPWVTKEIAQYFNVFDDHVE"
FT   CDS_pept        complement(648689..651244)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000177197" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21044868"
FT                   /locus_tag="CAGL0M06259g"
FT                   /product="Similar to uniprot|P38297 Saccharomyces
FT                   cerevisiae YBR179c FZO1"
FT                   /function="GTP binding"
FT                   /function="GTPase activity"
FT                   /protein_id="CAG62595.1"
FT                   /db_xref="GO:0003924"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="HOGENOM:HBG055750"
FT                   /db_xref="HOGENOM:HBG736345"
FT                   /db_xref="InterPro:IPR001401"
FT                   /db_xref="UniParc:UPI00003B70EC"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJH5"
FT                   /transl_table=1
FT                   /translation="MSKQINFKGNGNKEEEEDPAKEILESLNNDDSYDSFVTPPPSQLT
FT                   YSRNDGQLILDEQDQDLSASHHRRASNENMLSAQLSQWTYNNNRATLQKAISHVSDLLD
FT                   KIDQENEERPMFLIQEDDVNKLNVLQPHLKLEGTYTVKHDKSFNLDKAALAKLFHSQVQ
FT                   VAKKHLSSLKIRLDDMSSKVFITGDVNTGKSAFCNSLLRRRLLPEDQLPCTNVFCEILE
FT                   SRDNNNLEEVHAIPLRLATTVKDVPAIYDIHNRTTYDIFPLSSLPELVQRNDKYVLLKI
FT                   YIKDDKVSPEKSLLRNGIVDISLMDSPGLNIDSLQTAEVMAKQEEIDLVIFVVNAENQL
FT                   TLSAKEFISLASTEKKFMFFVVKKFDKIRDKQRCKDLILKQIKDLSPESHKRANEFVHF
FT                   ISSPESDINSPRAGNGPDGDPDPGDDGGEYNSADPDFDHLQSSIRNFVLKKRSLSKLLP
FT                   VKTYIAKLLTDAEIISKANLKLFEEEDKQLDKELQELEPVLNEAQNKTGYLTMKIEHIA
FT                   ENAIYSCYEFTKSQINSSLELTYDELPSYQGVSRIHDFVFSTEQCIRDKIKSNVISSEQ
FT                   FARMQTEKTVNELESLGKQELGDEFMKERSFQSDLMFTKRIHTVSKKINVRMSIMDFFA
FT                   PSWSSFVSYIGWSLSVPLLTSGESQNTADKTGAVVKKTVPGILGLKEYPLVQYFSRPSL
FT                   LFTSRLPTMAIYSVGGSKLMSNIAYNGLRLTSVNSLKKIASPLLILASLLGVAYLIHDL
FT                   PRALPLNLLRKYKRKLKELDFVHQNAERISREVRVVLKVPIREIYTSCEAVVEKKRAIK
FT                   REIEDKRASNALSMTFFNRLLAKSQTQLTIVQNINLDID"
FT   CDS_pept        651932..653560
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000179651" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21044869"
FT                   /locus_tag="CAGL0M06281g"
FT                   /product="Similar to uniprot|P38125 Saccharomyces
FT                   cerevisiae YBR180w DTR1"
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="CAG62596.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG059993"
FT                   /db_xref="HOGENOM:HBG398006"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI00003B70ED"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJH4"
FT                   /transl_table=1
FT                   /translation="MSTSSNTSGECSPFSITDSIVVQATDDNADKILQEVDLSDPNIDK
FT                   NDTFELRQQVSIKESPLYYLRDIPYSAYTSFQVSLIFLIVIYNGFLGPLAGNVFIPALP
FT                   LLQKEFNVSETTINATVSVFMATFSISPLFWGALADKGGRKILYIISISLMVIINILLA
FT                   SVPKKIGSLIFLRIIQAFASSSVISLGAGTVADLTPPKDRGKAMAYFMLGPNLGPILAP
FT                   IIAGLILLDNNNWRWLFGFLCIVSGLGLIMVILLLPETLRCIVGNGDRQWENWSQNEND
FT                   MSTQPVDFSSPISRWSFVSDIGFLNPITQDSIFKGLYPHPPKFSVWTYLRIMTFPPVIL
FT                   TSIANALLFCTYYSISVTLSHFLATEYSYSNLKIGACYVCPGVCMLLGSQIGGHLSDSM
FT                   RKSWKKENYNTEYPLEFRLILTVCGVLLAIGGSIGYGWCIQFHYHISAVLVFAGLMAFG
FT                   LTWCNNTIMTYLSELLSLRVSSAIAVSSFFRNIAAAISSALIAKLCQKMGIGFCFLGLG
FT                   LINLVSLFSILVLINNRNKWVKDSF"
FT   CDS_pept        join(complement(655501..655506),complement(654006..654710))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000190952" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17438971"
FT                   /gene_name="RPS6B"
FT                   /locus_tag="CAGL0M06303g"
FT                   /product="40S ribosomal protein S6 "
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="CAG62597.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG022722"
FT                   /db_xref="HOGENOM:HBG316337"
FT                   /db_xref="InterPro:IPR001377"
FT                   /db_xref="InterPro:IPR014401"
FT                   /db_xref="InterPro:IPR018282"
FT                   /db_xref="UniParc:UPI00003B66F9"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FJH3"
FT                   /transl_table=1
FT                   /translation="MKLNIAYPVNGTQKTVEVDDEHRVRVFYDKRIGQEIEGEAVGDEF
FT                   KGYTFKITGGNDKQGFPMKQGVLLPTRVKLLLAKGHSCYRPRRSGERKRKSVRGAIVGP
FT                   DLAVLSLVIVKKGEQELEGVTDATVPKRLGPKRANHIRKFFGLTKEDDVRDFVIRREVT
FT                   KGEKTYTKAPKIQRLVTPQRLQRKRYQRNLKVRNAQAQREAAAEYAQLLAKRLAERKAE
FT                   KAETRKRRASSLKA"
FT   CDS_pept        complement(657290..659269)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17438972"
FT                   /locus_tag="CAGL0M06325g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="sequence-specific DNA binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG62598.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0043565"
FT                   /db_xref="HOGENOM:HBG124078"
FT                   /db_xref="InterPro:IPR002100"
FT                   /db_xref="UniParc:UPI00003B70EE"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJH2"
FT                   /transl_table=1
FT                   /translation="MGRRKIEIEPITDSKTRGITFLKRKAGIFKKAHELSVLCNVDVAV
FT                   VVLGANGTFYEFSSVEMDELLRYYTDQNGMGLLHIKTEPSAYGDGYKKTPTVKYQGTRH
FT                   LKRGRRLAKTKSVDLNQIRRASVGAPDNSTVNASSETNKKRQIKDEEGNGVDDDLNNAA
FT                   VKLRKLTHARHHSTGNSLLPQMDSNVKLGSLAFDSHERDSDLKLTRTRSFPFVGDISTE
FT                   KVTQTNEQLEKAAPKFIVNSPPGSLNRESSHSNYMRPATNFNMGRSSTNGSTSKKLKPI
FT                   LKLNIPIDNTNAANGVRNYSNQHASNSAENDLPKHIIRTPFQGSNFRVSPNVKHEGSYF
FT                   KNENIIDSENGNSKLTFSYGNDKNIKNQFRPPFFGSMKGNNSAGGSNNIAGSPTNQYLI
FT                   TPLQQMNPNRVPLYKGAATTNSGSSLSTSLNMNGEVSTPNTANGNTASQRQLFGAFYSS
FT                   GADSGKLHKNDKPNMFSNNQGDENDDVEGQDDVGQETRSENTSMAMNRNIMPATTPIGP
FT                   ESSSQPLKMGPDFLGSTNSPNTSTMLFPDWNLSATGTNFSGQNFLNSAGPKSGNIFGFP
FT                   PLANYPFVGTGYGNSSNNSNNNNNNNGNNTNSNSNNQSINGGNPSKISGSELSPYLPHL
FT                   HTPYPGKIFQFNNNDTNESYQASK"
FT   CDS_pept        660288..661232
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000192011" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20196071"
FT                   /locus_tag="CAGL0M06347g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /function="hydrolase activity, acting on carbon-nitrogen
FT                   (but not peptide) bonds, in linear amides"
FT                   /biological_process="ceramide metabolic process "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAG62599.1"
FT                   /db_xref="GO:0006672"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0016811"
FT                   /db_xref="HOGENOM:HBG196338"
FT                   /db_xref="HOGENOM:HBG735397"
FT                   /db_xref="InterPro:IPR008901"
FT                   /db_xref="UniParc:UPI00003B70EF"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJH1"
FT                   /transl_table=1
FT                   /translation="MIRWEYPQAQDGYWGEITSTIDWCEENYVVSHYVAEWSNTFTNSI
FT                   FISTALYTIYCTRRNKLELRFLLIGLAYCLVGVGSWLFHMTLKYHFQLLDELPMIYAMC
FT                   VPCWSLITELIATFTGPTKNKHSNGKTNTLSSVKQVVIASLILLTASTVTVVYLIVKNA
FT                   TIHQAFFGCLIGVVAFSSAYMVMTFVKDPQHKKNLHNSMMMGAIFFMSGYAVWLMDIHL
FT                   CKLWRFIRREYLLLPLGLLLELHGWWHVLTGLGIYYYIVCLQYLRLITTDRLQHYKLIW
FT                   RWGLLPELVPADYNIGTPYSLTFRGPREKAKPE"
FT   CDS_pept        complement(661547..663220)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000227514" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21044870"
FT                   /locus_tag="CAGL0M06369g"
FT                   /product="Similar to uniprot|Q02908 Saccharomyces
FT                   cerevisiae YPL086c ELP3"
FT                   /function="N-acetyltransferase activity"
FT                   /function="iron-sulfur cluster binding"
FT                   /protein_id="CAG62600.1"
FT                   /db_xref="GO:0008080"
FT                   /db_xref="GO:0051536"
FT                   /db_xref="HOGENOM:HBG142524"
FT                   /db_xref="HOGENOM:HBG317000"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR005910"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniParc:UPI00003B70F0"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJH0"
FT                   /transl_table=1
FT                   /translation="MGRHGKGPKTNKQKLAPEKERFLQCCTDITLELTNSLTSGTTREI
FT                   NLNGLITKYSKKYKLKQQPRLTDIINSIPDQYKKYLLPKLKAKPVRTASGIAVVAVMCK
FT                   PHRCPHIAYTGNICVYCPGGPDSDFEYSTQSYTGYEPTSMRAIRARYDPYEQARGRVEQ
FT                   LKQLGHSIDKVEYVVMGGTFMSLPKDYREDFIVKLHNALSGYNGNDIDEAIRYSQQSLT
FT                   KCVGITIETRPDYCTETHLDDMLKYGCTRLEIGVQSLYEDVARDTNRGHTVKAVTETFA
FT                   IAKDAGYKVVSHMMPDLPNVGMERDLQQFKEYFENPAFRTDGLKIYPTLVIRGTGLYEL
FT                   WKTGRYKSYNANALVDLVARIMAMVPPWTRIYRVQRDIPMPLVTSGVDNGNLRELALAR
FT                   MKDLGVTSRDVRTREVGIQEVHHKVQPDQVELIRRDYYANGGWETFLSYEDPKQDILIG
FT                   LLRLRKASKKYTYRKEFTSQRTSIVRELHVYGSVVPLHSRDPKKFQHQGFGTLLMEEAE
FT                   RIAKEEHGSSKISVISGVGVRNYYAKLGYELDGPYMSKKI"
FT   CDS_pept        complement(663660..664514)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000066059" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21044871"
FT                   /locus_tag="CAGL0M06391g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /protein_id="CAG62601.1"
FT                   /db_xref="HOGENOM:HBG059996"
FT                   /db_xref="HOGENOM:HBG204191"
FT                   /db_xref="InterPro:IPR012483"
FT                   /db_xref="UniParc:UPI00003B70F1"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJG9"
FT                   /transl_table=1
FT                   /translation="MIVGYRGVVVRRVGVSRLANVYNTRLFSSGVKLLDEAEQKQDTKK
FT                   IQDFNPRHLGVASELYVPASLSRLPSVITSPKLWFDNVIRRIYMLGLNTVQIGIFRFQT
FT                   GIKPAFLLWKNKAIETYVQVNANFASKSVEKLKPEVSVWVEEALNARSKQIPDNVKLDW
FT                   QLLKFNDVPKLISIQPMMIPGRPLEHIQLLYRFNTKQRLVKLNKTNNKVEKLDRDVVDY
FT                   MVFLCDATTNDLILMGSVFESKPDAKLPKNYDDNTEKAVRRMKECGDIYRVPSSSENPQ
FT                   ITN"
FT   CDS_pept        664851..667517
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000095264" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17438973"
FT                   /gene_name="BRO1"
FT                   /locus_tag="CAGL0M06413g"
FT                   /product="Vacuolar protein-sorting protein BRO1 "
FT                   /biological_process="protein transport"
FT                   /cellular_component="endosome"
FT                   /protein_id="CAG62602.1"
FT                   /db_xref="GO:0005768"
FT                   /db_xref="GO:0015031"
FT                   /db_xref="HOGENOM:HBG059997"
FT                   /db_xref="HOGENOM:HBG203904"
FT                   /db_xref="InterPro:IPR004328"
FT                   /db_xref="UniParc:UPI00003B70F2"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FJG8"
FT                   /transl_table=1
FT                   /translation="MKPSVIGLKCKDTDKVDWKRGLSSYLKRIYGSRQWKEFYDEQLCV
FT                   EMDHVRNNANGELGAVTLVEQNYKYYAYLEQLYLRLGNNIGQFKLEFTWYDAEYGLVSS
FT                   PTKHTQKTLVFEKSCTLYNLGVALTEVANEKINEDFKTAMVHMAKAMECFRYLSENFFN
FT                   SPSADLQTENTKFLSDLSHAEAQEMFLINAINNGTSEKQASLISKLAYSGSNLYENCWE
FT                   FLRTEEGGLTPYGEARWNSIVSGKHHFFRSLAAYYNALALEQNNKYGEAIAFLKLATQC
FT                   LSSSLPYKYALNDNFDFDGFGETIKDKTKQLIKDNDYIFHDSIPQSVSLSSIKALDAIK
FT                   APKWEEQLKPFMEAIAHKCEKLYRGIVPMEVFEKESIYSEKKASMLRQCINDSETADME
FT                   YSSFIEFTHLPNLLSDLKRRYKSQNFSGTTDPQGDMMRDQIQSWIKSISQSKYKDPDEQ
FT                   LKLISSKKQEILTLLAGLPSEQKENVVKLKMALVEAAASDEKLFSLVQPYAAQLRLLKQ
FT                   PDELWKIFNMFSIDESNKQSLLDIDDSKNQEILAKISDIEQMAEDLRLLKEERGRTLKE
FT                   LKSQTNDDDITNTLLVNSKAESEELEVIFKKELDKFKPLTTRIEATIFKQESVVNEVKN
FT                   ELDNVFSLSGLENKTSEEEEKQKKRKEFFMQIEEAATKFLIFNNDLPKGLEFYDSLLKM
FT                   SKDLAVSVKVQNNASGSDNNSNNGYVSGNVIPPSLPPQPRNVGSSIDSQFQSMNLGSVP
FT                   TPQRFPQPPAPNSRPIVSMENYTSQFSVPPAHGDLPPAYNQVPLVPTRNYDQPHGSGNY
FT                   PGNVSSQHPVSSSPIPGAYDQVPMVPPKQPPAEGRSQISRQEQMEREERELQRDPTAFY
FT                   KKSSVFDESLYSRYSGK"
FT   CDS_pept        668126..669691
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000115471" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17438974"
FT                   /locus_tag="CAGL0M06435g"
FT                   /product="Similar to uniprot|P38126 Saccharomyces
FT                   cerevisiae YBR186w PCH2"
FT                   /function="ATP binding"
FT                   /function="nucleoside-triphosphatase activity"
FT                   /protein_id="CAG62603.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0017111"
FT                   /db_xref="HOGENOM:HBG059269"
FT                   /db_xref="HOGENOM:HBG204192"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="UniParc:UPI00003B70F3"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJG7"
FT                   /transl_table=1
FT                   /translation="MLVTVDACLRQSSINLVRQYMKNEEIRCNGNKYSTEDIFETVIKA
FT                   IRNAIQRRVGASQNCNGVLTFEDIFRDGKGSISIQDPPTQAQENIILSLIKVIFHSTST
FT                   DPQFFLKISTHDNMILSLFVKVVYLNKHDELDDLKLDNVGLHEINHMVNQILTNQVLKH
FT                   TQPIDKVNDNDRFEIYFYILAAENHNEQEKLLTTEFDKFSIVDSYSNDDESTYNEFSLD
FT                   QNSSYEKNARQTQSIAHKVILPCPELEGVWENLYYNKDIKIKLLNYSTASLRLAWYLET
FT                   TSSSTDVVNEMISANNKMILLHGPPGTGKTTLCKALCNKLAIRMAKTKNCVVIDQGSLL
FT                   YELSCSRVFSRWFGESSKNITQLFRDIEADIITANKHNNFVFLLIDEVETIATSRINLS
FT                   NKNEASDSVRVVNSLLTHLDKLKRYPNFLVLATSNLLETLDTAFVDRADGVFFIGNPTS
FT                   KELKYMINSSIDKLIKTGVIVDQDSYNLRKYDDVLQLLATFCEVCIKKTTHPTYLSNYC
FT                   CSYI"
FT   CDS_pept        670483..671286
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000224541" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17438975"
FT                   /locus_tag="CAGL0M06457g"
FT                   /product="Similar to uniprot|P38301 Saccharomyces
FT                   cerevisiae YBR187w"
FT                   /cellular_component="membrane"
FT                   /protein_id="CAG62604.1"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG340553"
FT                   /db_xref="HOGENOM:HBG489944"
FT                   /db_xref="InterPro:IPR001727"
FT                   /db_xref="UniParc:UPI00003B70F4"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJG6"
FT                   /transl_table=1
FT                   /translation="MTTIIAALALLPYVSATTTTTTNTTNDIPASHFGSFAMAVAMIGL
FT                   SEIGDKTFLIAALMAMRHARLLVFTAAAISLTIMTVLSGFLGHTFVSLIPESYTTFLAG
FT                   ILFLVFAYKLLIEGLEMSKDAGVEEEMTEVEEEIAISTMNEKMDDIEGGSGKGKYTDAA
FT                   SGPVNQVKQLFSKVFSPIWVSIFLMVFLGELGDRSQISIIAMATDNDYWYVIAGGVMGH
FT                   CICTGIAVLGGKLLATKISMRTITLSSAVLFLIFGIMYIYHAFHY"
FT   CDS_pept        complement(671472..671810)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17438976"
FT                   /locus_tag="CAGL0M06479g"
FT                   /product="Similar to uniprot|P38302 Saccharomyces
FT                   cerevisiae YBR188c NTC20 splicing factor "
FT                   /protein_id="CAG62605.1"
FT                   /db_xref="HOGENOM:HBG124080"
FT                   /db_xref="UniParc:UPI00003B70F5"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJG5"
FT                   /transl_table=1
FT                   /translation="MSLLKQQAEERQRRLDQLRNIATSNSILPRDEVIEQNVEDSQVKD
FT                   EGQLVEEVNSEQEELADDEQHILEQNGSETADFKAQLQPQLDLLKKKTDEAIKRILRRK
FT                   IMQDKLDD"
FT   CDS_pept        join(672743..672749,673624..674201)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000194525" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17438977"
FT                   /locus_tag="CAGL0M06501g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /function="rRNA binding"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="small ribosomal subunit"
FT                   /protein_id="CAG62606.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="GO:0015935"
FT                   /db_xref="GO:0019843"
FT                   /db_xref="HOGENOM:HBG053230"
FT                   /db_xref="HOGENOM:HBG588353"
FT                   /db_xref="InterPro:IPR001912"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR005710"
FT                   /db_xref="InterPro:IPR018079"
FT                   /db_xref="InterPro:IPR022801"
FT                   /db_xref="UniParc:UPI00003B70F6"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJG4"
FT                   /transl_table=1
FT                   /translation="MPRAPRTYSKTYSTPKRPYESSRLDAELKLAGEFGLKNKREIYRI
FT                   SFQLSKIRRAARDLLTRDEKDPKRLFEGNALIRRLVRIGVLSEDKKKLDYVLALKIEDF
FT                   LERRLQTQVYKLGLAKSVHHARVLITQRHIAVGKQIVNIPSFMVRLDSEKHIDFAPTSP
FT                   FGGARPGRVARKNSGKASEGGDDAAEEADEE"
FT   CDS_pept        join(675227..675237,676008..676479)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000194513" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18501419"
FT                   /locus_tag="CAGL0M06523g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="CAG62607.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG008055"
FT                   /db_xref="HOGENOM:HBG497499"
FT                   /db_xref="InterPro:IPR001147"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR018259"
FT                   /db_xref="UniParc:UPI00003B70F7"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJG3"
FT                   /transl_table=1
FT                   /translation="MGKSHGYRSRTRYMFQRDFRKHGAIALSTYLKVYKVGDIVDIKAN
FT                   GSIQKGMPHKFYQGKTGVVYNVTKSSVGVIVNKMVGNRYLEKRLNLRVEHVKHSKCRQE
FT                   FLDRVKSNAAKRAEAKAQGKAVQLKRQPAQPREARVVSTEGNVPQTLAPVAYETFI"
FT   CDS_pept        677238..679001
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000154429" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20196072"
FT                   /gene_name="SSH4"
FT                   /locus_tag="CAGL0M06545g"
FT                   /product="Protein SSH4"
FT                   /biological_process="protein transport"
FT                   /cellular_component="endosome membrane"
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="vacuolar membrane"
FT                   /protein_id="CAG62608.1"
FT                   /db_xref="GO:0005774"
FT                   /db_xref="GO:0010008"
FT                   /db_xref="GO:0015031"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG202416"
FT                   /db_xref="HOGENOM:HBG252595"
FT                   /db_xref="InterPro:IPR001870"
FT                   /db_xref="InterPro:IPR003877"
FT                   /db_xref="InterPro:IPR008985"
FT                   /db_xref="UniParc:UPI00003B70F8"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FJG2"
FT                   /transl_table=1
FT                   /translation="MPLIPDSIQSIGVFHVDDPFNPMPDPGDADPETVAFAFFIGIAVV
FT                   FSLLLITLVCTAAYLVCTSSYEGEYDEELANNGDGSRRGILNFRPLFGKKNSNGLLLDS
FT                   NFTNPGEFDDNEEFIEREREALIKMSPFEVDSYMRAKEFQIVSPPAVQEFGTYLDSKDL
FT                   QMIKDRGIQSYYFIPSINDNVDKSGHFLPSFLVQDKLEVEFTRWNKSSSAVLNYPLPYN
FT                   KKDAVYFEVKVYNHKPNSNSIFSIGLVTVPYPYFRIPGMCKFSIAYESTGKLRINDPFF
FT                   PSTLLPKLVEGDVVGFGYRFKTGTIFITHNGKKLMDVTQNVSVELFIALGAMNASYTRT
FT                   YTKDGLLEDPDNIELRNALAEGRELKLSKDIQNPHNPMDETKWDIIDSDEIELHVNLGQ
FT                   TGFVFIEANVKKYGFGSVFGEIGIPPAYNPNDIQKDKLIQKGEELPPQYPEDTENFGLF
FT                   GNLKIKSHIKNPLKEVSSNPSAPELIQKKLKTPIVKTPKVGIYEFTTPIDRKRETNMQP
FT                   SINPPVYEINDTRQSSPEITNETISNEETVSSSSKAEPALQHGQSNKTPNKRQNKKTKQ
FT                   RKNKKKGKKNK"
FT   CDS_pept        complement(679126..680325)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000268797" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19349246"
FT                   /gene_name="FAL1"
FT                   /locus_tag="CAGL0M06567g"
FT                   /product="ATP-dependent RNA helicase FAL1 "
FT                   /EC_number="3.6.4.13"
FT                   /function="ATP binding"
FT                   /function="ATP-dependent helicase activity"
FT                   /function="RNA binding"
FT                   /biological_process="rRNA processing"
FT                   /cellular_component="nucleolus"
FT                   /protein_id="CAG62609.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005730"
FT                   /db_xref="GO:0006364"
FT                   /db_xref="GO:0008026"
FT                   /db_xref="HOGENOM:HBG517301"
FT                   /db_xref="HOGENOM:HBG737336"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="UniParc:UPI00003B70F9"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FJG1"
FT                   /transl_table=1
FT                   /translation="MSFNREHDLKLKFKSSKKLKISATFESMDLKEGLLRGIYSYGFEA
FT                   PSAIQSRAITQIISGKDVIAQAQSGTGKTATFTIGMLQAIDLKKHDLQALVLSPTRELA
FT                   AQIGKVVTNLGDYMNVKAYAMTGGKTMKDDLKKIQKHGCQVISGTPGRVLDMIKRRLIE
FT                   TRHVQILVLDEADELLSDTLGFKHQIYDIFTKLPRTSQVVVVSATMSPEILEITKKFMN
FT                   DPVKILVKRDEITLEGIKQYYVNVEKEEWKFDTLCDIYDSLTITQCVIFCNSKKKVDWL
FT                   AHKLKQSNFAVISMHGDMKQDERDRVMNEFRTGQSRVLISTDVWARGIDVQQVSLVINY
FT                   DLPEITENYVHRIGRSGRFGRKGVAINFLTKIDASRMKEIEKYYKIKVKPMPADLSELS
FT                   "
FT   CDS_pept        680678..681355
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000001030" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17438978"
FT                   /locus_tag="CAGL0M06589g"
FT                   /product="Similar to uniprot|Q12084 Saccharomyces
FT                   cerevisiae YDR020c"
FT                   /function="ATP binding"
FT                   /function="kinase activity"
FT                   /function="phosphotransferase activity, alcohol group as
FT                   acceptor"
FT                   /protein_id="CAG62610.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0016301"
FT                   /db_xref="GO:0016773"
FT                   /db_xref="HOGENOM:HBG203124"
FT                   /db_xref="HOGENOM:HBG465606"
FT                   /db_xref="InterPro:IPR000764"
FT                   /db_xref="InterPro:IPR006083"
FT                   /db_xref="UniParc:UPI00003B70FA"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJG0"
FT                   /transl_table=1
FT                   /translation="MDKRILLLIGGGHDTGVKSMSNELKTKFDSLFPESNIKVIDIDYE
FT                   QEYMISPARIKRSYSNEDYDFDVLYNTLTHQSEHKAEGEVDIIIVCGCYALYNQKINEL
FT                   ANLRVFVESDGDVRLINKIRSENIDNSEQLATTLQEYLQNLRPEMENYIEPTRVHAHLI
FT                   IPYANKDSGVAIIVDGMVKIVNEVSNSRSPDRQNSKEIARNQLYDFLGESMDNERSRYY
FT                   DLA"
FT   CDS_pept        complement(681693..683150)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000173527" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17438979"
FT                   /locus_tag="CAGL0M06611g"
FT                   /product="Similar to uniprot|P40501 Saccharomyces
FT                   cerevisiae YIL088c"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAG62611.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG210671"
FT                   /db_xref="HOGENOM:HBG332582"
FT                   /db_xref="InterPro:IPR013057"
FT                   /db_xref="UniParc:UPI00003B70FB"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJF9"
FT                   /transl_table=1
FT                   /translation="MIDNPTATVGSSITNLVKTIVGAGLFAIPFAFKNDGVAVGLLLIF
FT                   LAAVTSSFGLILLAKCSKTLINPRNSSFFTICMLTYPSLAPLFDLAMVVQCFGVGLSYL
FT                   VLVGDFFPDLFGGERKYWILLSAILVVPLCCLKKLDNLKYSSIVGVIALLYLSLLIGFR
FT                   YLTDVAFAPEISFERGEISWFKVYDYKGLLSTFSIIIFAYVGAMNIFTIVNELQDNSMT
FT                   NVRKVVDSSILISTILFLFVGLFGYLTFGSLTMGNILLNYDSDSLAIGIGKFCLAMMLI
FT                   LTFPLLFHPLRTAINNIVVWFIIKFEKSSLTPEISARDSEASNYVTAETHTSRPINLII
FT                   NDDEVNDCEELNEDLLDSNNVIYQEHGHEEEPPKGGLNGVEHDVPFPETRFYIITALLL
FT                   VSMYAMALNVKSFALVLSLVGATGSTSISFILPGLFGYKLIGTDALAIGHTMTKEDRLY
FT                   RRLSLLLIYFGFAVMFLSLYVTLKYQQ"
FT   CDS_pept        complement(683660..684133)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248619" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17438980"
FT                   /locus_tag="CAGL0M06633g"
FT                   /product="Similarities with uniprot|P40502 Saccharomyces
FT                   cerevisiae YIL087c"
FT                   /protein_id="CAG62612.1"
FT                   /db_xref="HOGENOM:HBG058583"
FT                   /db_xref="HOGENOM:HBG398105"
FT                   /db_xref="InterPro:IPR019419"
FT                   /db_xref="UniParc:UPI00003B70FC"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJF8"
FT                   /transl_table=1
FT                   /translation="MASVGKNESLSAQAYQLTATPYPAVVNGLALLATPMVSPQMSATA
FT                   GMTSPASSAKGVMKNVLSMPSSRNSTRTIGPSNKAAMLFGGAQLLGAYIINDGDLENGA
FT                   GFVTAWSALYMIVSGKGSVKALRYGRVWPLALSTLALGNTVLYGRRFLFSDFK"
FT   CDS_pept        complement(684606..685016)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000155290" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19349247"
FT                   /gene_name="HHT3"
FT                   /locus_tag="CAGL0M06655g"
FT                   /product="Histone H3"
FT                   /function="DNA binding"
FT                   /biological_process="DNA repair"
FT                   /biological_process="nucleosome assembly"
FT                   /cellular_component="nucleosome"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG62613.1"
FT                   /db_xref="EMBL:AAM74211.1"
FT                   /db_xref="EMBL:AAM74217.1"
FT                   /db_xref="GO:0000786"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006281"
FT                   /db_xref="GO:0006334"
FT                   /db_xref="HOGENOM:HBG493811"
FT                   /db_xref="HOGENOM:HBG715487"
FT                   /db_xref="InterPro:IPR000164"
FT                   /db_xref="InterPro:IPR007125"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="UniParc:UPI00000009B9"
FT                   /db_xref="UniProtKB/Swiss-Prot:P61833"
FT                   /transl_table=1
FT                   /translation="MARTKQTARKSTGGKAPRKQLASKAARKSAPSTGGVKKPHRYKPG
FT                   TVALREIRRFQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAIGALQESVEAYLVSL
FT                   FEDTNLAAIHAKRVTIQKKDIKLARRLRGERS"
FT   mat_peptide     complement(684609..685013)
FT                   /gene_name="HHT3"
FT                   /locus_tag="CAGL0M06655g"
FT                   /product="Histone H3"
FT                   /db_xref="UniProtKB/Swiss-Prot:P61833 "
FT   CDS_pept        685761..686072
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000234654" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20196073"
FT                   /gene_name="HHF3"
FT                   /locus_tag="CAGL0M06677g"
FT                   /product="Histone H4"
FT                   /function="DNA binding"
FT                   /biological_process="nucleosome assembly"
FT                   /cellular_component="nucleosome"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG62614.1"
FT                   /db_xref="EMBL:AAM74210.1"
FT                   /db_xref="EMBL:AAM74216.1"
FT                   /db_xref="GO:0000786"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006334"
FT                   /db_xref="HOGENOM:HBG210755"
FT                   /db_xref="HOGENOM:HBG385452"
FT                   /db_xref="InterPro:IPR001951"
FT                   /db_xref="InterPro:IPR007125"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="InterPro:IPR019809"
FT                   /db_xref="UniParc:UPI000006A8C4"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8NIG3"
FT                   /transl_table=1
FT                   /translation="MSGRGKGGKGLGKGGAKRHRKILRDNIQGITKPAIRRLARRGGVK
FT                   RISGLIYEEVRAVLKSFLESVIRDAVTYTEHAKRKTVTSLDVVYALKRQGRTLYGFGG"
FT   mat_peptide     685764..686069
FT                   /gene_name="HHF3"
FT                   /locus_tag="CAGL0M06677g"
FT                   /product="Histone H4"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8NIG3 "
FT   CDS_pept        complement(686466..687554)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000141851" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17438981"
FT                   /locus_tag="CAGL0M06699g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /protein_id="CAG62615.1"
FT                   /db_xref="HOGENOM:HBG058585"
FT                   /db_xref="HOGENOM:HBG203057"
FT                   /db_xref="InterPro:IPR013907"
FT                   /db_xref="UniParc:UPI00003B70FD"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJF5"
FT                   /transl_table=1
FT                   /translation="MEEMEVQKRLTSKDVPRKDKRRVNLENRVGKIQQSFILERDSYYR
FT                   DRLTSLQTDLTSLHQGNNELFMRKLRDLEEARDLELVRLRLYEEYRVYRSGIEFQEEIE
FT                   KTKEDHERLVKICKERLYQNIEMKTKKLQEERLLMDVANIHTYSMDYDRPHYQKNTRSH
FT                   TASGWESSSNDFGRDTANESATDTGLSGFGNERRSLRRRVVLGREGSGLEGGNGGNATS
FT                   GYTSGGINGDGYNYGKSYNTEDSDGGRYGANPYASPSGRGSQRQNNSGGYRTDMNSDTE
FT                   FLQSIGDSSELYNLLFGDKNVGGKDGNKSSSDKKKPRGTQRYSMKTAPPLQSLKTEEVS
FT                   EDIALIRELTGQPPAPFKVDKQ"
FT   CDS_pept        complement(687902..688978)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000194726" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19349248"
FT                   /locus_tag="CAGL0M06721g"
FT                   /product="Similar to uniprot|P40506 Saccharomyces
FT                   cerevisiae YIL083c"
FT                   /protein_id="CAG62616.1"
FT                   /db_xref="HOGENOM:HBG028751"
FT                   /db_xref="HOGENOM:HBG434815"
FT                   /db_xref="InterPro:IPR007085"
FT                   /db_xref="UniParc:UPI00003B70FE"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJF4"
FT                   /transl_table=1
FT                   /translation="MVPPYSNGRPNIHTSITEVEHAIDRSISENVFPVAQTSEEASFFH
FT                   NNPRPAYMDELIQDTREFIEYQHEQGRDKIVLVTSGGTTVPLENNTVRFIDNFSAGTRG
FT                   AASAEQFLKNGYSVIFLHREFSLTPYNRKFTHNLKNSFLDFIDKDGVVKPEFKEQVLEN
FT                   KRLYDLYVSEEKKLLLLPFTTVNQYLWSLKSVAKLLDSRGSLFYLAAAVSDFFVPHSRM
FT                   PQHKIQSRDYKLDGDSSSDDTTTTTADGKLIVNLDPVPKFLRRLVESWASQAMIVSFKL
FT                   ETDERILIHKAITALDRYNHQLVIGNLLQTRNKEVVFVSSTNRDGDWIRLDNSVKTIEE
FT                   LIVPEVIKRHDAWVAKNT"
FT   tRNA            complement(689384..689457)
FT                   /gene_name="tRNA-Ile (AAT)"
FT   CDS_pept        690036..690878
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000188365" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21044872"
FT                   /locus_tag="CAGL0M06765g"
FT                   /product="Similar to uniprot|P53965 Saccharomyces
FT                   cerevisiae YNL032w SIW14"
FT                   /function="protein tyrosine phosphatase activity "
FT                   /protein_id="CAG62617.1"
FT                   /db_xref="GO:0004725"
FT                   /db_xref="HOGENOM:HBG202707"
FT                   /db_xref="HOGENOM:HBG253090"
FT                   /db_xref="InterPro:IPR004861"
FT                   /db_xref="InterPro:IPR016130"
FT                   /db_xref="InterPro:IPR020428"
FT                   /db_xref="UniParc:UPI00003B70FF"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJF3"
FT                   /transl_table=1
FT                   /translation="MSPGSGEESPLRDIVRSTSSLKIDDLIKNESDIIRILNQQEDLLM
FT                   DNGRVRNVHHLVDEDNLLREEFDKVLKQFHGNEDNELKIKGNEEDIDDLFDEEEHKKSS
FT                   TGLLLSCDSEVTPPENFSHVVGEIYRSSFPRTENFAFLQKRLKLKSILVLIPEEYPQEN
FT                   LDFMEKANIKLFQVGMSGNKEPFVNIPSDLLTKALEVVLNPENQPILIHCNRGKHRTGC
FT                   LIGCIRKLQSWSLTMIFDEYRRFAFPKARALDQQFIEMYDDDKIKSIATQNKWLPLQW"
FT   CDS_pept        complement(691398..692996)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000160667" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20196074"
FT                   /locus_tag="CAGL0M06787g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /function="glycolipid 2-alpha-mannosyltransferase activity "
FT                   /biological_process="protein glycosylation"
FT                   /cellular_component="membrane"
FT                   /protein_id="CAG62618.1"
FT                   /db_xref="GO:0004377"
FT                   /db_xref="GO:0006486"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG192431"
FT                   /db_xref="HOGENOM:HBG396033"
FT                   /db_xref="InterPro:IPR002685"
FT                   /db_xref="UniParc:UPI00003B7100"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJF2"
FT                   /transl_table=1
FT                   /translation="MRVKVKRWVNDAVEEVLDWLLSTIAIYMYITAIICGTFLYFTYPS
FT                   RTDIRFYSEQDLGTERDAPFYYGCVNTEGYLQAPEYKKMNAAFVMLTRNNELKDVLSSM
FT                   NSIEAHFNQWFKYPYVFLNDEPFSEEFKKSIREATDADIEFGTLDESQWEFPEEVRNTF
FT                   EYQNAITDQGDRGILYGNMESYHKMCRFYSGIFYKHPLMQKYEWYWRLEPDVEFFCDLT
FT                   YDPFFEMHRRNKKYAFTMIIPEIYWTVPNLFRYTKAFIREYGVKVGTLWKLFATNYDIL
FT                   KTDKGRDEFTDYENMVRDDLHQWVKFGGDVEPKLSEKVAIDHLLESETADDDVGLMFLV
FT                   NRARSKVPLIEDEFEGEEYNLCHFWSNFEIARLDVFDNEVYNSYFQYLEASGGFWKERW
FT                   GDAPVHSIGLALTLDVDDIHYFRDIGYMHSILKHCPKNSPDLNEFQYKPANKKYKRSSW
FT                   TRYDTPIEGGSGCRCRCPSKPAEVEDTITFCFEKWMDVTHLKKGEVELYQLFNIEEKEE
FT                   MVRNDFERHHQQQNQ"
FT   CDS_pept        693356..694603
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000750" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20196075"
FT                   /locus_tag="CAGL0M06809g"
FT                   /product="Similar to uniprot|Q04235 Saccharomyces
FT                   cerevisiae YML005w"
FT                   /protein_id="CAG62619.1"
FT                   /db_xref="HOGENOM:HBG058586"
FT                   /db_xref="HOGENOM:HBG396784"
FT                   /db_xref="InterPro:IPR003402"
FT                   /db_xref="UniParc:UPI00003B7101"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJF1"
FT                   /transl_table=1
FT                   /translation="MVLELVVRDLKLLKPIKTILENEGLFVKPIYSEGEDKIIRTRISD
FT                   SNHQLLESLGTGVLIREIDGPVIQSHTKNDITEFTRHFFEGKLENATVIKLLEVLPVKY
FT                   TVFPPLLLFNYSKQRSFLNELWQQTVPSELMDQFYQAMLSAPFLANKKVSHIATNMPII
FT                   ESDVMRRPFNIVPLYGFKNSIPNEDKIWDSPSAQDFQDALWCQVNQNGIEQVWAPQFTM
FT                   FSRGNIKEKKRILDTFTDIEGNDVVDMYSGIGYFTLSYLTRNARTVFAFELNPWSVEGL
FT                   KRGLKANRIDQNRCHIFNESNANCLTRIKEYASIHGPPHIRHINLGLLPSSRDGWPLAV
FT                   QLYRYQLQFSTDRITIHIHENVHIDHIRDNSFIANTVAQLQEIDSELTYTPTHLEQIKT
FT                   FAPDVWHICLDVDIDH"
FT   CDS_pept        695162..697099
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17438982"
FT                   /locus_tag="CAGL0M06831g"
FT                   /product="Similar to uniprot|P53968 Saccharomyces
FT                   cerevisiae YNL027w CRZ1"
FT                   /function="nucleic acid binding"
FT                   /function="zinc ion binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAG62620.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG124082"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="UniParc:UPI00003B7102"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJF0"
FT                   /transl_table=1
FT                   /translation="MGDNEEDRRKKFLNGLQLQPDQDNMFLDQYLDQAAELQRHLQGNN
FT                   SMNGDVYEQDNNNHNFSTGQNILSESTFSPSSDMSNPVSNLFNSKSINFSDMPYEMGVG
FT                   EETPNDDRDRQDSNQNNNNNLMNTPTLKIECFDEDGVFLPGDTTNDPFTQDSGPKYDSS
FT                   QNINAGIVSDMNNFENMDSNFLDFGGDNQVSKEDGTYLDLYDNNLKNASTEKIASSNNL
FT                   SVSRNSEDNLSRVSSTLNSPFMQPTDRSVSPILSPPVMYLGDHSHTDDNDDVVSILSNN
FT                   SNILLPVNSHGYKYVTDFNQLGQLIGGDPFELDFNGDNDIINSNDLKVDAETLLNSENV
FT                   HLQAPQPNNNSSNNNNVSSPSGSNKMPTTPIISIEEYDDNNKNSNDDEYAIDMDSSNAL
FT                   QENRGFLGISLLPAEDSDATHDEILQGRKQKLKNRRVSQSSSRRSSRSSMRSLTPEEKA
FT                   RSLSSNRNKLLEMADLLPKSPSSNNGSNNNSRRSSFYEESEDISMDTNISENNNTNNNT
FT                   GTDYVCEVCGKVFSRPYNLKSHLRTHTDEKPYQCSICGKAFARQHDKKRHEDLHTGKKR
FT                   YVCGGKLKDGTFWGCGKKFARSDALGRHFKTSSGRKCITPLYEETARERNLPSIDDTNI
FT                   QATEMGVTLE"
FT   CDS_pept        697615..699015
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000170308" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17438983"
FT                   /locus_tag="CAGL0M06853g"
FT                   /product="Similar to uniprot|P53969 Saccharomyces
FT                   cerevisiae YNL026w"
FT                   /cellular_component="outer membrane"
FT                   /protein_id="CAG62621.1"
FT                   /db_xref="GO:0019867"
FT                   /db_xref="HOGENOM:HBG060099"
FT                   /db_xref="HOGENOM:HBG756550"
FT                   /db_xref="InterPro:IPR000184"
FT                   /db_xref="UniParc:UPI00003B7103"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJE9"
FT                   /transl_table=1
FT                   /translation="MMSASDDQLQAELQAELQRFQNFQNGLLNRNLNTPVSVTKVITNG
FT                   TETIKPQTLQTYLDNTILQATTLKQLVKNADFLSAKLVQHGLAQDVYQNFSTNEKVMSP
FT                   SAENPIPIIDVISQLNILPVKKFVAKTGTNVGNNEGEGYLEFQLRNVFGNGESLRLDML
FT                   RGTAKNSSMLASFVKPINPYHVLDLNIYKHSKNLGNICPLDLHFNGGKMSIKSELGNTQ
FT                   KRINQEWFYEGVTRTTKVTSDHASDTLLFQAGTDFKSSIGHTYAIDTRDSVMAPNRGNL
FT                   FKLNNEVALGKYWKSQFELSKVQSWFKNDFITTTTTLKGGYLGNFHPDKKTLHINDKFM
FT                   SGGPNDIRSFQSFGVGPKDLQDAIGGDTFLSYGVSIFSKLPIKKFEDSHFRLHWFFNGG
FT                   KLINHQNKPVIDTLHDLSRQHSTSVGCGIVLRHPVARFELNFSLPLTVSTEDSLRKGFQ
FT                   FGLGMSFL"
FT   CDS_pept        complement(699260..700279)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000217621" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19349249"
FT                   /gene_name="SSN8"
FT                   /locus_tag="CAGL0M06875g"
FT                   /product="RNA polymerase II holoenzyme cyclin-like subunit "
FT                   /biological_process="regulation of transcription "
FT                   /biological_process="transcription"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG62622.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006350"
FT                   /db_xref="GO:0045449"
FT                   /db_xref="HOGENOM:HBG396776"
FT                   /db_xref="HOGENOM:HBG436057"
FT                   /db_xref="HSSP:1ZP2"
FT                   /db_xref="InterPro:IPR006670"
FT                   /db_xref="InterPro:IPR006671"
FT                   /db_xref="InterPro:IPR011028"
FT                   /db_xref="InterPro:IPR013763"
FT                   /db_xref="InterPro:IPR015429"
FT                   /db_xref="UniParc:UPI00003B7104"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FJE8"
FT                   /transl_table=1
FT                   /translation="MSGSYWTSMQRQKWQHTKPSLARERQRLWVMECQLFPQGLNIIVD
FT                   SKPNSADSSNGNAANNGGGNGRSQLVATTKNIPITHRDLHYDKDYNLRIYCYFLIMKLG
FT                   RRLNIRQYALATAHIYLSRFLLKASVREVNLYLLVTTCVYLACKVEECPQYIRTLVSEA
FT                   RSLWPEFIPPDPTKVTEFEFYLIEELQCYLIVHHPYKSMEQIVEALKEEPFKLTFTSDE
FT                   LQNCWSLINDSFINDVHLTYAPHIIAMACLFITVSIQGSNTKELSLTSAVTETLTSQSS
FT                   LTPQQQTFFRFLAESHVDLEEVMDTIQQQIILYDHWDRYHEPWIKYLLHTLYLRPLSA"
FT   CDS_pept        complement(702211..702957)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000187553" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17438984"
FT                   /locus_tag="CAGL0M06897g"
FT                   /product="Similar to uniprot|P53970 Saccharomyces
FT                   cerevisiae YNL024c"
FT                   /protein_id="CAG62623.1"
FT                   /db_xref="HOGENOM:HBG058579"
FT                   /db_xref="HOGENOM:HBG324388"
FT                   /db_xref="InterPro:IPR019410"
FT                   /db_xref="UniParc:UPI00003B7105"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJE7"
FT                   /transl_table=1
FT                   /translation="MEDILGFGDLIESRPVEHMGQSDLTFNGMLVPGLKIYEDGGESGC
FT                   GGKVWIAGELLCEFILEKSRDGELLKDWINDDSVSFGNVLELGSGTGLVGLCVGLVTKK
FT                   QSQRMVKTYITDIDQLVPLMEKNVELNLIDQQVFAKELLWGEALPIEFAPVKTGHATTS
FT                   SLDLVLAADCVYLEKAFPLLEKTLLDLTECDNPPVILMAYRKRRKADKHFFQKIRKNFN
FT                   VIVINDFKNYDQYLKQRTHLFQLVRK"
FT   CDS_pept        complement(703702..706572)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000112499" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17438985"
FT                   /locus_tag="CAGL0M06919g"
FT                   /product="Similar to uniprot|P53971 Saccharomyces
FT                   cerevisiae YNL023c FAP1"
FT                   /function="nucleic acid binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG62624.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG190560"
FT                   /db_xref="HOGENOM:HBG397891"
FT                   /db_xref="InterPro:IPR000967"
FT                   /db_xref="InterPro:IPR001374"
FT                   /db_xref="UniParc:UPI00003B7106"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJE6"
FT                   /transl_table=1
FT                   /translation="MQDGRTEVTQDEYRHYDDHPDNSSLVIGLSEDESEIETNMGAELS
FT                   EELSDLDEGDEKDMAYYEKAVQEIVKGDSYSCLICTVELDYTCKLYACEKCYRVYDYEC
FT                   IREWAEKSTSKRTDKLWACPNCFYTKKAIPKKNRPTCWCGEQVNPEPNPLNPNSCGQTC
FT                   NAKICSHGCSQICHLGPHQECTRMMSIKCSCGKVTKDIVCFQRRLYSKGFNCETVCDKL
FT                   LPCGIHKCNRKCHTGLCGSCPETIISKNTNMKIRCYCGQTSKDKIKCKDVRFPANAAYS
FT                   KDDKGQRWIGVFMCDKIRKVPYECGEHSFYEKCKAPPSISGRLICEFSPKKLKTCPCGK
FT                   NELTDLSKPRSKCTDAIPTCGQVCGKMLKCGKHKCPFACHLGDCMDPCTQIEKVRCACE
FT                   QKQFTIPCGFNDHARCNLKCESLMSCRRHRCTERCCAGRPLAERRRKTMKINVRDLADE
FT                   STIEPIHICLKDCNLTLSCGIHKCNRKCHAGKCPPCLESDSNDLVCPCGKTIVEAPVRC
FT                   GTKLPNCPYPCIRVVRGETDCGHSPMPHECHPPDIPCPDCTATVFKPCKCGKEQRVRTV
FT                   CFMKDVSCGKVCGERLQTCYHKCQKKCHEPGACQTVCKQTCNMPRLYCNHRCPKPCHKF
FT                   EECPDIPCTALVKITCPCGRIEKEVTCGVYSKNKEAQDSTRIVCDEECAVLQRHMQLKE
FT                   AFGIVDKPQNTHNEEMARLEQVISTASTFADLDLPFTEPVITTYIRHENWCTDIENTLN
FT                   KLIDDNNRTSLHFKPMRPPQRYFIRELAKAYNLYSESQDPEPNRSVFVKKNLDGSSTKP
FT                   ILSISEAAPLYQSYKKLEKEKKQANFESMTTTRLINFTPEMSPELESAARFNGFLVTNV
FT                   GEFTSTDDLQNLFAPYLKSTLVVEPQFQILPERKQAVIYPNKYKEISINVERDMETLVQ
FT                   HFDFLIKESLLAGGVELCNIENVLAE"
FT   CDS_pept        complement(706878..708356)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000203203" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17438986"
FT                   /locus_tag="CAGL0M06941g"
FT                   /product="Similar to uniprot|P53972 Saccharomyces
FT                   cerevisiae YNL022c"
FT                   /protein_id="CAG62625.1"
FT                   /db_xref="HOGENOM:HBG072242"
FT                   /db_xref="HOGENOM:HBG736383"
FT                   /db_xref="InterPro:IPR001678"
FT                   /db_xref="UniParc:UPI00003B7107"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJE5"
FT                   /transl_table=1
FT                   /translation="MEFYRDSTWVLEYLEGQIEKTGRVSGSLQTIVLRCCKQYRIKTNP
FT                   KHIYAIVSSCWKYKPYLDKIMKKSGLLDAIPRKKGKPAFSKLTLLLLCHDLLLSKAKRI
FT                   QMGKHPIKNYVLKYKNALNAEFVKLKIKLKITDLSQVVDKDDAADDMTPVRWIRINPLR
FT                   ISNHDTDQVLNELKKKFPTRVNTWKDIIPGSIYYDEFIPNLYGIHISDKITSHELYKQG
FT                   KIIIQDRASCFPAHILNPSADDVVIDACSAPGNKTTHVAAHIFGDPENPRNDNVQIYAF
FT                   EKDPERAQILQKMIKTAGCHKNIDVNVGDFTQIATPSKYSDVTGFILDPSCSGSGIFGR
FT                   KSVDILNNHGKKSNDEVPDENDAEETTDSKNEQLKERLSKLASFQFQIVRHAMSFPNAK
FT                   KIVYSTCSIHAEENERVVIDLLLDKKVQSWGWRVAKKELVLPTWYRRGFKEEFQEVFTD
FT                   KTEQECQELADGCVRALPKEDGGIGFFAVCFVRD"
FT   CDS_pept        709544..710338
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000256285" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19349250"
FT                   /locus_tag="CAGL0M06963g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /function="6-phosphogluconolactonase activity"
FT                   /biological_process="pentose-phosphate shunt"
FT                   /protein_id="CAG62626.1"
FT                   /db_xref="GO:0006098"
FT                   /db_xref="GO:0017057"
FT                   /db_xref="HOGENOM:HBG398862"
FT                   /db_xref="HOGENOM:HBG725991"
FT                   /db_xref="InterPro:IPR005900"
FT                   /db_xref="UniParc:UPI00003B7108"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJE4"
FT                   /transl_table=1
FT                   /translation="MTTAAPKLIQFDDEREVACATTEQIIKSQNSKLRQPVKKRTRREN
FT                   RFRLAISGGQLMQTLLKALLYRKEEIEWEKWDIFFVDERLVPFNSNESNYGQLKRGLLD
FT                   PLKSINYPQPNVYHIEETEIDDANVVAQTYEKQLINIFASRDSVRLPTFDMILLGCAPD
FT                   GHIASLFPQCHHNLREEMAWVIPITDAPLEPTKRISMSVPVISNSNQIIFMVTGSNNAE
FT                   LMKMIIEKPSCELPSALISTCAPGRVSWYVENEALKEVMLLD"
FT   CDS_pept        complement(710622..711371)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000908" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18501420"
FT                   /locus_tag="CAGL0M06985g"
FT                   /product="Similar to uniprot|P17261 Saccharomyces
FT                   cerevisiae YCR075c ERS1"
FT                   /protein_id="CAG62627.1"
FT                   /db_xref="HOGENOM:HBG204061"
FT                   /db_xref="HOGENOM:HBG344102"
FT                   /db_xref="InterPro:IPR005282"
FT                   /db_xref="InterPro:IPR006603"
FT                   /db_xref="UniParc:UPI00003B7109"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJE3"
FT                   /transl_table=1
FT                   /translation="MEFEDILGVIYVTAWSISMYPPLYINWKRKSARAISPDFVLLNLT
FT                   GYFYLVCSLTLQMYKWIPHLQSNIERPKLTGFDYCYCLHGFILTVLIASQLFMSRSVWR
FT                   FPDTHQFRMKPVYKKVLLLSIFLFGVLTLQFTYHNMQSGWDNERTLAYCNNLFLLKISM
FT                   SLIKYIPQVLHNFERKSMQGFAISGVFLDMTGGIASIVQLIFQILKESEINLSILISNF
FT                   GKIGLAMVTLIFNTIFISQWLLYEKKV"
FT   CDS_pept        711794..712030
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000909" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17438987"
FT                   /locus_tag="CAGL0M07001g"
FT                   /product="Similar to uniprot|Q3E841 Saccharomyces
FT                   cerevisiae YNR034wa"
FT                   /protein_id="CAR58075.1"
FT                   /db_xref="HOGENOM:HBG512118"
FT                   /db_xref="InterPro:IPR021591"
FT                   /db_xref="UniParc:UPI00017BD8FC"
FT                   /db_xref="UniProtKB/TrEMBL:B4UN59"
FT                   /transl_table=1
FT                   /translation="MLSSKLQELLPGSVGVMTFDSNNNLVLADGVAKDKVNDIPELSEV
FT                   QCNAEGVAVLENGDYIVHVCKKDGNTLVVYTGK"
FT   CDS_pept        complement(712268..713125)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20196076"
FT                   /locus_tag="CAGL0M07007g"
FT                   /product="Similar to uniprot|P25659 Saccharomyces
FT                   cerevisiae YCR076c"
FT                   /protein_id="CAG62628.1"
FT                   /db_xref="HOGENOM:HBG124084"
FT                   /db_xref="InterPro:IPR013886"
FT                   /db_xref="UniParc:UPI00003B710A"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJE2"
FT                   /transl_table=1
FT                   /translation="MMLVNTKLELAVKLVQEYFTEYATASVSFDNWFSNEVVKVEIVCK
FT                   KCEEQQILKLAAFETIKDKQCMISIYSGDEILSQSLFQYADDMQVVDAIKLPLDFEEYK
FT                   DRYSSKINEVLEGIGVKLNLKNYVNKLREDSAQDQNERAHPHDMHNNPLERYPQRVERT
FT                   SNRDDIPKFEDEYEINSRRTDPNCLEPPGGYGDRDLYPTGQKYPNLNNPNVMPHLPNNQ
FT                   GGMVFDPFGDRNHVRNPRDMPPGWIPGAKFDDPYGRPPSGFPGGPSSGPGGFGSGGFGS
FT                   NGFI"
FT   CDS_pept        complement(713658..716174)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000246501" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17438988"
FT                   /locus_tag="CAGL0M07029g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /protein_id="CAG62629.1"
FT                   /db_xref="HOGENOM:HBG190380"
FT                   /db_xref="HOGENOM:HBG396972"
FT                   /db_xref="InterPro:IPR019167"
FT                   /db_xref="UniParc:UPI00003B710B"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJE1"
FT                   /transl_table=1
FT                   /translation="MSQRRRESALNFEETYNGFGEHELEENDYLNDETFGADIEVGTDF
FT                   DFGHPGKAATNNNVPAQASVMPQRSYVTAASSGINKPGQQNVDASMDLKPMESLWGGQT
FT                   EARPEEPVLSMEEIERQQRQMQQQQHQGPHGPMPPMPMMPPNMPPPNMAMPPPGYGPMP
FT                   GYQYPMNVNPSMFQGPPPPNMAMPPMQPSQGGQPMQPGQGGQPMQPPQRMPMPHQPEPP
FT                   VQSPMSAVQQSSGVSTPQQSVISSSASPANSNQAALHQEQGQQNLAFQQDEQSQQHQQQ
FT                   QQYYQRNRFNNQNNNRGNQRREPLSPEEKMRLQIRHAKVEKILKHAGLMTPRDKDFITR
FT                   YQLSQIVTEDPYNEDFYFQVYKLIQRGGVAAESNKGLIARAYLEHSGHRLGGRYKRADI
FT                   ALQRMQSQVEKAVTVAKERPQKNKDVDSVREGVLGKISTTMNSKAPRRQLAIPSHKSNE
FT                   DIAFSDDGKLSRDSTPALEEVTRNLDSVDLNAHSRTRRRSSYAFSSIDHNSVLSRSGGR
FT                   KFVLSLIETVYEEVLDLEANLRNDKETDSTALWETLHIDDEVYEVCPFISMLSFDKGVK
FT                   IIPRIFNFLSKQQKLKLLQKFFSELSHLNIIILSSYKTNPDPTESQLKKMDLFQTVFLK
FT                   IIVSFLSSSSSFIEIMGLLLYLIKNNNVSFISTSKIGLNLITVLISRAALIRQDSNRSN
FT                   VLSSPEISTWNEIYDKLFTALESKLSAVFPPKEYCDKVVKIQTANAGLSLAANPVSNKF
FT                   YDQAYIWQFLASLALSGKLNHQRIIIDEVRDEIFGTINTAEQLKKLPTEDQNGSLYRRE
FT                   KLYQDLNLFLNVMGLVSRDGEIMELK"
FT   CDS_pept        complement(716775..719546)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000113673" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19349251"
FT                   /locus_tag="CAGL0M07051g"
FT                   /product="Similar to uniprot|P39112 Saccharomyces
FT                   cerevisiae YMR287c MSU1"
FT                   /function="RNA binding"
FT                   /function="ribonuclease activity"
FT                   /protein_id="CAG62630.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0004540"
FT                   /db_xref="HOGENOM:HBG059575"
FT                   /db_xref="HOGENOM:HBG203523"
FT                   /db_xref="InterPro:IPR001900"
FT                   /db_xref="UniParc:UPI00003B710C"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJE0"
FT                   /transl_table=1
FT                   /translation="MKVRVQRRWFHCCRRLDNAPLENSVKNYLARTKGLEPDFEIRQLP
FT                   QIISGFNKRYRARYLEPSQRWFKADWKASDHGEDKATRLLRPEVFDKFIINSDFHRGNM
FT                   EQYQKAQKLSFDPAELLRTSLNVGDIVLLKQCTSELTMCVNLPQSTTDPRYTFAKKDGT
FT                   LVYAMKNSVILRIPKDLPEEVNQLLKRESNHPYQKIGTIKNSSNETEILPVLTRQLIVS
FT                   FTLATFTKFAWTQLPIVLKKLELIHRYLQDSRGSKHVNFMSLVRIIKNLNIKEATDAIN
FT                   GDAYVRKVIDESMSVVNKSIDPTTLLATYWGVREQQQNNLWGSVYTNTALLSPTTVAVL
FT                   PLKKAHLFYQEVITRLESNDYQEIKAFAKLVNDKDYHSIAKRYDYIRTLLNDYAAGNIE
FT                   ENAVLTTIISKIFRHIDMYRDQDVTRSLCGKLLVEISPQSNSSNFILGNWDLNIPKSSG
FT                   ISSVEQKLYDTAMPTIVSDTDRYDFGDMPVFCIDSEDAHEIDDGISIEELDGVRSRIHI
FT                   HIADPAGLFPESFDYTKSGISDDVLRVSLKRAFTTYLPDLVVPMLPKSFCNRADLGKHD
FT                   RKTETISFSFELVNKEDGGLHVDYDTFQVRLGIVSNFPKVTYDKVDSILNGDDNSLPSK
FT                   QKKQLELLHTLATKLLHKRIHDDNAVVFGDGFNKGLVSLSPDDDGELCIPTFYDQSQTK
FT                   STLLVSEFMILTNKLCAAFFQENKIPGVYRCYNGLNLGNQAKAQFELLKENIKLGKLPS
FT                   LKDITKISSQLSSSFYSPFPLPHKMIGNTAYLTVTSPMRRGPDLINHLQLHRFLKKLPL
FT                   CFKQEYLDQYVWSFQARADILKIFQRHSSTYWTLKHLEQSGTKTHDVIVTSVPQNGTVN
FT                   CLFPEYSYARGTLKLDPAMKKIPRIGDTIRHCKVESIHPLDGILTLTHVNRK"
FT   CDS_pept        719729..720319
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000004797" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21044873"
FT                   /locus_tag="CAGL0M07073g"
FT                   /product="Similar to uniprot|P38876 Saccharomyces
FT                   cerevisiae YHR189w"
FT                   /function="aminoacyl-tRNA hydrolase activity"
FT                   /biological_process="translation"
FT                   /protein_id="CAG62631.1"
FT                   /db_xref="GO:0004045"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG059574"
FT                   /db_xref="HOGENOM:HBG610927"
FT                   /db_xref="InterPro:IPR001328"
FT                   /db_xref="InterPro:IPR018171"
FT                   /db_xref="UniParc:UPI00003B710D"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJD9"
FT                   /transl_table=1
FT                   /translation="MKLEKSIKYGRAMNKARHLCLTGIGNPEPSYKGTRHNVGLTVLDL
FT                   LIKQLVPRDQHVFRREGKVHVLRTPTITFIRSDIGFMNLSGRSVVPMWQKLYTDHTDYA
FT                   VIHDELSLRTGALQLRQPQASLRGHNGLRDISAHWRHQYYKLAIGIDRPESRDPQAVAD
FT                   YVLSKVPQRDATYIENTTTSKALELLQRQFPYI"
FT   CDS_pept        720613..721944
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000186940" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19349252"
FT                   /gene_name="ERG9"
FT                   /locus_tag="CAGL0M07095g"
FT                   /product="Squalene synthase"
FT                   /EC_number="2.5.1.21"
FT                   /function="farnesyl-diphosphate farnesyltransferase
FT                   activity"
FT                   /function="oxidoreductase activity"
FT                   /function="squalene synthase activity"
FT                   /biological_process="cholesterol biosynthetic process "
FT                   /biological_process="isoprenoid biosynthetic process "
FT                   /biological_process="oxidation-reduction process "
FT                   /cellular_component="endoplasmic reticulum membrane "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAG62632.1"
FT                   /db_xref="EMBL:BAB12207.1"
FT                   /db_xref="GO:0004310"
FT                   /db_xref="GO:0005789"
FT                   /db_xref="GO:0006695"
FT                   /db_xref="GO:0008299"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0051996"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG176184"
FT                   /db_xref="HOGENOM:HBG600510"
FT                   /db_xref="InterPro:IPR002060"
FT                   /db_xref="InterPro:IPR006449"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR019845"
FT                   /db_xref="UniParc:UPI00003B710E"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9HGZ6"
FT                   /transl_table=1
FT                   /translation="MGKVLDLALHPLELRAALKLKFIRQPLFSTNDTRATPQLERCYEL
FT                   LNLTSRSFAAVIMELHPELRNVIMVFYLILRALDTVEDDMTIDPQLKVKVLREFDSKLD
FT                   TTDWSFDGNDLKEKDRVVLTEFPCILGEYHKLKPEYQKVIKRITGLMGNGMADYILDEN
FT                   FNLNGVQTVKDYDKYCHYVAGLVGDGLTELIVLAGFGSDDLYHGKNSFQLYESMGLFLQ
FT                   KTNIIRDYAEDLDDGRSFWPKEIWSEYATKLTDFRDPKNTQKGVDCINHLVLNALTHVI
FT                   DVLTYLSSIHEQSSFQFCAIPQVMAIATLAKVFNNPEVLRKNVKIRKGTTCDLILNSRT
FT                   LKGCVDIFQYYLRDMKQRLPVEDPNYLKFNIQVAKIEQFIEEMFQDNLPAGVEPRETMI
FT                   YLKVQERLKWDTQVIPRVQEEDYKFNMALSVVFCVLLSFYFFTK"
FT   CDS_pept        complement(722174..722575)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000190820" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17438989"
FT                   /locus_tag="CAGL0M07117g"
FT                   /product="Similar to uniprot|P38877 Saccharomyces
FT                   cerevisiae YHR191c CFT8"
FT                   /protein_id="CAG62633.1"
FT                   /db_xref="HOGENOM:HBG190749"
FT                   /db_xref="HOGENOM:HBG397498"
FT                   /db_xref="InterPro:IPR018607"
FT                   /db_xref="UniParc:UPI00003B710F"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJD7"
FT                   /transl_table=1
FT                   /translation="MPSVDINYDKLKELLSKDSSTDGGSATPANTIETPLGTIMVEIQG
FT                   SLELPTSIDEDSELSKKFDGVDAVKFGSLNIEDKKAVLYVGKKQRLLGKVVKLSTPLGI
FT                   LKFNEGKNVEMLDIIEYKVIFSDRPLPIM"
FT   CDS_pept        722830..723591
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000066114" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17438990"
FT                   /locus_tag="CAGL0M07139g"
FT                   /product="Similar to uniprot|P38878 Saccharomyces
FT                   cerevisiae YHR192w"
FT                   /protein_id="CAG62634.1"
FT                   /db_xref="HOGENOM:HBG059114"
FT                   /db_xref="HOGENOM:HBG203818"
FT                   /db_xref="InterPro:IPR019273"
FT                   /db_xref="UniParc:UPI00003B7110"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJD6"
FT                   /transl_table=1
FT                   /translation="MFWFRDKRTLVQRYTADLAQITTQIHDLDKSIKHGSKRVARLQRQ
FT                   VTYFGLSAITLLGSYMFLNYTPAITVIAMAGAVAIVVIVKLLLSRMYQVYHQYRIKKLS
FT                   QLRGLHQKKLDKLKEETNYNATSSIIQRFSSGETQSEDAVILMDEEISKKYNELTELQK
FT                   QLTELKQNEKKLMDPKERDVWFDKVLGVLSGGDEMAPKPIICTNCNEHCGAYRLLNRPL
FT                   KYVCPNCGIKIDETAKMEQAVNEEVNEDKTK"
FT   CDS_pept        complement(723774..724271)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000239674" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19349253"
FT                   /gene_name="EGD2"
FT                   /locus_tag="CAGL0M07161g"
FT                   /product="Nascent polypeptide-associated complex subunit
FT                   alpha"
FT                   /biological_process="protein transport"
FT                   /biological_process="regulation of transcription "
FT                   /biological_process="transcription"
FT                   /cellular_component="cytoplasm"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG62635.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006350"
FT                   /db_xref="GO:0015031"
FT                   /db_xref="GO:0045449"
FT                   /db_xref="HOGENOM:HBG236848"
FT                   /db_xref="HOGENOM:HBG628290"
FT                   /db_xref="InterPro:IPR000449"
FT                   /db_xref="InterPro:IPR002715"
FT                   /db_xref="InterPro:IPR016641"
FT                   /db_xref="UniParc:UPI00003B7111"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FJD5"
FT                   /transl_table=1
FT                   /translation="MAEIPEGANVTILNRNEKKARELISKLGLKKVPGIIRVTFRKKDN
FT                   QIFAIEKPEVFRSVGGNYVVFGEAKVDNFTQRLAAAQQQAQSQTATKTPEDIQADMQAA
FT                   AVANENKTEGDAAEEDVDAGDLSNDDIDLVVQQTNATKGQAIKALKEHNGDIVNAIMSL
FT                   SK"
FT   CDS_pept        724616..726373
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000181687" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19349254"
FT                   /locus_tag="CAGL0M07183g"
FT                   /product="Similar to uniprot|P38880 Saccharomyces
FT                   cerevisiae YHR194w"
FT                   /biological_process="mitochondrion organization "
FT                   /cellular_component="mitochondrial inner membrane "
FT                   /protein_id="CAG62636.1"
FT                   /db_xref="GO:0005743"
FT                   /db_xref="GO:0007005"
FT                   /db_xref="HOGENOM:HBG056390"
FT                   /db_xref="HOGENOM:HBG737392"
FT                   /db_xref="InterPro:IPR012571"
FT                   /db_xref="UniParc:UPI00003B7112"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJD4"
FT                   /transl_table=1
FT                   /translation="MMLRRWVCNASNASSARLRLPTRVPVWLPDGSPARLAHRAPNQLV
FT                   PGMSSFQIWSIQVRWASDKNAVRKSIKEKIAQYKFITERDRTLAQTSGLFAKLRINTRW
FT                   FLKRSLNRPFNTDDIGAFISWILVSNFIILLLWTTSFVSVIIYLLNTVYAQEYVAEKIG
FT                   NYLTRNTALSVVFESAVVPDWSSGKISFKNVFISRRPKTSHSFTKGSQKEAAQRAKLAL
FT                   SESLLVNREDFDHGNYTQFDLTLDQLDISLNLRKWINGKGFIDEVIINGLRGIVDRTHV
FT                   VWKANDDPRNYKNIAQPGDFEISNFKMNDVLFTLYQPQGFRPFQVSIFNCELPQLRKHW
FT                   LFYDILNANSMSGTYDNSMFTIHRKYNTLGDGSSESPVSPWRKVTRFRVDSLDVDHLNA
FT                   GIEGPFGWITEGKVNMIGDVLLPDKNADSLQLTELLTEISNRLIKQAKMYNIIPQNKSE
FT                   TPDIDPDDYFIMDFSLKLNHVKATVPLFAPGMTYINNALIRPIVGYINSHRTYIPIKCR
FT                   VVKKIDDFEGSWTVYDSYLMQDLSAEVYDAFAVYVADDQQRSQRIKKVGFWSLQVLLQL
FT                   ILLSLGSIA"
FT   CDS_pept        726724..727449
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17438991"
FT                   /locus_tag="CAGL0M07205g"
FT                   /product="Similar to uniprot|P38881 Saccharomyces
FT                   cerevisiae YHR195w NVJ1"
FT                   /protein_id="CAG62637.1"
FT                   /db_xref="HOGENOM:HBG124086"
FT                   /db_xref="UniParc:UPI00003B7113"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJD3"
FT                   /transl_table=1
FT                   /translation="MTRPPVLQYGIPFGVTVGAWKSLRKYLGHRMPYSSLHEPSQFEQW
FT                   ADDFFVPETLQEKIIEHIPEPVKHNKLSELFEQVTQRFFDMDTRLSIIMLIVIVLAPLL
FT                   SPSRKETHENCNDNENELQQSTAEERLKSAETTAVDLDEQEKEIHMEEIEDSTVVAVKL
FT                   PVATAEEVELMHETFGAVPALKREPNPSHTASSSSLDSANSKLSRESPRVPLQVSPAKA
FT                   CNSNAQINNFQAYSQPFTY"
FT   CDS_pept        728096..729724
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000891" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17438992"
FT                   /locus_tag="CAGL0M07227g"
FT                   /product="Similar to uniprot|P38882 Saccharomyces
FT                   cerevisiae YHR196w"
FT                   /protein_id="CAG62638.1"
FT                   /db_xref="HOGENOM:HBG058126"
FT                   /db_xref="HOGENOM:HBG203821"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniParc:UPI00003B7114"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJD2"
FT                   /transl_table=1
FT                   /translation="MSQIACFSKDGLTFAYQADRSKKNTIDLYPLDPENNYMINSSLVN
FT                   NIDCESNDLKISELNFYGWCYNEIANGSTKTKRRNSDDAGVISTTSHENYFVNVYGTSK
FT                   IVVYTQTGKDIVNILKSKDSIIGMATDGPFIWVLDENMVAKKFHYNQSKQQKSFTFSEG
FT                   RDSNVKNFEVLYRDEKTFYIVIFTEDKVYLIDPSKRRAVTKLVLEIGYYSHAEFLNNGE
FT                   YLVLSNSENLLVVDFESGKEVFRWETEAAFKFKVIKDFVFVLTGNDNSIDVFKFGEKQP
FT                   TRKIVASSSTIIDFEHTSGDNLLVAWLNVNEPNFKKLSLGDINSAGSIIDVNTSQHDGT
FT                   DLSEDNISVAGNEDSSEKEITQRQKITKAGQDKISQELLTALIEGEDKEIIEILNLPTW
FT                   SSDRISNFLNNKIEENDQAVRLYQLVADEIEKDPWSDNATLPVWLKWILLIKGKDMNIS
FT                   NDKKTRKQTRHLKSALRTSSTTLPILLGIQGRLEMLKTQAKLRKELAGIQLEQDDSTTT
FT                   ENNITYADGESDSFVDAAEYVEAKQ"
FT   CDS_pept        730042..731235
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000248323" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17438993"
FT                   /gene_name="LPE10"
FT                   /locus_tag="CAGL0M07249g"
FT                   /product="Mitochondrial inner membrane magnesium
FT                   transporter LPE10"
FT                   /biological_process="RNA splicing"
FT                   /biological_process="ion transport"
FT                   /biological_process="mRNA processing"
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="mitochondrial inner membrane "
FT                   /protein_id="CAG62639.1"
FT                   /db_xref="GO:0005743"
FT                   /db_xref="GO:0006397"
FT                   /db_xref="GO:0006811"
FT                   /db_xref="GO:0008380"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG058873"
FT                   /db_xref="HOGENOM:HBG397594"
FT                   /db_xref="UniParc:UPI00003B7115"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FJD1"
FT                   /transl_table=1
FT                   /translation="MLLVNRAITLNLVKRCCWRSTMFMTPKRFLGTSEEESTAALLLQK
FT                   NLIQRNNMLYGHGSGTIRCTVFDAGGNIVSPALDIKREELVAKHGLLPRDLRKIEKSRK
FT                   NDLVPSFLVRKNGILVSLATIKTLIKPDMVIVFDSFGSLNSTSHKAFLNSLKLRLQNLD
FT                   MVELKKDPLPYEFRALESIFISALSNLTSEMNVQVTICKGILQDLEYSITRDKLKFLLG
FT                   QNKKLSNFYKKTVLIRDMLDDLLEQSDVLCSMYLSDLKNGVEHKDDDHSEIEMLLETYH
FT                   NHLDEIVQITENIISNVKTTEEIINIILDSNRNQLMLLGIRFSIGMLSLGGPIFIGSLY
FT                   GMNLENFIEETDYGFIAASAIGMISLGALYFYSIKHLHKLQKMSLFNYTNYARDVKK"
FT   transit_peptide 730042..730152
FT                   /gene_name="LPE10"
FT                   /locus_tag="CAGL0M07249g"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FJD1 "
FT   mat_peptide     730153..731232
FT                   /gene_name="LPE10"
FT                   /locus_tag="CAGL0M07249g"
FT                   /product="Mitochondrial inner membrane magnesium
FT                   transporter LPE10"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FJD1 "
FT   CDS_pept        731627..732076
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000095211" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17438994"
FT                   /locus_tag="CAGL0M07271g"
FT                   /product="Glutaredoxin"
FT                   /function="electron carrier activity"
FT                   /function="protein disulfide oxidoreductase activity "
FT                   /biological_process="cell redox homeostasis"
FT                   /protein_id="CAG62640.1"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0015035"
FT                   /db_xref="GO:0045454"
FT                   /db_xref="HOGENOM:HBG326260"
FT                   /db_xref="HOGENOM:HBG728471"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR004480"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR014434"
FT                   /db_xref="UniParc:UPI00003B7116"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJD0"
FT                   /transl_table=1
FT                   /translation="MFATRLLGKSALLGTTSTRMVFRSQMARYMSTETKKAIEGAIASA
FT                   PVVLFMKGTPEFPQCGFSRATISMLGQQGVDPEKFAAYNVLEDPELREGIKEFSNWPTI
FT                   PQLYVNKEFIGGCDVITSMARSGELADVLEEANALVPEEKEEGTD"
FT   CDS_pept        complement(733072..737619)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000162078" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20196077"
FT                   /locus_tag="CAGL0M07293g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /function="ATP binding"
FT                   /function="ATPase activity, coupled to transmembrane
FT                   movement of substances"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAG62641.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0042626"
FT                   /db_xref="HOGENOM:HBG059517"
FT                   /db_xref="HOGENOM:HBG323792"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010929"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniParc:UPI00003B7117"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJC9"
FT                   /transl_table=1
FT                   /translation="MPASISSSIISKERKDDADTTSNSYADSVHSYENINRDDNEQQPV
FT                   STQLSRHLTQILSEEGGKERLESMARVISTKTKAEMDKFEVNDMDFDLRMLLNYLRNRQ
FT                   LEQGIEPGDSGVAFKNLTAVGIDASAAYGPSVEEMLRDTGKLPLTLINKLRRKKDSVPL
FT                   RNIIQNCTGVVESGEMLFVVGRPGAGCSTLLKCISGETSELVSVDGEFSYDGLDQEEMM
FT                   KNYKGYVIYCPELDFHFPKITVKETIDFALKCKTPRVRIDRMTRKQYVDNIRDMWCTVF
FT                   GLRHTYATKVGNDFVRGVSGGERKRVSLVEAQAMNASIYSWDNATRGLDASTALEFAQA
FT                   IRTATNMMNNSAIVAIYQAGENIYELFDKTTVLYNGKQIYFGPAKKAVQYFENMGWIKP
FT                   PRMTSAEFLTSVTVDFENRTLDIKPGYEDTIPKSGFEFEEYWLNSPEYQELLRHYDDYH
FT                   ARHPAEETRERFDTAKKQMLQSGQRESSRYVVNYWSQVWYCMIRGFQRVKGDSTYTKVY
FT                   LSSFLIKGLIVGSMFHKIDNKSQSTTAGAYSRGGLLFYVLLFASVTSLAEIANSFSTRP
FT                   IIVKHKSYSMYHISAESLQEIITELPTKFVAIIVLSLVTYWIPYLKFEAGAFFQYILYL
FT                   FTVQQCTSFIFKFVATITKDGVTAHAIGGLWVLMLCVYAGFVLPLGEMHHWIKWLHFLN
FT                   PLTYAFESLVSTEFHHREMLCSQLIPSGPGYENVSVANQICNAAGAIKGHMFVNGDTYI
FT                   DRQYHFAYRHAWRSWGVNIVWTFGYIVFNVILSEFIKPVSGGGDLLLYKRGHMPEFGTE
FT                   NADARVASREEMMETLNGPDVDLPKVIAAKDVFTWNHLNYTIPYDGATRQLLSDVFGYV
FT                   KPGKMTALMGESGAGKTTLLNVLAQRINMGVITGDMLVNSQSLPASFNRSCGYVAQADN
FT                   HMAELSVRESLRFAAELRQPRSVPLEEKYEYVEKIIALLGMQNYAEALVGKTGRGLNVE
FT                   QRKKLSIGVELVAKPSLLLFLDEPTSGLDSQSAWSIVQFMRALADSGQSILCTIHQPSA
FT                   TLFEQFDRLLLLKKGGKMVYFGDIGENSSTLLNYFERQSGVKCGISENPAEYILNCIGA
FT                   GATASASADWHDLWQQSPECAAARAELDELHKNLLSRPVTEDPELVTKFAASYTTQMKC
FT                   VLRRTMIQFWRSPVYIRAKFLECVSCALFVGLSYIAVNHSVGGATEAFSSIFMLLLIAL
FT                   AMINQLHVFAYDSRELYEVREAASNTFHWSVLLLCHYVVETGWSTLCQFMCFICYYWPA
FT                   GYSGRASHAGFFFFFYVLIFPMYFVSYGLWILYMSPDVPSASMINSNLFAAMLLFCGIL
FT                   QPKEKMPGFWRGLMYNVSPFTYVVQALVGPLVHDKKVVCNKNEFAIMDPPAGQTCGEYL
FT                   RTYIGNNSGYLVNPQATSNCNYCPYSVQDEVVARFNVKWSYRWRNFGFMWVYICFNIFA
FT                   MLSCYYIMRVKVWSLKSVLDFKKWFNGPRKDRHEKDKSIFEKKPGDEEKVKQKF"
FT   CDS_pept        complement(740469..741557)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000200927" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18501421"
FT                   /locus_tag="CAGL0M07315g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /protein_id="CAG62642.1"
FT                   /db_xref="HOGENOM:HBG396429"
FT                   /db_xref="HOGENOM:HBG433971"
FT                   /db_xref="InterPro:IPR007577"
FT                   /db_xref="UniParc:UPI00003B7118"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJC8"
FT                   /transl_table=1
FT                   /translation="MKREVAYLAITNAFLVFFILFYTFDLLTLCIDDTIHDTLTASDLN
FT                   SSVPREDELIPRIIHQTYKTEDIPKHWIEGQHRCQELHSDYQYIMWTDQMALDFITEHY
FT                   SWFLPTFVGYKRPIQRADAIRYFILYHYGGIYIDLDDKCERPLDNLLKLPAFVRKTSPL
FT                   GISNDVMGSMPGHPFFWKAIHNLNHYNKNWYVPYLTIMSSTGPLFISIVWKHYRRWKIF
FT                   TKNYVPVKIIQPQDYKGSSSSFFSIVKGSSWHTDDAKWMKSLENHILSCVVAGFIFAFF
FT                   ILYGEYIFYCWLCYKKPITLTNSDSGSKNSWSSKLLWVWNRIKFRSSSYTTTYPTTPTT
FT                   SPKRSRKDSNAVFDIEKRTVNV"
FT   CDS_pept        complement(743020..743961)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17438995"
FT                   /gene_name="LGE1"
FT                   /locus_tag="CAGL0M07337g"
FT                   /product="Transcriptional regulatory protein LGE1 "
FT                   /biological_process="chromatin modification"
FT                   /biological_process="regulation of transcription "
FT                   /biological_process="transcription"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG62643.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006350"
FT                   /db_xref="GO:0016568"
FT                   /db_xref="GO:0045449"
FT                   /db_xref="HOGENOM:HBG124087"
FT                   /db_xref="InterPro:IPR021581"
FT                   /db_xref="UniParc:UPI00003B7119"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FJC7"
FT                   /transl_table=1
FT                   /translation="MSDERYQSRYGRYDSGRGGRSGYYSNYQNSSHHRSNDGPNTNTHG
FT                   PSNGNGNSGGYYHGYYNRHGSMNGRAASSGRGYYGGHNTHITSAPHNNPNAYSRAPATG
FT                   NTSYTGSYYSRGGNSSGRGGYSSYNRGGYHASHQYNNGGYYHRNNNYNSSYTERQKSVS
FT                   GDSATSGGMKYTSSHRTTHVTHPAHPPITIQRSGSNGNGVAQGNASSGEVPTAPRRETT
FT                   AQNNGRDKREEQLKKYGISNMAQGYLEIMDQNSSSTTSVTQTEIELDEKLREMNSQVFR
FT                   TMCELALVENQYTRDTLNVQLTQEKLDTLLLS"
FT   CDS_pept        744461..744790
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19349255"
FT                   /locus_tag="CAGL0M07359g"
FT                   /product="Similarities with uniprot|Q02799 Saccharomyces
FT                   cerevisiae YPL054w LEE1"
FT                   /function="nucleic acid binding"
FT                   /function="zinc ion binding"
FT                   /protein_id="CAG62644.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG124089"
FT                   /db_xref="InterPro:IPR000571"
FT                   /db_xref="UniParc:UPI00003B711A"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJC6"
FT                   /transl_table=1
FT                   /translation="MTNVDLSKFSAKQQQLILQCLAITNQVNQSKNIGSGSQNKYSRRK
FT                   DCSHIPCKFYMVGSCQAGQSCPFSHQTQTIERAYSTPCKYYQKGYCKFGDRCINLHIHE
FT                   DQNEK"
FT   CDS_pept        complement(745077..746510)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19349256"
FT                   /locus_tag="CAGL0M07381g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /function="glycolipid 2-alpha-mannosyltransferase activity "
FT                   /biological_process="protein glycosylation"
FT                   /cellular_component="membrane"
FT                   /protein_id="CAG62645.1"
FT                   /db_xref="GO:0004377"
FT                   /db_xref="GO:0006486"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG124090"
FT                   /db_xref="InterPro:IPR002685"
FT                   /db_xref="UniParc:UPI00003B711B"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJC5"
FT                   /transl_table=1
FT                   /translation="METRGLIHWLRYYYKVFHRNRTLKAVAVLLSFVLFIYYVRNSDIT
FT                   DKLVTFAGEENVKSLHAVKANIRANWNQEDDGDKFKKDLSASLQVKLDNILGTQNMSLA
FT                   EMGELPIDAETIEEQKSIRYAKLLKDHKATENSTMGFLFKSLANEGLKPSACIYSFVTG
FT                   NSELRKLLRTIESVQKKFNHKFGYPWVIISPEPLSEKFHADVEKKLEEFTSAIDDVKTE
FT                   VEFGTVPPEHWGFPDFIDSTVASNARIDLFDIPNGDSQLFRLINRYNAGLAAHHTLLKK
FT                   YDWYMRVSPGIRLNCEMEYDIMRWMQDNRKIFGFTLSIKEIERSAKKIWGHNLNFTAHN
FT                   REFYNPIEKSSLRSYIQVGRDTYNYCSFSTDLQIVNLNFLRSPVYTKYFEYMDKAGGIF
FT                   YERWSDSIIQSMAYSTMVPAKMIQHISPMGYQNKETVVCPADDIMWREYKCECDQGSDI
FT                   SFNRDLTCTQRYKDTQGMF"
FT   CDS_pept        747805..748398
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000184836" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18501422"
FT                   /gene_name="OAZ1"
FT                   /locus_tag="CAGL0M07403g"
FT                   /product="Ornithine decarboxylase antizyme "
FT                   /function="ornithine decarboxylase inhibitor activity "
FT                   /protein_id="CAG62646.1"
FT                   /db_xref="GO:0008073"
FT                   /db_xref="HOGENOM:HBG124091"
FT                   /db_xref="InterPro:IPR002993"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniParc:UPI00003B711C"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FJC4"
FT                   /transl_table=1
FT                   /translation="MSGARDIELGANTNELVTELLWDIIYLTEHQFLLPYYHGEHKKFQ
FT                   KKLVKRVGNHLNSLVNNSASKPTGSMTVNVRHVWRNVGDRYTLLYLPLYFKELIWCKAN
FT                   GSIFHVIIPHTKEHVIHEHKEWLLAILEMAGYWNLSHVRLYLPRDDLTNIQTLLKNLHW
FT                   IGANLLPNENRNECNENDDITLSDETYIILECEC"
FT   CDS_pept        complement(748504..749631)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000176034" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17438996"
FT                   /locus_tag="CAGL0M07425g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /biological_process="regulation of signal transduction "
FT                   /biological_process="response to biotic stimulus "
FT                   /protein_id="CAG62647.1"
FT                   /db_xref="GO:0009607"
FT                   /db_xref="GO:0009966"
FT                   /db_xref="HOGENOM:HBG270660"
FT                   /db_xref="HOGENOM:HBG324543"
FT                   /db_xref="InterPro:IPR007304"
FT                   /db_xref="UniParc:UPI00003B711D"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJC3"
FT                   /transl_table=1
FT                   /translation="MSGTILEQFRGIQGTIDRKLLHTQLRQDSEEYQKLLTGTIQELLD
FT                   LKSKVYHKLSLFSSNETVEDIATSSLLYLSLDYYLGLLCSRKQATSNQLANPMDKNKMR
FT                   IMFLDKAIQLFMQYLSTLQDNEILDESISKKIDGFENTFMPTMDELYAVPKHKEDLSGA
FT                   QLRRQEKIEMHKQNTAVAQQLRILEGKVSEDQENDDDELLRKLYLQKLKLLSYETFDEI
FT                   EKILYEKELLSNFVRMAPQSDNEPHLAGNDQSKSSNDDPTGYTDKLETLNKPLLSKHGK
FT                   VLRNFTLVDKRSELKSKVKGYGQYGPTMSVEEFLEQEWEQGRVLQGGEEPTKEEIEALN
FT                   EDNMEWQDKETYKAREWDEFKEENPKGSGNTMNRG"
FT   CDS_pept        complement(749980..751392)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000172710" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17438997"
FT                   /locus_tag="CAGL0M07447g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /protein_id="CAG62648.1"
FT                   /db_xref="HOGENOM:HBG027398"
FT                   /db_xref="HOGENOM:HBG696796"
FT                   /db_xref="InterPro:IPR002791"
FT                   /db_xref="UniParc:UPI00003B711E"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJC2"
FT                   /transl_table=1
FT                   /translation="MSLPRRCMTSDKGTFGAYTAEERWPIIVQNAIDDVDAELKDIKDR
FT                   GDDSEQILEDGELLKKQLIEFREEILANTPLRKFTEQEIAIANIPLSFNETLDETADIN
FT                   KSWISSEWLFTEVYMYRRINVLFKSKKSPFWQEFDIFDRLKQSTFKASLHGVVELAIRY
FT                   KKLSHELQSLDLSSGESQEVLKILFKEFTEVSLWGNATDLSLLTSISLEDIKSIQGAKA
FT                   REASESKIVVNDTDKAWDALISSKPGNRRVDFVLDNSGFELYADFLMGAFLLRSKLASK
FT                   CIFHAKDMPYMVSDVMMKDFETLLKDLEDRDFFPVTSGSEDDLALNDLATDIRDFIKEG
FT                   SFEFRTDSFWTTELDYWNIDPSEKKYHGAEIHNDFTKSNLVIFKGDLNYRKLTGDRTWP
FT                   RTTSWEAAIGPLAHNGVPTLSLRTCKATVQVALPEGKDEELSAVWEKDHPGQGSWWCCS
FT                   GKWAVICFSDGK"
FT   CDS_pept        752098..753375
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000038427" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17438998"
FT                   /locus_tag="CAGL0M07469g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /function="zinc ion binding"
FT                   /biological_process="peroxisome organization"
FT                   /cellular_component="peroxisomal membrane"
FT                   /protein_id="CAG62649.1"
FT                   /db_xref="GO:0005778"
FT                   /db_xref="GO:0007031"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG189863"
FT                   /db_xref="HOGENOM:HBG203384"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR006845"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="UniParc:UPI00003B711F"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJC1"
FT                   /transl_table=1
FT                   /translation="MSFFSNLPATATSNSGEGVSSLFPTIFEIVSSQEIDELLPASIRY
FT                   ILTNYWISRYPSWTTLQVNNYFEEWFGVGVQGLVEWYHIDKYNSTFVDKFYGLQRFNNS
FT                   DPVLTQAQAIRQAREAGNPNLQWPKSLQLTNGQKRVVFLQKIILPYISHRLSEVYNKLK
FT                   SRIAMLSTELDDETGGADKKTKLKRFVIKWFVRLYPLWNSLTSLLNMVVKLAFLTGRTG
FT                   SMTFLEYLFKIEYTRMTLPLENGSISPSKTLKNNERPTRTNMSSIRGIFESAIGSLGGM
FT                   AGLTGSQLFPAFIFMLRVYQWWNTEDLTTKLQKKLNDIDKDIPRPPNAHISEEASNDSF
FT                   EDSEMSQISEKIGTKKSDICPICKDSIENPCVLETGYVTCYACALDYIPKHEGRCPVTG
FT                   KRLLGCQFDSESGEWKVVTGIRRLLV"
FT   CDS_pept        complement(753496..754350)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17438999"
FT                   /locus_tag="CAGL0M07491g"
FT                   /product="Similar to uniprot|Q04368 Saccharomyces
FT                   cerevisiae YMR025w"
FT                   /protein_id="CAG62650.1"
FT                   /db_xref="HOGENOM:HBG124092"
FT                   /db_xref="UniParc:UPI00003B7120"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJC0"
FT                   /transl_table=1
FT                   /translation="MDNRVNEVLLNSNIILEANFHYEKLTMVNGLYNGKQPMLFLLLGT
FT                   INDDGVASASEALSVVLNVDSRTGHFSFDKEQLATRIELMKVTHKQDELIGFLTINSKY
FT                   YNYEETIRMILIDFMPQFVGSAIIFSYTPNESSSENKTQQKNTSHLDLSCQLIENYNID
FT                   TCDLKFQIEYNNIEIPVVSGSKSELELDEMPLQDEINYYHDRKKHIKQELSRVISYLGN
FT                   ASSVEQPLNAAILNRAAIITHLLNRNPTNDIETAISNMENEIRLLQTTLEQWEIVNMKD
FT                   NPS"
FT   CDS_pept        complement(754838..755914)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000206216" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20196078"
FT                   /locus_tag="CAGL0M07513g"
FT                   /product="Similar to uniprot|P36516 Saccharomyces
FT                   cerevisiae YMR024w MRPL3"
FT                   /function="double-stranded RNA binding"
FT                   /function="ribonuclease III activity"
FT                   /biological_process="RNA processing"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAG62651.1"
FT                   /db_xref="GO:0003725"
FT                   /db_xref="GO:0004525"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0006396"
FT                   /db_xref="HOGENOM:HBG058195"
FT                   /db_xref="HOGENOM:HBG395821"
FT                   /db_xref="InterPro:IPR000999"
FT                   /db_xref="InterPro:IPR001159"
FT                   /db_xref="InterPro:IPR014720"
FT                   /db_xref="UniParc:UPI00003B7121"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJB9"
FT                   /transl_table=1
FT                   /translation="MMLCRVTRPITFRGFATFGRLQQAVDTAELDQYRSYYLGLKDVIG
FT                   KVPEEVAQRSPSLVALHRRLGLPREFTYSTLARCLTCRTSDLPAKIKNPFVTEASARYL
FT                   AGTANVVPASKKLDNHGLNIFGKNLLTYHVTQYLVKRYPRLPVVVLNAAVDSYLSQRVL
FT                   ASIGKSWGIESEDSPVVNRYLANEPYEITLGKLRFFNNTLKREDGLQLITSKNFSEEAA
FT                   YALAVRSIIAALWASTQNTAKPDSAIHFIKDHILSRKLDVTKIFQFENPTRELAVLCRR
FT                   ENLDLPVSKLIAESGRLSKAPVFIVGVFSGEEKLGEGYGSSLKEAKARAASDALLKWYC
FT                   YEPTEEQAAVIDHGAVIV"
FT   tRNA            756146..756218
FT                   /gene_name="tRNA-Ala (AGC)"
FT   CDS_pept        756457..757920
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000200714" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17439000"
FT                   /locus_tag="CAGL0M07546g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /function="GTP binding"
FT                   /function="GTPase activity"
FT                   /biological_process="tRNA modification"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAG62652.1"
FT                   /db_xref="GO:0003924"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0006400"
FT                   /db_xref="HOGENOM:HBG001389"
FT                   /db_xref="HOGENOM:HBG746795"
FT                   /db_xref="InterPro:IPR002917"
FT                   /db_xref="InterPro:IPR004520"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR018948"
FT                   /db_xref="UniParc:UPI00003B7122"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJB8"
FT                   /transl_table=1
FT                   /translation="MVGIRFLSHTRQRLPTIYSMVTPRAKSAVSVIRVSGDKAQYVYRK
FT                   LTRRDDVPRSRQACLRGLYNGDNELIDRALVLYFKSPGSFTGEDVVEFQVHGGRAVSES
FT                   VLSAIGSLNNRDQDVEIRMADRGEFSRRSFLNGKADLTGLEGINTLINADTEAQRRAAM
FT                   GSFTGKNKALFNRWRDIAIQNSAQLTAIIDFSEDSDFADEYTAVMAEVRQELMGLRTEI
FT                   GNFIARVTKASIVENGINMTLLGAPNVGKSSLLNQIASDDISIVSDIPGTTRDIVSSIV
FT                   NINGYKVNLFDTAGIRVDTTDPIEKMGIEKAFKRIGSSDICICVIDGTQPLPLNVLDLL
FT                   KSSDLSGSEIIFVVNKIDIVDDSCKLSKIQQYIGNNLTGCKICFVSCLKSTGIDELVTV
FT                   LTGKFKTLTQNEENEDPIIVSDRVKEILEKDVLYGIDQFLQIQDDMHDIVIATEHLRYV
FT                   IDGIGKITGEVIGLEEVLDVVFSKFCVGK"
FT   CDS_pept        complement(758110..758607)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000233454" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17439001"
FT                   /locus_tag="CAGL0M07568g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /function="small conjugating protein ligase activity "
FT                   /biological_process="post-translational protein
FT                   modification"
FT                   /biological_process="regulation of protein metabolic
FT                   process"
FT                   /protein_id="CAG62653.1"
FT                   /db_xref="GO:0019787"
FT                   /db_xref="GO:0043687"
FT                   /db_xref="GO:0051246"
FT                   /db_xref="HOGENOM:HBG492183"
FT                   /db_xref="HOGENOM:HBG756483"
FT                   /db_xref="InterPro:IPR000608"
FT                   /db_xref="InterPro:IPR016135"
FT                   /db_xref="UniParc:UPI00003B7123"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJB7"
FT                   /transl_table=1
FT                   /translation="MSKTAQKRLYKELQQLIKDSPPGIVAGPKSDDNLFVWDCLIQGPP
FT                   DTPYAGGVFNAQLEFPKDYPLSPPKLTFTPSILHPNIYPNGEVCISILHSPGDDPNMYE
FT                   SAEERWSPVQSVEKILLSVMSMLSEPNIESGANIDACILWRDNRAEFEKQVKLSILKSL
FT                   GF"
FT   CDS_pept        758940..760310
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000066040" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17439002"
FT                   /locus_tag="CAGL0M07590g"
FT                   /product="Similar to uniprot|P35192 Saccharomyces
FT                   cerevisiae YMR021c metal binding activator "
FT                   /function="DNA binding"
FT                   /function="copper ion binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG62654.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005507"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="HOGENOM:HBG124093"
FT                   /db_xref="HOGENOM:HBG203382"
FT                   /db_xref="InterPro:IPR001083"
FT                   /db_xref="UniParc:UPI00003B7124"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJB6"
FT                   /transl_table=1
FT                   /translation="MIIFKNDKYACVKCIRGHRSSLCVHTGRMLVKVRNRGRKKGIDVR
FT                   DAIVVGDIHRKRSCECASGHAGDDSKQYGAPNADVSRPHESGLNSTCVGMNKQPILFVR
FT                   AKKVLKAQLIGGELKEMSEVDMSRLEVDTSDDETVATTTTVPKVEILDNNVLNVTQGNI
FT                   DDDMVLVDDTKNFAGASIGELIDEQLSSINVEPTGSHCCGSQPHGIDPMKTTTVTAAAT
FT                   ETEKYPFFQLLTKRGVYLSTQCSCSAANCACSNCLIHRTEEEINNYIEASGVPLTNLDS
FT                   STSLQATPEIESPRPSCMCKPEECTCDGCDIHTIEVVPFQRIVIHGLINTRLTKKTLIQ
FT                   YRKKLIGQKYWWDYCMVYIPCLRCNNFDGLDIVGFFDNIIKEHGHELEDAKEKVDAGSI
FT                   QNLTSQAENFIMNMNNSIDNGVSSNTTNNMNNINDTRLQSHYANLVKTEGTISPMFM"
FT   CDS_pept        complement(760610..762355)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000246632" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21044874"
FT                   /locus_tag="CAGL0M07612g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /protein_id="CAG62655.1"
FT                   /db_xref="HOGENOM:HBG058190"
FT                   /db_xref="HOGENOM:HBG398221"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="UniParc:UPI00003B7125"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJB5"
FT                   /transl_table=1
FT                   /translation="MDRTYDVVVVGAGIAGLKAASVLTQSGKSCLVIESRDRIGGRLCT
FT                   VTGYNGARYDLGASWHHDTLTNRLFAEEVQLAAVDGADSTPQMFSGGATHCSASSASSA
FT                   SSASTGGNSAGVYAPFVFDDDDPLIVDKIRGSLGDVTIRLIADEIEKFIELYFHSEYTA
FT                   ELSDDNDSQHSHEGFPRADMPLFDMLLMYLQQRAPFLTDDQMWYGIQYARYMELWHGVS
FT                   WYQLSSRDSFFGHQGRNAFVMNYDTIYNRIHGQIRTELGTVQLNSTVTKIENAGAHTTV
FT                   SYTTSSASGAEDTQHGQHGAAGQQHTVQCSYVIVTIPQSLLSEGAVEFKPPLVPQISAA
FT                   LQKMHFGSLGKVVFEFEECCWDLHTAKIVAVAHAAADTRAEFTALLRKESREKNYTAQR
FT                   LQALVQDVKQLLGDDAVRHDCWNQPLLFVNMAKTTGVPSLMMLMAPPLTHYIESLHDSH
FT                   QVYEFFKPVLSQIMSVCNAPGHIINGLDIAGGVAGDDANVSDKGPILRNVIVTDWTNDP
FT                   YSKGAYSACYAGDDALDMFLAMSNGQSSRVRFAGEHTILDGAGCAYGAWESGEREANYI
FT                   LKQMK"
FT   CDS_pept        763929..764702
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17439003"
FT                   /locus_tag="CAGL0M07634g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /function="DNA binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /protein_id="CAG62656.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="HOGENOM:HBG124094"
FT                   /db_xref="InterPro:IPR003163"
FT                   /db_xref="InterPro:IPR018004"
FT                   /db_xref="UniParc:UPI00003B7126"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJB4"
FT                   /transl_table=1
FT                   /translation="MSERELPGYTYLPPPRLSYQPSIALVPGVMQVRPPASPASPVGTG
FT                   AGTPGAAGTTGITGISSTTGTTGTGGTALGTVPTSALTNNNNNNNSSSSGNAYMTSALA
FT                   SWNQYQYPWLQHPLLSRVITTYWEDEHTICHGVNHNGVTVVRRADNDMVNGTKLLNVTG
FT                   MTRGRRDGILKNEPVRDVVKGGPMTLKGVWIPIDRARAIARQEGIEQWLYPLFIDDLHQ
FT                   AITLLRQQVQPQVQMPAPQLPVQSQQLIPQIHHHM"
FT   CDS_pept        765772..767379
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000181358" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18501423"
FT                   /gene_name="ERG5"
FT                   /locus_tag="CAGL0M07656g"
FT                   /product="C22 sterol desaturase"
FT                   /function="electron carrier activity"
FT                   /function="heme binding"
FT                   /function="monooxygenase activity"
FT                   /protein_id="CAG62657.1"
FT                   /db_xref="EMBL:AAX73197.1"
FT                   /db_xref="EMBL:AAX73198.1"
FT                   /db_xref="EMBL:ACA58064.1"
FT                   /db_xref="GO:0004497"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0020037"
FT                   /db_xref="HOGENOM:HBG065082"
FT                   /db_xref="HOGENOM:HBG592092"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002403"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="UniParc:UPI00003B7127"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJB3"
FT                   /transl_table=1
FT                   /translation="MASVVDQVHMSMNATAHAAGAASAGAVMAAPSLLDKLQGMSYLQM
FT                   FVTLICGVLVWDQVSYQMKKGNIAGPRFKVYPIIGPFLESLDPKFEEYKAKWDSGPLSC
FT                   VSIFHKFVIIASTRDLARKVLQAPKYVKPCVVDVAVKILRPSNWVFLDGKAHTDYRKSL
FT                   NGLFTKTALAQYLPPLEELMDKYIEKFVELSKENNYEPQIFFHEMREILCALSLRSFCG
FT                   DYISEDQIRKIADDYYLVTAALELVNFPIILPFTKTWYGKRTADMAMKIFESCAQRAKD
FT                   HIAAGGKPICVMDNWCKLMHDAKNRTDDDSRLLHREFTNREISEAVFTFLFASQDASSS
FT                   LACWLFQIVADRPDVLAKIREEQLRVREGDINKRLDIDLVDKMEYTHMVVKETLRYRPP
FT                   VLMVPYVVKNKFPVVPDYQAPKGSMLIATLYPALHDPEVYENPDDFIPERWVEGSPANE
FT                   AKKNWLVFGCGPHVCLGQTYVMITMTALIGKFALFTDFKHKVTPLSEKIKVFATIFPKD
FT                   DLLLSFKKRDPVTGEIKE"
FT   CDS_pept        complement(767857..769278)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248612" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17439004"
FT                   /locus_tag="CAGL0M07678g"
FT                   /product="Similar to uniprot|Q04347 Saccharomyces
FT                   cerevisiae YMR014w"
FT                   /protein_id="CAG62658.1"
FT                   /db_xref="HOGENOM:HBG058187"
FT                   /db_xref="HOGENOM:HBG398115"
FT                   /db_xref="InterPro:IPR015158"
FT                   /db_xref="UniParc:UPI00003B7128"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJB2"
FT                   /transl_table=1
FT                   /translation="MSKENLLLKLDRLEYQWHYLQETHEKFEPRFPFTQRFFNAKGKKN
FT                   NKKVTKILESSDKEKVRSDLKEVRVEILNRKIHNVEKHVNNYLFKTIKSIVSNDKSVFQ
FT                   PVLEAVEAKYGAGDAGLHDFCEIVTKSKAIKFIISKLQKSSANIASANEEVSDKRIPKW
FT                   AADHEYVKMWTDKNNKYNPSKVWNEDVTKIKSCDALISRVMNGKKYKQMMDQFDDSLDL
FT                   FLNINKQKRLQKQQEKKKSTKTSSKQHEEENEDASGDDFGYSDNDDPRYNENIDEDELL
FT                   KQYDGMLVGSDDESDEEEDSAKSSASEDETSERIGKQEPVPKLKKKEKAKLPELMVGYV
FT                   SGGSDEEIEVDDIAKEQIEIKPQKKNRRGQRARRKIWEQKYGSKAKHVQREIEKEMEKK
FT                   RKRQAEYEERVAKRAARAEQNEEYQAKKAEIKREKEEHRKKLEKIEDHPSWVAKKMAED
FT                   KEKNAKFAGKKITFD"
FT   CDS_pept        772364..773746
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000141906" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18501424"
FT                   /locus_tag="CAGL0M07700g"
FT                   /product="Similar to uniprot|P20048 Saccharomyces
FT                   cerevisiae YMR013c dolichol kinase "
FT                   /function="kinase activity"
FT                   /protein_id="CAG62659.2"
FT                   /db_xref="GO:0016301"
FT                   /db_xref="HOGENOM:HBG398767"
FT                   /db_xref="HOGENOM:HBG429566"
FT                   /db_xref="UniParc:UPI00017BD8F3"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJB1"
FT                   /transl_table=1
FT                   /translation="MEVIPQLWQLVMLSVPFMYCYDNVMELLCSSVVVQMVIVVHLVCF
FT                   VLRRKLFDDFYRIYLPFLVSFTFCDRTLTELNMIMSTTAVIPSNYTPIHLVGLIFQAGL
FT                   MKIGMHNYDYISGVKCLVANYLLVNWLEDIGQLKTLDQIDCNLFGILLTDCLMINNATA
FT                   PNYLLVLKGAMTSVMIIIVVNHFLTRLIPSLSNSIVLAGNFLVLFPILVNHLIDFSNEK
FT                   ITSPALWLIDFILESEIRQYIMLSWVIVLVVFIPLVILFKSKISLNTSRKIWHFVIFLL
FT                   IVEPFHLDPEFVKISLCGIIPCFLSVEYLRYLKIEPYGEHLDFFLRSFADYRDQRGPLI
FT                   VSYIYLITGITIPLLLFESPVGLVSLGVGDSLASIVGKKVGRMHWKGTNKTIEGTVAFI
FT                   VGTTFISWILQRYFNYFSTIDIFKILVICTTGGVLEGNSELNDNILIPLFMVSMEKLLA
FT                   QS"
FT   CDS_pept        complement(774048..777851)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000154574" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17439005"
FT                   /gene_name="TIF31"
FT                   /locus_tag="CAGL0M07722g"
FT                   /product="Protein TIF31 homolog "
FT                   /function="binding"
FT                   /protein_id="CAG62660.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG058185"
FT                   /db_xref="HOGENOM:HBG203377"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniParc:UPI00003B712A"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FJB0"
FT                   /transl_table=1
FT                   /translation="MSQPSDIVKVIVALPTLSKKPQQGKKKKSKELEEITLQFRKDSKL
FT                   QNVLDFLSIAPATKYFTNYNLKNSTGDLLLSSEEKTLRELCSDKDEYKVALELKPYNQY
FT                   QALKHVLTSRDFFGFASETEDGLSNVAVSTGSKFYKLPLKEIKEKSPENEDKDTENKKP
FT                   TSMNVTDEEKVEFNHMVHGLFETLKKEKKVLLKDLMNTDTSVVTPCLRSINFSPYNPVP
FT                   AFYRTKGHLFYLQIVTLEGESLQVTAIPSGFYINKSTTSKFDPSPKENDGHVDTVHYTL
FT                   YDLLASSSKNFVTHISSLEKKFDDLESVTYVRPACTTLNKPWLIPAIPTNGPDYLRTQI
FT                   DSFNFEPERNFNDEFQSIKEIPTNTLQARIESERIFAKLTHEFTINATKGAMDILYGNG
FT                   TAMNPDSPLEEQIFLKNNIFYSFVGDLNQTYADKGGDEAAIASANQDLRTLNMLTRLNL
FT                   PNIHHLLTTIVDFGGKRILAQTPVPGLLSPMGVKITTNEETKEETVSELSSDICVKYGL
FT                   DENEKKVVFNEEFDEILNDQFAKSFHLKKHTIQGTELVFSSQSKGIVGSDKRHYILDLA
FT                   NTYPLDVEFAKENFDDVKEASKKYPHRQTLIRPELVEKWWATKIENDKVELVKAYEENL
FT                   YSYNPDAYQVPGVEDETVVEISKYLNEEIIPNVVQDYLNGNIISPYNGEHLADTFHKNG
FT                   VNMRYLGKFANLVKEELRKQEEAHEAKLAQVIVDNKEYEEWEKSYLQKIETMIKERQAK
FT                   INKLVQEGKEVPKELTEDLKLDDNEIKKPSTEKPVVVSYDELVPLIKTAELEIISRSLK
FT                   HILRKYSRSLPPIVIPALISFVFNLLFGTTYNPAPAVESVDPLYPVDQYEFKNLTHDTL
FT                   LKEIEQEAVVRYRYELEGDWFAEHELYPFTLIRSICNKFGVQLLNKDYFFSTEQLEEYK
FT                   QSLDKKSRAKYVAPLTTFSVSDLTVIPKIKAIDYSSPISEELWSQGASIINENQKDGLT
FT                   LLAQSIGFKEEVNSILHSSVAEKYLTLSTIYNKLGLNAEAIAFCRKSCAIYERVCGVDS
FT                   FELLRALTNLATLEFANESPYNVALIYQRIIQTVSGYGLDKIHHPIFTNIFNYLEQLSL
FT                   GVQDAKLAVEVLKSLGDFLVSIDGTESLPYAYIKSKLGNLLAADNRFSDALNQIKVAER
FT                   IFTKELGTNHGSTAQARQWVDGLTNLIKDVNQKKQLQQDQTAASGLKQQPQKSKSGHNK
FT                   KETTNPDLADKSVDELLSFIEGEDGKSSKTTKKSKSKGKNKK"
FT   CDS_pept        complement(779281..779985)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19349257"
FT                   /locus_tag="CAGL0M07744g"
FT                   /product="Similar to uniprot|Q8TFJ1 Pichia angusta "
FT                   /protein_id="CAG62661.1"
FT                   /db_xref="HOGENOM:HBG124095"
FT                   /db_xref="UniParc:UPI00003B712B"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJA9"
FT                   /transl_table=1
FT                   /translation="MSLEKKLVYPWVAEIDGSDTSAIFEEIRNPAICEFKTFILSEVGD
FT                   FQIWIERFEDIILLTNMYWYRFYKAGPYYKEGITDIYERHVISNFDNAMIQLVLKTVSA
FT                   KVRELCDSYLQFGAHHKQVTVFGLIDQIRSHYDRDNPLITYKRYYAWLGHMSNISNVER
FT                   ELDIRRLITDLLDDMPVMELSDKLSFEEQANKRAEISKYKNDIIAYMTIATTPNITADG
FT                   ITRALREKFGDF"
FT   CDS_pept        781830..782546
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20196079"
FT                   /locus_tag="CAGL0M07766g"
FT                   /product="Similarity"
FT                   /protein_id="CAG62662.1"
FT                   /db_xref="HOGENOM:HBG124095"
FT                   /db_xref="UniParc:UPI00003B712C"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJA8"
FT                   /transl_table=1
FT                   /translation="MAYPLLSKLDDIKDEVWLFEKINKPFLSIGFKTIILNEIGDFQKW
FT                   ILQLEWIIKSTDHLWYQFYQAGPFNFAGISDPHKQYIVSVFDGALKKLISNTVSERVNI
FT                   DYEDFLQSHLSNCKITSFDLLEILKIEYDWVNAEKYFRENFEWLQNMDNFNTTQKMLRC
FT                   QRLVHIITEPLVDKIQMTKETKNEIDDFKQQIAANLMIALSPNHTQEILRHYRIGKRLD
FT                   LYDITNTIAYLEDKSI"
FT   tRNA            complement(783270..783341)
FT                   /gene_name="tRNA-Glu (TTC)"
FT   CDS_pept        join(complement(784445..784724),complement(783505..784319))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21044875"
FT                   /locus_tag="CAGL0M07832g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /protein_id="CAG62663.1"
FT                   /db_xref="HOGENOM:HBG124096"
FT                   /db_xref="InterPro:IPR015159"
FT                   /db_xref="UniParc:UPI00003B712D"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJA7"
FT                   /transl_table=1
FT                   /translation="MEQRLETEDLHSESTDISSSIDADDLLHSGDSSLGEADKQIMEWA
FT                   GKLELESIDLREKSEKLINTLTNMSQELMKVSSQLVKQLENCNHSKEEDIVDQVYKLDV
FT                   NINNQLQDWKKSFSDQLKSINHNSNLGQIKNLTECMANQEANILGAIRHNSTILKDECR
FT                   DIIKSQELAGAPKLQRAVDYLHEIMHNMSCQTESMNELLLSIDKQLHNIDLALIKEKDQ
FT                   YKVQFKAFKRSLRDMITSNRNNVEDTVVNTVQVTIERKLEDMFDKMFDQKLLGKLRLLI
FT                   TKGEIPVPEGSKLANAIPLNRHTNDYDLNGTTWTDSSSQDGPRTRARFRTKNKVTKPRK
FT                   SEISRTIIPWCEISSPPVEYTSDL"
FT   CDS_pept        785153..785470
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000816" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17439006"
FT                   /locus_tag="CAGL0M07854g"
FT                   /product="Similar to uniprot|P47093 Saccharomyces
FT                   cerevisiae YJR022w pre-mRNA splicing factor "
FT                   /protein_id="CAG62664.1"
FT                   /db_xref="HOGENOM:HBG202231"
FT                   /db_xref="HOGENOM:HBG253180"
FT                   /db_xref="InterPro:IPR001163"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="UniParc:UPI00003B712E"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJA6"
FT                   /transl_table=1
FT                   /translation="MSPLLKQYLNKDIVVVTTAGEVMHVVLDGYDKYTNLVVKEGDKIR
FT                   LLRGSEIVVCGLLEDAKALEGLPMDSHVYKDTKNVIKDEYLIWEAVNKKHQSTHKKRKL
FT                   K"
FT   CDS_pept        complement(785578..786204)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000192424" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17439007"
FT                   /gene_name="MDE1"
FT                   /locus_tag="CAGL0M07876g"
FT                   /product="Methylthioribulose-1-phosphate dehydratase "
FT                   /EC_number="4.2.1.109"
FT                   /function="metal ion binding"
FT                   /function="methylthioribulose 1-phosphate dehydratase
FT                   activity"
FT                   /biological_process="methionine biosynthetic process "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAG62665.1"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0009086"
FT                   /db_xref="GO:0046570"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="HOGENOM:HBG315099"
FT                   /db_xref="HOGENOM:HBG365643"
FT                   /db_xref="InterPro:IPR001303"
FT                   /db_xref="InterPro:IPR017714"
FT                   /db_xref="UniParc:UPI00003B712F"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FJA5"
FT                   /transl_table=1
FT                   /translation="MGEAAELICTLCKQFYHLNWCTGTGGGISIRERNGESDVAYIAPS
FT                   GVQKELMRPEDLFVMDLIKGDYLSIPRGLKPSACTPLFLACYKKRNSGAVIHTHSQNAV
FT                   MCSLLFDKEFKISNIEQIKAMPNHGYYDTLTIPIIENMAHEDELIDQLNDVLDKYSQDT
FT                   VAVIVRRHGIFVWGPSIEKCKIYNEAIDYLLELALKMHQYNIPLP"
FT   CDS_pept        786678..789155
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000216643" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21044876"
FT                   /locus_tag="CAGL0M07898g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /function="binding"
FT                   /protein_id="CAG62666.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG124098"
FT                   /db_xref="HOGENOM:HBG202423"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR021133"
FT                   /db_xref="UniParc:UPI00003B7130"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJA4"
FT                   /transl_table=1
FT                   /translation="MADEEVDIERLTLQEKLDHKLWKARQRGYQDLQKELEEGILDPSF
FT                   FDQLWGETGRFEQYIQDSNVVALESAVVALNSFLGKKISKIVDSGDDTIKTHAKFQVDA
FT                   WVPVLIIKPLSSTRAATKKNAMECIIKLVSLMDSVDYTISAILTKLPSVIKQPKPTAAI
FT                   INILNQILTKFQCNLLASADLLKQLLEPLPKLSSHADRNVRSETMNLIVTVFLKVDGFQ
FT                   NRALLDELLLNSLKPIQIKDMEKMIDKVKDQKPEIMPYVWEDVIAKNKQQFNVDEDGDT
FT                   VMMGSNTEPKQDNTNNNVNALDSLVAGDTILDKFPDEFHSRVESQKWKDRAEALEEFYD
FT                   HALSKLKKIDGNANENYTNLFSMYGHIISKDINVQVVTIAAESIDKICHALPKQKLTKH
FT                   LIQLVFNPLLERTKEKKPTLLDAIRKTLKTLVEHSNPVLPHNEDMLQLILQYMEHKVPQ
FT                   IRMECTSLFNYVLQLEAPGFDIHSSYLFGEISRIVPKVVKIVNDTNPSIRQVGFDCFAT
FT                   LVTLLGKRPFIDSLDKLDTQKRKKIEELINSKSRPSSGALPGTRAGATSTVLPVKRPPT
FT                   SPLKKPPTSTSPRSRVLLTSRSLTKPNFGGSQPAPVAELTTGTLTPNKRFDKAVDNGVQ
FT                   GITSNGGANYVSKFNSERERWDKERGGLLSSIKKLEDTNAELTARNFELVDKLTSFEKE
FT                   REQQNLVINSKNEENGKLLEKIDFLEMKVKELQEKLDSNLSSARTFSLGTELSVPEAKR
FT                   VVESSDDELPKRVNSLRINSRASTLSSSDQQLFSRQFSGRDDEESWKRAAEVTRKLKER
FT                   IETMKARNRELSN"
FT   CDS_pept        complement(789467..791161)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000061334" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18501425"
FT                   /gene_name="PDC1"
FT                   /gene_synonym="PDC"
FT                   /locus_tag="CAGL0M07920g"
FT                   /product="Pyruvate decarboxylase "
FT                   /EC_number="4.1.1.1"
FT                   /function="magnesium ion binding"
FT                   /function="pyruvate decarboxylase activity"
FT                   /function="thiamine pyrophosphate binding"
FT                   /function="transferase activity"
FT                   /protein_id="CAG62667.1"
FT                   /db_xref="EMBL:AAN77243.1"
FT                   /db_xref="GO:0000287"
FT                   /db_xref="GO:0004737"
FT                   /db_xref="GO:0016740"
FT                   /db_xref="GO:0030976"
FT                   /db_xref="HOGENOM:HBG055646"
FT                   /db_xref="HOGENOM:HBG479104"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR012110"
FT                   /db_xref="UniParc:UPI00003B7131"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FJA3"
FT                   /transl_table=1
FT                   /translation="MSEITLGRYLFERLNQVDVKTIFGLPGDFNLSLLDKIYEVEGMRW
FT                   AGNANELNAAYAADGYARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSI
FT                   SSQAKQLLLHHTLGNGDFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYITQRPV
FT                   YLGLPANLVDLKVPAKLLETPIDLSLKPNDPEAETEVVDTVLELIKAAKNPVILADACA
FT                   SRHDVKAETKKLIDATQFPSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESADL
FT                   ILSVGALLSDFNTGSFSYSYKTKNIVEFHSDYIKIRNATFPGVQMKFALQKLLNAVPEA
FT                   IKGYKPVPVPARVPENKSCDPATPLKQEWMWNQVSKFLQEGDVVITETGTSAFGINQTP
FT                   FPNNAYGISQVLWGSIGFTTGACLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMI
FT                   RWGLKPYLFVLNNDGYTIERLIHGEKAGYNDIQNWDHLALLPTFGAKDYENHRVATTGE
FT                   WDKLTQDKEFNKNSKIRMIEVMLPVMDAPTSLIEQAKLTASINAKQE"
FT   CDS_pept        complement(792135..794111)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000112643" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17439008"
FT                   /locus_tag="CAGL0M07942g"
FT                   /product="Similar to uniprot|Q12209 Saccharomyces
FT                   cerevisiae YLR047c"
FT                   /function="electron carrier activity"
FT                   /function="flavin adenine dinucleotide binding "
FT                   /function="iron ion binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAG62668.1"
FT                   /db_xref="GO:0005506"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0050660"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG058520"
FT                   /db_xref="HOGENOM:HBG202425"
FT                   /db_xref="InterPro:IPR013130"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="UniParc:UPI00003B7132"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJA2"
FT                   /transl_table=1
FT                   /translation="MNAYDGNSTVPDRRAEKLAQSRIADLYSRACFTCALIIICVMIPS
FT                   YNRVTLSQRYFQVMHYFRHHFVARHAWIHRLRVYHNKSLQQCIFWCSFVGIFTLHGSQG
FT                   NFFIVVKKLGRLAVALMPPLLFLTLRPSPLPKTLYLTLLPFHKWIGRIVVLAAFLHSVF
FT                   YAYVMCANKVLLEKMRKPANLYGLIAMVLFVLIVVTSLAPIRRRAFRVFYTVHYLSTWL
FT                   VVVLIYMHARPGVPYYTAMSLSILVAQVIYRVRITRVCVAKVQRISPTLTLMEFPLEQL
FT                   ALRPQYPGAHVRIRPAKGGGLARAVDYLVNGLVVPLQHPFTIANLPKDDKIQLIIRSEK
FT                   FPMRDGMRYHVSGAFEPVINFLTKPRNLADSLVKYRSTFALGRGTQALLGSPLNYIVDS
FT                   QRVLIVVGGTGISFGLPLLRVLNFNGCLVKLKWAIRDFRDLRILSHIRNNFEGMEVYIS
FT                   GQGAEDEIEIEYTDNDFSDNEHTPLLSHHHMQGGSLLDSMDHVGSGNARAMDPGAKRDT
FT                   KATNNANGVNSANGANGGYCLRNVARENTADEIDFTDVFKNDTEHKRVPVGVFREPSII
FT                   EEQEDRDKKIAIPSGVKVFHGRPRLDQHDYNWCMESECGVNDVSVDKRRVWVVAAGPPG
FT                   LIDATSRWSTDSGLRFHGESFAV"
FT   tRNA            complement(794833..794903)
FT                   /gene_name="tRNA-Gly (GCC)"
FT   CDS_pept        complement(795243..795569)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000173745" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20196080"
FT                   /locus_tag="CAGL0M07986g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /protein_id="CAG62669.1"
FT                   /db_xref="HOGENOM:HBG178448"
FT                   /db_xref="HOGENOM:HBG737843"
FT                   /db_xref="InterPro:IPR018793"
FT                   /db_xref="UniParc:UPI00003B7133"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJA1"
FT                   /transl_table=1
FT                   /translation="MGASCKDQKRAVAICLQRSPCVMIERHKPQECLDNPELSKDLPEL
FT                   CIAQMKAFLDCKRGMVDMTKRFRGNAPLSTGKYDQQYDKLCSGDFNPREEMNKLNTLNS
FT                   SEKE"
FT   CDS_pept        795893..800059
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093808" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17439009"
FT                   /locus_tag="CAGL0M08008g"
FT                   /product="Similar to uniprot|P47104 Saccharomyces
FT                   cerevisiae YJR033c RAV1"
FT                   /protein_id="CAG62670.1"
FT                   /db_xref="HOGENOM:HBG059004"
FT                   /db_xref="HOGENOM:HBG202234"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR022033"
FT                   /db_xref="UniParc:UPI00003B7134"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJA0"
FT                   /transl_table=1
FT                   /translation="MSLTFLPGKPNDTVTSVCQRLWLDQTLLAYCSGNNLIIMSNELTK
FT                   LQTLYLDEDCVSVDINATNGFIAVGFGNKTKIYKPMYQVMKNPKWVNCCEVFHDESKVN
FT                   CVKWGNANELVIGSKYLSLWNIKDEFGDYRPVLLWTKLQPKPVYCCDISQDSQLIASYG
FT                   KYEKTVKLWKRVSISGEENVFNVTLLKHDAPITALKWKRNSIDDDINRASQVLFTLCED
FT                   RQLRVWFCYKLDSCHTVDLWGSLTLSHRQRYCLIIDNWLLSYCSKNSKLRSIDRNTIVN
FT                   SDVVLLADSEGNVEIHALDHLSNDPPRIMKKRLLHNKRLHKDSFVAKPDILYFSEVQPF
FT                   TSKDNILSIVIHDLKGVIRHSTISLAELLDNDKEVIGTLEHKFTGHNKSIQKLIRSSDG
FT                   EALLTTTRFSENCVWTPQYLGHGITLRMKNIICTESPIETAVVHEKGKLVIALLQNNKL
FT                   QAWRCPNYDSKMSDTKLSTLEAELTLQKDKTVKPILMLNTPEEKHNHDRHFIAIFYDDG
FT                   SINAFEVSERRGISEIRSQNLALDGREIHQLSTIDPVHRTFNANRPLLAVCTTGGTVIT
FT                   FRAKIDYEKLELSWIQAHEINTGGQKLRLVRGSSTGKMCIVDQSEKIMSLWDMRRGVLE
FT                   YEEHFEEPILDIDWTNTVHHQSVVSIGFESHVILYTQLRYDYTNKTPSYLPIEDINVIS
FT                   HTAHKIGDSIWMKDGIFVVASGNQFYVKDKTLDTNDPFTHASIGSRMIFSNDLFHLSSV
FT                   LNGPLPVYHPQFLIQALYANKLELVKELLLRLFLELRKLQLNAKNIIDLDSTLNIEPYK
FT                   FLYRLNKDYPKEIFPAPYQEFNEQVAGQLSEQLTKIALPYMTRHQQITLMTVITTVIEL
FT                   MKHQSTVDFNGLRFLLGTKLYQSHKKSQKSVLMRDVSWALHSDNKELLMSILGAQILSW
FT                   QQARQYKIAYWAKQDDLLASFEKIAKYEFSKDDTRDPNRCAVFYLALKKKQVLSSLWRV
FT                   CPGHPEQQKMMKFLGNDFKQSRWRTAALKNAFVLSSKHRYIEAASFFLLADSLKDSVNV
FT                   ICRQLKDIDLAIAVCRVYEGDNGPILAEFLTKEVLPTAIVDNDRWTTSYIYWKLRKQEL
FT                   AIKALITAPYDLEDNKQLVEENKVVNKSFLVEDPALLFLYNHLRNRNLRYFLASLDLSN
FT                   EYERYLILRATEILCRMGCDYLAISLVKNWNFIDKPKVATKLPFSPIKDQTYSGINAMT
FT                   EEPTSTNKVRKSLFDMFDKSGEDNTSSSSANNVTKSVLDDFNSNNNLRTSSILDQFKPS
FT                   GGLNTNTDSLCTQKIEKNPDQQPKNLLDAFTYNNVPEGKENDNKLTEKSVPNKPRSLLD
FT                   DFETIPSTSVTNSSQNSVENKTVTEENVALRSEPPKVKNLLDDFM"
FT   CDS_pept        complement(800149..801312)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000065980" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21044877"
FT                   /locus_tag="CAGL0M08030g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /function="binding"
FT                   /function="peptidyl-prolyl cis-trans isomerase activity "
FT                   /biological_process="protein folding"
FT                   /protein_id="CAG62671.1"
FT                   /db_xref="GO:0003755"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="HOGENOM:HBG022580"
FT                   /db_xref="HOGENOM:HBG610621"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR015891"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR020892"
FT                   /db_xref="InterPro:IPR023114"
FT                   /db_xref="UniParc:UPI00003B7135"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJ99"
FT                   /transl_table=1
FT                   /translation="MKVYLDIAIAGEQIGRIVCELYNDKAPKAVENFHRLCVGSGSVGG
FT                   IHLTYKRSCFHRVIRNFMIQGGDLVFGKEDNLDSDKVGLGGCSIYATEEEIKDDTKELQ
FT                   CHGLFEDENVGEFDEPFLLAMANTGSPNTNSSQFFITTYPSPHLTGKHSIFGRVIHGKS
FT                   VVRTIEYGKVDKEGTPENLVVIEDCGDWDETMSIPLYNASNSTIGGDIYEEYPDDDTHF
FT                   DSEDFAAAYNASNIIKDSGSALFKIKDYQNSYYKYMKALKYVNTYIPEQDVDEKHCLLF
FT                   IELKKKLYLNICLALFNLKDYDESMKYGHYLLELDSVDDKDKAKAYYRIGNSLFAKKRY
FT                   DEALKNYRLCRDHNPDDNVIGQKIEKTENILEKEKERTKKNISKFFR"
FT   CDS_pept        801812..805744
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21044878"
FT                   /locus_tag="CAGL0M08052g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /function="ARF guanyl-nucleotide exchange factor activity "
FT                   /biological_process="regulation of ARF protein signal
FT                   transduction"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAG62672.1"
FT                   /db_xref="GO:0005086"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0032012"
FT                   /db_xref="HOGENOM:HBG124099"
FT                   /db_xref="InterPro:IPR000904"
FT                   /db_xref="UniParc:UPI00003B7136"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJ98"
FT                   /transl_table=1
FT                   /translation="MLVSDPNTIILRECRELLYVIASERQDEYIPAVPDLIGGSNEYSE
FT                   DEEDTQKAELMKGEGTEDVDDKTAVKNQLQTLIDTVLLSQTLDNIDACTIVAPFNRTLI
FT                   SPRLNREATIRTLDALEKFINFEVINVNMSNYSTAFRMLIDSLNNISFDAYDKTSDDSI
FT                   LFKTLVLLRSSITKNSFEILSDSVAYDLLKTTITLACNSKRSPLLQEYARSSIYELTAI
FT                   AFNKIRSLKSSDDTNNYINDKSLGSSTLKKYLANRSSSEEDSMGLKGDEYFNSTVDLIK
FT                   ENKYKDPNCGLPVIKRYLQLLLSLLTIDQDNKHTKQVKALGFSLIICGIEVAGKDIILF
FT                   PSLFSIVADQIFEQVLYVIRTVYDKELVKVALDLFITLTINMEPYLRPQIELTFSHICD
FT                   ILLDKSIFTGERSKKTKSELKEIFLESISIMWKRKPSYLVDAFINYDCNLNRMDLANII
FT                   SGTLCKLLTSNGNDDINTWLLSFESLEIFINFMYEMTIKNASMSTNGIKEGSDIISQKK
FT                   KKIEYLSCVDRFNKKPKEGITYFHRSGFLKTLSDKDIATFLFENKGPLNKQKIGLLLCD
FT                   PNEQKLLQSYMQNFDFRDFRLDEALRIMLSKFRLPGESQQIERIIEMFSEVYSSQNERK
FT                   NENIQPESIDSNEADSELCVSISNKNVTCDADSAFVLSYSLIMLNTDLHNPQIKTHMSF
FT                   SDYTSNLRGCYKGADFPDSFLAKLYNSIKEKEILMPEEHHGNEQLFKDDWNNLIASAFI
FT                   LTKPSSKIQEHEERTKDFTDFIGAIFETFGFSLVSAFLSTTHANQISSNNTRLFAIIEK
FT                   CGRITSIYGLSAPYNKVIDSLLKMTVLIGNLDKELRLVENDNDDYAQIEVESSTSNEAI
FT                   CVSNESIAFGRDEKAQLSYITAYKLLNLEKNNIGLLPDTLETLIEVLTILYDKHIIDMS
FT                   YIDNVNELMRCDILPRTPTEITIKKEALNRSLLSTFASYIKGDEGPSKEQISLSELTIS
FT                   LVREHNVFTALNAHPKLINSGPMKSVLSLTSNARYNSRKNYCNYNFFFLVEFLIKLCID
FT                   NNIIEECGGSMINHLENHSNTPGITTRSRYAIMIIKNLINKHLGEQDKIIIDTLTFLNS
FT                   EDKDLQENDFDLFTTLINELISHSEKNLTVLNNPLFWRALSRACEYNILIETVSSILDN
FT                   FVLNEDTDLTDQIMIHLLFIQTIHQSKALTKLLENITKLPQNYSDANVPHLIELLLNNH
FT                   DEPLRVQVEQCLVALTKECSSSEQPEPSNLVQKYYLPVLSRNITDENVVVSLVNIITTV
FT                   SNQCTDTNSWNKEELKKIMMPFVNHE"
FT   CDS_pept        806323..808878
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17439010"
FT                   /locus_tag="CAGL0M08074g"
FT                   /product="UPF0508 protein CAGL0M08074g "
FT                   /protein_id="CAG62673.1"
FT                   /db_xref="HOGENOM:HBG124100"
FT                   /db_xref="UniParc:UPI00003B7137"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FJ97"
FT                   /transl_table=1
FT                   /translation="MDIHTLRSRWAYNVQLLKQLQWACTDTAKRSLNGTISNIEASSFA
FT                   NNLQKCTEALQFCIQKSLTIERTLKNYEIDVPLPVIKDVLLEQELMKYYTVILMEGCKL
FT                   IFDYSISIFRIGTEPRFMLCLIKLYLNLDSITELLGNEGNQFSDLLNSFEYQFMTQYNI
FT                   INCNTIHLDQVRDIFAKSNPLIAPPLLTVNDIEKRGYFFLSSVDLHIDNKLIEIAQLKN
FT                   GHLAVFYVNSQRQSFSTNGAKQLLKELVEGRMELLNMGRTLLFQTLKQRDMVIFLEFED
FT                   SLELVTNNSLTKKLLIQCVDKVSWCTYWKIYLENLFSEEQARTNVKASTSMLNPSHSFQ
FT                   NFKIKHTKLSELRPVSHQGIALNIPQKKSQNCQANITKSDDLEEDPGFKFAIHQSNPIN
FT                   EIYTSQTEELITSPSLNEIEYLSYDKLIALDRSLELTLSPKLLESPREANYKTVSQTFS
FT                   LDRINNISQNTPEVSDQESIVSNDELEKEPVFNPSVEDHKPQLLRKKSSLLSIFSNKNK
FT                   SKNKNNLKLEINSQMSSSNLSLNSASSSRTFFSVNSNDSTSTTVSDKYIEDSDRFQLDN
FT                   TTSILQLKVTKASCWDKSSWQVLSSFPLLLSLVKDHEAVYLTLQNPSNSGRFKFVTRIS
FT                   NIWKTTRSTAKDIQISIPTKDILATILDDLTNTTPRYQVLSLRTEEAERLKNTIDHCIN
FT                   GDMLSSISNSTTTRTLSSDASSSYMSQVSSNVSRSSTEVSDLNVHDFKSMASVKNILVL
FT                   SDIKARLHTKNNGRWCPHHIGLVNIYSLETPNNKKGIRFELTTDTRTTFQFNSKIHDLK
FT                   RLGRTGIAMIDDSEYLFEFPNNVITEQIYRYIAPSHPMI"
FT   CDS_pept        809185..809559
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19349258"
FT                   /locus_tag="CAGL0M08096g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /protein_id="CAG62674.1"
FT                   /db_xref="HOGENOM:HBG124101"
FT                   /db_xref="UniParc:UPI00003B7138"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJ96"
FT                   /transl_table=1
FT                   /translation="MQLKNTPLFVTCIEYTHTLPNNTRTPSNLNKYLTTIGKLTLLTNE
FT                   CIPDADFLSNSVEVHEPSFETVVMMLQLCELPNVSSTDGKFHHTDITPRVGLLPSVRLG
FT                   RSHHRLRQYRKSFAPIREFH"
FT   CDS_pept        join(810184..810492,811107..811352)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000205045" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18501426"
FT                   /locus_tag="CAGL0M08118g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="large ribosomal subunit"
FT                   /protein_id="CAG62675.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="GO:0015934"
FT                   /db_xref="HOGENOM:HBG232228"
FT                   /db_xref="HOGENOM:HBG568696"
FT                   /db_xref="InterPro:IPR001063"
FT                   /db_xref="InterPro:IPR005721"
FT                   /db_xref="InterPro:IPR018260"
FT                   /db_xref="UniParc:UPI00003B7139"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJ95"
FT                   /transl_table=1
FT                   /translation="MARYGATSTNPAKSASARGSYLRVSFKNTRETAQAINGWELTKAQ
FT                   KYLDQVLEHQRAIPFRRYNSSIGRTAQGKEFGVTKARWPAKSVKFIQGLLQNAAANAEA
FT                   KGLDATKLYVSHIQVNHAPKQRRRTYRAHGRINKYESSPSHIELVVTEKEEAVAKAAEK
FT                   KLVRLSSRQRGRIASQKRITA"
FT   CDS_pept        complement(811750..813732)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000205115" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20196081"
FT                   /locus_tag="CAGL0M08162g"
FT                   /product="Similar to uniprot|P34237 Saccharomyces
FT                   cerevisiae YKL179c"
FT                   /biological_process="intra-Golgi vesicle-mediated transport"
FT                   /cellular_component="integral to Golgi membrane "
FT                   /protein_id="CAG62676.1"
FT                   /db_xref="GO:0006891"
FT                   /db_xref="GO:0030173"
FT                   /db_xref="HOGENOM:HBG067191"
FT                   /db_xref="HOGENOM:HBG396211"
FT                   /db_xref="InterPro:IPR012284"
FT                   /db_xref="InterPro:IPR012955"
FT                   /db_xref="UniParc:UPI00003B713A"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJ94"
FT                   /transl_table=1
FT                   /translation="MDGSVYHHAADLWAKADLTNLQKDLDTSILAIKDRESSSLESRKH
FT                   LASETKVFKKLESDEKLNGINKIIKQYQQEIDSLTKRAKSAEQDLLDFYSKISEAPDPL
FT                   PLLKNSADNVEKIEDSDKLNGKITELEDKLARCADYDKIKERLSDLEQSSVKTLAKRLA
FT                   AKEQELNSTWEEKQRNWSEKEKELSKQITILQDNNKALEATIAKKIDIEGGETTSTGTP
FT                   SSMDFSASTERNLLMQELESSQSRVFQLEKRNEELSGKLAKATSEAEKESDLAAKQQQI
FT                   SQLESENALIMASSERERTNLNNITRELQQKVDNLKTESVSYKNELETLRRKVNTFSDY
FT                   NEIKSELEALKKIEFGASDDADDEDDQNQESNKVQKSLMNANKKLQATLVELRTENISQ
FT                   KELNSKLQKEIAQLTDKLGELEEANAKLEIDLQQIEDIDQKFNDTASMVSGATRQMNNR
FT                   TSKGRGKLSPTSSIVGIPEEGEYEPMQNTAILPIITKQRDRFRNRATDLEKQLRQLNQD
FT                   KGKLRQEMQILKAENTKLYEKVRYLTNNQNSSTIGVSSLDTEAQLSHSYDESLNPLSKF
FT                   KKTERDYYLNRHLSVWEKLFSTFAKIVLQNKSTRLIFLLYCVCLHGLVFMMSMYVINIS
FT                   GYLTPEVNVVQTSASKIGNAVDKNI"
FT   CDS_pept        complement(814364..815722)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093298" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17439011"
FT                   /locus_tag="CAGL0M08184g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /function="mating-type factor pheromone receptor activity "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAG62677.1"
FT                   /db_xref="GO:0004932"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG124102"
FT                   /db_xref="HOGENOM:HBG395950"
FT                   /db_xref="InterPro:IPR001499"
FT                   /db_xref="UniParc:UPI00003B713B"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJ93"
FT                   /transl_table=1
FT                   /translation="MSFESAIIGLCTLGMLALVPPLAWHTKTKNTPAVILIMWLILMDF
FT                   KCIVNAAIWSGSDFMMKWEGKGWCDIVIKLEVGANVGISCAVTNIIYNLHKILKADNAL
FT                   LKHNSWRKIAQDLSISLLTPIMVMALSYLVQVFRFGIARCYGCLNILSPTWVTTVVYTM
FT                   WLLIWSSIGSIYAVLVLIVYYRKRKDVKDILYCTNSGLNITRFARLLIFCFLIILVMFP
FT                   FSIYLFVKDLRQVGTKFSFRATHSKEFWGTILKFDVGHKFVNVWIYVLMSYLVFLIFGL
FT                   GTDALDMYASFMRLIGLGFTLDKFSAKRDEKNNNRFSAFMESIILHQNSDMQQRYSESL
FT                   TPTSQDCTFDCEMGNFKDAMFSNKPYHINVKKSYVLNDCVLEKIPQGQYLLSDLYSYDD
FT                   QITFHQHSANSLGSLGHVYSISYRSEVNSANTNKEIDTEGSSNGSPITRVESG"
FT   CDS_pept        complement(816472..817674)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093529" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21044879"
FT                   /locus_tag="CAGL0M08206g"
FT                   /product="Similar to uniprot|P46992 Saccharomyces
FT                   cerevisiae YJL171c"
FT                   /protein_id="CAG62678.1"
FT                   /db_xref="HOGENOM:HBG058972"
FT                   /db_xref="HOGENOM:HBG398421"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR018805"
FT                   /db_xref="InterPro:IPR018807"
FT                   /db_xref="UniParc:UPI00003B713C"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJ92"
FT                   /transl_table=1
FT                   /translation="MAMIKNVIAATAAALMCGSLVEAEVRGYDMIEFSNVGFTGSYTPV
FT                   KKMSNLDNNSTCKCEVGDRTWFQGDNAPLNEHLSVHFRGPLSLEKFAFYTSPNFVINDN
FT                   SSNSQSWNRSAFYDASAQTADNVTFMNNQGADSPCVGKALSYASDNGTSSASSPNVLKA
FT                   DNYVSSDQEYSIFSTVKCPKSGVKNGCGYYRDGIPAFYGFGGETKMFLFEFKMPTETQS
FT                   NSSSFEFYDMPAIWLLNDKIPRTSQYPINANCSCWSSGCGEFDIFEVMNGTERNHLYST
FT                   FHTYQGIEDLGTGIQSYGYIPRDTKGTMMGGVIFDSNGNTVSFISNSTSFDQTLSPSAV
FT                   NSLLRAIPSNETYSTKLMSISGVAPSSSKSKSSGAALSVDQGIWYYVFTAFTAVAHFLL
FT                   I"
FT   CDS_pept        complement(818072..820594)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000113404" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17439012"
FT                   /gene_name="LST4"
FT                   /locus_tag="CAGL0M08228g"
FT                   /product="Protein LST4"
FT                   /biological_process="amino acid transport"
FT                   /biological_process="protein transport"
FT                   /protein_id="CAG62679.1"
FT                   /db_xref="GO:0006865"
FT                   /db_xref="GO:0015031"
FT                   /db_xref="HOGENOM:HBG124103"
FT                   /db_xref="HOGENOM:HBG202403"
FT                   /db_xref="UniParc:UPI00003B713D"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FJ91"
FT                   /transl_table=1
FT                   /translation="MGERFEGLENLNDECKVKLFGCRMRAPGSGTGGHESIEYRLLILE
FT                   ENAEMVCRQRYRTILDYSSRGHGSMGLKHDEMTNGNVSAPFITASELRQYIYGSPIRSK
FT                   TRVTEDKFRIIPNSRQLLITRVFYPRRTSMNLHGTFPKNYQSSDRRVSITMCLPSYLLA
FT                   DISDSWADIDGWLTQTERHLMATSFHVVETQDNFVTLVNKLLIPALRSCHEIPRLFLYP
FT                   QDNIDFIHTWFKDVFNWIELKEGTKLSFLPFLIAKTLIEYRDDPQESECHRIVITSGNL
FT                   VIANKLVFILGGLLKPRYDGEMKIMITPVSTPTPSNHLMPPSMNGSNESSYHSSSNSHT
FT                   PSKLKIPATINEHRPSRPRYSSTENIHVQSRTMDIPIVKSDQSPFSTSRGWKIPSSYRS
FT                   ATSSVSISSDESLAEVIQPSSLKSTTSIPFQNFSSSLSNQLYSSSYGSWFNGSITGSFT
FT                   NSNPLSNGTSNMATFSSSFKKNNISSIFQSNSPTAGTDSWERPENNTGLNPNITLQRTA
FT                   SNSSLRHMLTPYQQQLISPSTNSEYDEYPWFGATNNAGGATVGTSSETVGSQQPVLLQG
FT                   AHMDTTTLLDSIRTSNNNGAYTFPLKNVGFDRDCSSLDHHKLLTSCFEEIFEGDIDANK
FT                   VTTMVPCSDIAVHIHSKQEDSEGVTSHPRVVIDVDIPGTTISKYPEELLPRYTMYLSHF
FT                   NPFFKLQAIPATNEIENKIVHGLKRDFISEKCDVSKTLFISMRSRSIKEIVVRKTTSIN
FT                   TPSNSSNQDPRNKSKGSMLKQKIKKVFSNGTCTGRVTPVLNNCVAFVEAALMSAMSLYS
FT                   DPTIDKKYRDERILKIFLAVAHYNVDEV"
FT   CDS_pept        821047..822765
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000142066" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17439013"
FT                   /locus_tag="CAGL0M08250g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /function="metal ion transmembrane transporter activity "
FT                   /cellular_component="membrane"
FT                   /protein_id="CAG62680.1"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="GO:0046873"
FT                   /db_xref="HOGENOM:HBG058975"
FT                   /db_xref="HOGENOM:HBG202404"
FT                   /db_xref="InterPro:IPR003689"
FT                   /db_xref="UniParc:UPI00003B713E"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJ90"
FT                   /transl_table=1
FT                   /translation="MIARWLLFSLISSLLCILGALFVPIISRYSSKSHENNNTKLVNYG
FT                   LSLSAGSMMTTALYKMLPAMDPDNRFTVFFGFTFGILISFFLNYVVHAFTSESLIHCAH
FT                   GDDHSHSHGDHDRAHDHDHDHNDSHEYGHGHEHSHEHGNNNNHVHLDDNEADDDLYDPL
FT                   SRHRSVETEHSALLPHGKEGVRRRLSLLDLFSKKHRDIGPCCDSIVKSCGVLSVPADKL
FT                   TCVPLNQRGKCLNEQCHNYMQEVDQRPNHVSSQTDSSYSPNHSNSSSYESQDDAEHKHE
FT                   HTSGVVCLENNIGYDLENLDTYRNNYMLGRRNTIEYQPSAKVSTNAGSTSVRSQAISRP
FT                   SLKGINSAPHYSENAQATKASNHDGHGHDDGHEHFHHHDEEALYSHHHHLETPFSKLLS
FT                   IGLQTCLVLTLHKFPEGLIIFYTNQSDETKSLGLSIFISLLIHNFVEGFAMTLPFYTAF
FT                   ESKWKAILITTILGGGSQPFGAVLGYFIFKSSGGDHKHSDGAPPIMGLLLSITAGFLVV
FT                   ISVQMFQTGVSFSDSHHHHSDDNEEEIAQNHTMGTTCLKWCCAGICLILLSGIFV"
FT   CDS_pept        complement(823019..824884)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000162166" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17439014"
FT                   /locus_tag="CAGL0M08272g"
FT                   /product="Similar to uniprot|P36029 Saccharomyces
FT                   cerevisiae YKL174c"
FT                   /function="amino acid transmembrane transporter activity "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAG62681.1"
FT                   /db_xref="GO:0015171"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG146321"
FT                   /db_xref="HOGENOM:HBG202405"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniParc:UPI00003B713F"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJ89"
FT                   /transl_table=1
FT                   /translation="MIQEYTLIPENIRENIRENMPNLDPHEIFENLHHYVQEDEVTDEP
FT                   EEVEHFNYKQELDKSLLSRNSVIGLGFGLMSPVLGMCTSMGIGMLNGGPLSIMLGFFIS
FT                   GILIWFSSLSLGEIVSKFPMELHVGSAMIAPPRLKLICSWFTGWLMLIGNWTMSTSITF
FT                   AGAQLTISLILMANNELISETHLILFTVIVFYMVVTLVGLVNLKFARFIEIINKVCVYW
FT                   IIYAIIFIDILLLIFHKGKFRSLKYALFHFDNSMSGYSSAFLSFLIGFQQSNFTLQGFS
FT                   MLPALADEVKKPEKDIPRGMSTAVLLSTFSGLIFLLPIMLILPDIETIFSNHKVLPIVT
FT                   IFTKSTHSMVVSVFLVLLILGNLFFSGIGSITTSSRAVYSFSRDHAIPRYDLWTFVPPD
FT                   SQSRVPKYSILLSMGISYFLGLLALISTAAFNAFIGAAVLCLCSATFIPLVLVLCTGRR
FT                   SIKHAPVKIRYKFGWFINIASVLWLLLVMVSVCFPTQLPVTVKGMNYAIVVYVLCLIGI
FT                   TILYFKWGKYNFRLPLSDDAKNNPFSLEAQFPTTKEDNEYEHSGSNAKTANLPEGQASP
FT                   VENPFIGEHENSQTDIDFDVVSVDLQDAIEERDTRLEGQTRNDTN"
FT   CDS_pept        825250..828219
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000231589" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17440073"
FT                   /locus_tag="CAGL0M08294g"
FT                   /product="Similar to uniprot|P36048 Saccharomyces
FT                   cerevisiae YKL173w U5 snRNP-specific protein "
FT                   /function="GTP binding"
FT                   /function="GTPase activity"
FT                   /protein_id="CAG62682.1"
FT                   /db_xref="GO:0003924"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="HOGENOM:HBG156268"
FT                   /db_xref="HOGENOM:HBG737692"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniParc:UPI00003B7140"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJ88"
FT                   /transl_table=1
FT                   /translation="MDFDEFGNPIGDELELGEEIEVKKEETESIGTNGEGSNHSDNEIN
FT                   EEDDDYMSDLDADFDDENLALESLRHTYGDQVEVLMEYEDRDANEPIVESGDTGESHSK
FT                   EGVFIRLKKNIPRAQFDREYMMQMMKVPERIRTVCILGPLHSGKTSIADIFVLNNYDRL
FT                   NCITKNIRLGWKQLRYMDNTRQEIERGMTLKLNGMTFLATDMQDKSHVINLLDTPGHVD
FT                   FIDEVAVAMSVSDTALVCIDIIEGISSTTRYIIKECQKRGLSMVFLINKIDRLVLELML
FT                   PPTEAYMKLQELVLNIQGATKDSMFTPENNNILFASAKFGIIFSIEQFVSKCYGKVLAG
FT                   PKLNEFVKRVWRNNYYDRGVFHPRTLNDKNHEATFVTFILNPIYKIFTHTLSREVDVVS
FT                   KTLKKNFGVSLTEDEMANDPQPLLKVVFTKIFPDQKALISSLTSCSGSGNYYQKQVNLL
FT                   ENGVQNTSSRQFLAHAVKNMSIGDSEWTLVKVYHGNIAVGDKISVIVPVSNISDSGVKF
FT                   IDEEMLEEGSQHVIEAISLLGGRFCYPVPSASEGQLVLLKGISKSFVKSATLCSNNIES
FT                   AGLPLFQAINYIGRPVFKVIIAPLNPKELPKLLSGLEKTNRYYPGLHVKVEESGEHVLL
FT                   GNGELYFDCLMHDLRNVYGGIEVKISDPVTVFAESCQGESFAAIPVESSNHNISLTVCA
FT                   EPLDKKIVQDISKKKLDVELLGDKKGLREMAKVLRRDYGWDSLAARNIWAFFHTSILVD
FT                   DTLPDETDKNLLQHFREQVLQGFYWAVREGPLMEEAIHGVKFRILKFEMSGRVNLDSLD
FT                   VGIIGVQLIPLMRKACNVALLTAKPIVVEPIYEMDIIMKKVYYPVLEEVLKKRRSAYIY
FT                   ATETIPGTPLIEVKTQVPVIESFGLETDIRLSSEGNAIIQSHQWNDIWRKVPGDVMDED
FT                   APIPKLKPAPTSSLSRDFVMKTRRRKGISNDGFMSNDGPTLQKYIDKELFSQLKEAGFV
FT                   "
FT   CDS_pept        829069..831963
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000113231" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21045129"
FT                   /locus_tag="CAGL0M08316g"
FT                   /product="Similar to uniprot|P36003 Saccharomyces
FT                   cerevisiae YKL171w"
FT                   /function="ATP binding"
FT                   /function="protein kinase activity"
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="CAG62683.1"
FT                   /db_xref="GO:0004672"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG058976"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR016241"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI00003B7141"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJ87"
FT                   /transl_table=1
FT                   /translation="MYGQRRVRSERYSSDISSGKDEEIKVSRSKGIDCPPRRRESSTNE
FT                   DSLYFQPTKIYKLEKELASRSTLVKSDKDSTDEERDSDEIVSNRFNEADSVRHFGRYTD
FT                   ENYQYRHINGLVPDYYEGMRKNKLGLVSDLTNESRNNYIFEQNANFEMEFPIDESALGG
FT                   NETRGMHDEYIPNLNYGQLIENWVDEEKQVQTMEDLQREDSMLQGQLMKEASMILSNKV
FT                   RSPTQERSQTPRLATWVNDYDSEPRIMTNRSSSVIPEALSDDDIREDSLSPNTSAIFSN
FT                   SHAQVEPIPLPSKNSSRMPTSTLEDRRSYMNFLGKPASTFGAIDSMGMSALKNVNSFLP
FT                   IHKSSLPSTIPVRKGSSGQSTANSDSSSLNLQHNLSSSVGDLKLDSDQMMDLIRKLPKD
FT                   FLTLPYSQRKKQIIKLAPDKDSRLIMSLLKKVMITNSKSASSIQKPSMRSRHGSLASQF
FT                   LSSFSPSVASMASSGGFRPDDKGLFIMGHKLGKVIGFGAWGMIRECVDIQSGAQRAMKI
FT                   VRFKDNQKVKRNVIREVNVWKEMHHMYILPLLDWKLISDYAMYCLTERVKDGTLYDLVL
FT                   SWEDRKNNQIPVDERIKLTMFLMLQLISALKYMHSNSTVHGDIKLENCLLKKGRQHKNW
FT                   TIFLCDFGMSCRFGSYRSRYDTLIDEEKNNSGIIREESYMPLSFEASPKPIYREVSQLN
FT                   SQHSQLSSQLTPQLQLQSNSASFSQPQQFLAVQQLPQPEPSLPHVHSDSNSTSQPPSKF
FT                   MKIVTDRNVIHDDTPFEILTARQASRRSFESHNSKKSQKMSTVSVESLPSSPSATPLDN
FT                   VNAFDPCSLDAQRHFSLSVENSNTKTPSSLIGSLPYAAPELLVPEPSPLGPGADIWALG
FT                   VTMYTMLMGKLPFKHDLESKLKQLIASGKFDKKSLKCMCNGGHSNLSDEALKYQGLYDA
FT                   ILGCLTINLLDRWGLHDVETALREELKKNGELSQ"
FT   CDS_pept        832444..832860
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000183702" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17440074"
FT                   /locus_tag="CAGL0M08338g"
FT                   /product="Similar to uniprot|P35996 Saccharomyces
FT                   cerevisiae YKL170w MRPL38"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="large ribosomal subunit"
FT                   /protein_id="CAG62684.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="GO:0015934"
FT                   /db_xref="HOGENOM:HBG384371"
FT                   /db_xref="HOGENOM:HBG594899"
FT                   /db_xref="InterPro:IPR000218"
FT                   /db_xref="InterPro:IPR005745"
FT                   /db_xref="InterPro:IPR019972"
FT                   /db_xref="UniParc:UPI00003B7142"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJ86"
FT                   /transl_table=1
FT                   /translation="MIYLKSIIKVIDNSGAQLAECIKVIGKGSPKSPGRVGDRIVCVIQ
FT                   KARPLTQNITGTATTNRVKKGDICHAIVVRTKQTNEYRRDGSMISFGDNACVLINKNTG
FT                   EPLGTRIMANDGVVDRTLKDKGFNKICSLASKAL"
FT   CDS_pept        complement(833220..835520)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000112846" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17440075"
FT                   /gene_name="KKQ8"
FT                   /locus_tag="CAGL0M08360g"
FT                   /product="Probable serine/threonine-protein kinase KKQ8 "
FT                   /EC_number="2.7.11.1"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAG62685.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG124951"
FT                   /db_xref="HOGENOM:HBG202407"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="InterPro:IPR020636"
FT                   /db_xref="UniParc:UPI00003B7143"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FJ85"
FT                   /transl_table=1
FT                   /translation="MPEHEERHSHGVNRSLSLGSSMRSLFKSQRSRGPSDRGANGTPGP
FT                   AQKVDIRVDTASASREHTPVVHKTPQSANPELQQPRHHLGLPNILKLNLTPTNSNPQSK
FT                   SGSPVSQNTSQESLITDTDIEVEDYRPSKDSRRTVRNASPMSSNGNLPINANTVIGPDT
FT                   SSNNIDSMLDGTGLRPFYEEADSSDYIENLRSFPLPTGHYAPGFIQPPKSPTSSRVPSR
FT                   SNSRKGREHAGTVSAAQLPRYNETPGKCILDLEYFKLYEDGHHVHTLKVMTSVNSDANG
FT                   NSHNHASKNDGHLDLPKGDDGSVVRQKSKFSLSGFFKPHSKEDIANADEKLKYAVSLLP
FT                   RNKICSKVETDRDTFAPVFTKTRSHVQSGSDDSSDDDEELDDPSIPKIVNKNAAVGSQE
FT                   LKLINNLSEKIRMGLSTAAKNKHNQSSKHRTPSGAGVQDENQPAFADLYGKCVAVVGHG
FT                   AYGVVKVCARTRDEKDDLPATKTYMDSKKIYFAVKELKPRPSDPIEKFSTRITSEFIIG
FT                   HSLSHYYDKNGEQSAPNILSIIDLLEYNDTFIEVMEFCPAGDLYSLLTARKNKIGKPLH
FT                   PLEADCFMKQLLKGIQFMHDHGVAHCDLKPENILLHPNGLLKICDFGTSCVFQTAWERH
FT                   VHFQTGLQGSEPYVAPEEYNPKKEYDPRLVDCWSIGIVYCTMIMGHYLWRNAARGKDSL
FT                   YDSFYEEMASKKEFYVFEELRHINQEINRLRRIALYQIFQPNPEKRISIDKLLQTGWMR
FT                   HTKCCVPYKNIPR"
FT   CDS_pept        complement(835962..836369)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000001073" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17440076"
FT                   /locus_tag="CAGL0M08382g"
FT                   /product="Similar to uniprot|P32388 Saccharomyces
FT                   cerevisiae YKL167c MRP49"
FT                   /protein_id="CAG62686.1"
FT                   /db_xref="HOGENOM:HBG058978"
FT                   /db_xref="HOGENOM:HBG202408"
FT                   /db_xref="InterPro:IPR007741"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="UniParc:UPI00003B7144"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJ84"
FT                   /transl_table=1
FT                   /translation="MSKVARQLKFLNKISSTTTDAQVILSPGKYQRLSLTFQTKNHNGH
FT                   MGARKFWKDYLPTIQFYNPQLRIDVTRIKNESKTVSVPCTLQAIGTDGKVVEEIDMSNK
FT                   HAPEILQSLLQKLDHERVPESQIISVGTQSA"
FT   CDS_pept        complement(836791..838179)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000233033" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17440077"
FT                   /locus_tag="CAGL0M08404g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="CAG62687.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG537393"
FT                   /db_xref="HOGENOM:HBG755340"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR000961"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI00003B7145"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJ83"
FT                   /transl_table=1
FT                   /translation="MQILGENFKEVEIMDSEYDRRKLEEESAGPPGDEPMGQENHEQLE
FT                   NHIDKATESQMSKELVVEDDQYDQGSHNIDYEARNKEEHNNGTNRTDGGHTQGTEQSNE
FT                   QQTESNHEQQQQQRLQQTEQHQQHQMETVKKPLIYGANTSGKYTLSDFQILRTLGTGSF
FT                   GRVHLIRSNHNGRFYALKALKKHTVVKLKQVEHTNDERRMLSIVSHPFIIRMWGTFQDS
FT                   QHVFMVMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVCLALEYLHSKEIIYRDLKPENI
FT                   LLDKNGHIKITDFGFAKYVPDVTYTLCGTPDYIAPEVVSTKPYNKSVDWWSFGILIYEM
FT                   LAGYTPFYDANTMKTYEHILNSELKFPSFFHPDVQDLLSKLITRDLSKRLGNLQNGSED
FT                   VKNHPWFSEVVWEKLLARYIETPYEPPIQQGQGDTSQFDRYPEEEINYGVQGEDPYADL
FT                   FREF"
FT   CDS_pept        complement(838957..840594)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000142024" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19349521"
FT                   /locus_tag="CAGL0M08426g"
FT                   /product="Similar to uniprot|P46996 Saccharomyces
FT                   cerevisiae YJL163c"
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="CAG62688.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG124104"
FT                   /db_xref="HOGENOM:HBG202282"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="UniParc:UPI00003B7146"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJ82"
FT                   /transl_table=1
FT                   /translation="MQLGASHSDEEIDESHYTNREGTVEAALLESFFDESHPMPVSAEL
FT                   KRIQENQARHIHLPWYQKPSTFLICLLIMLIALAETLYMTPIIIITKDKVCESISNGQI
FT                   KGEETICDPIKVQTILSEISSMTIIISGVISTFMAGKMGELSDRFGRVHVFIYIGLIRL
FT                   LGNAAHVYALWPSTTYYKWFIILAGSLNSFSGGMYAIIANANSYLSDIVEPENRSVSFG
FT                   KVTSALFATMGVGFLLASNIVTLFHGNNFAPIYFAISCSSLFILLCLFFIKETRHEDSL
FT                   RDSQEAFGRRMDKHFERLMADIESAERPGLAGKIYLYGHYYTNQALHLLSPLKTLWIPR
FT                   DSNGSLRGRHTVILLLVIDIAYVCSTTACMPPLILLTTYKYNWQTVEIGYFVSFSGISK
FT                   AVVLLLLSPYIVAWLKKIYTACTDKVDNIDMICIRISMVAIVFGISAIIFKTESESSVI
FT                   GFALFQAFSAFLSPTIQSTVIKYCPKDRTGQCFGGMALVRSLTMLVFPPLLLKIYGATV
FT                   AGSPEVFLWIPMIASIISVVLSLMIKTH"
FT   CDS_pept        complement(841439..844204)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000170818" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17440078"
FT                   /gene_name="MCD4"
FT                   /locus_tag="CAGL0M08448g"
FT                   /product="GPI ethanolamine phosphate transferase 1 "
FT                   /EC_number="2.-.-.-"
FT                   /function="transferase activity"
FT                   /biological_process="GPI anchor biosynthetic process "
FT                   /biological_process="cellular cell wall organization "
FT                   /cellular_component="endoplasmic reticulum membrane "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAG62689.1"
FT                   /db_xref="GO:0005789"
FT                   /db_xref="GO:0006506"
FT                   /db_xref="GO:0007047"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0016740"
FT                   /db_xref="HOGENOM:HBG524563"
FT                   /db_xref="HOGENOM:HBG609268"
FT                   /db_xref="InterPro:IPR002591"
FT                   /db_xref="InterPro:IPR007070"
FT                   /db_xref="InterPro:IPR017849"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR017852"
FT                   /db_xref="UniParc:UPI00003B7147"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FJ81"
FT                   /transl_table=1
FT                   /translation="MKNNTRFTLIVVGVLFHLLYLWSIFDIYFISPLVHGMEQKISTNN
FT                   PPAKRLFLIVGDGLRADTTFDKITHPVTKKADYLAPFIRSLVQNNATYGISHTRMPTES
FT                   RPGHVAMIAGFYEDVSAVTKGWKENPVDFDSFFNQTAHTYSFGSPDILPMFKDGASDPN
FT                   KVDAWMYGHEYEDFTQSSIELDAYVFRHLDQLFKNSSTDKELDKQIRQDGNAFFLHLLG
FT                   CDTAGHSYRPYSAEYYDNVIYIDKQVEKLVKQVEEFFGDNDTAFIFTADHGMSAFGSHG
FT                   DGHPNNTRTPLVAWGAGLNRPVRLDTPEFDEYTENWNLANIKRNDVKQADIAALMSYLI
FT                   GTNYPANSVGELPLAYIEGSEGQKLEALLNNAESILEQYRVKENEVINSQFVYKIYPKF
FT                   AEKSPTEYLKEIKELIKKIENGEESLEPEAIRLTEELMKVTLEGLHYLTTYNWRFIRTI
FT                   VTFGFLGWICYSFMIFLKLFILNNSQTTHPSILNISIFTSLGLILNYILFYQKSPLNFY
FT                   LYLIFPLFFWSKIFSNTAIIRDGVNEFFKGISKAESVIIGLTIISIYEGIVYGFFHRWI
FT                   LSLILVSFAFYPLVCGVTDLFTNLLWILTSVGLSSFTLLDAVKIENLQQIQVAGILIVL
FT                   SSAYAVMRLSQDISKYTQHLLSIQIFLVSGMLHFTSKSVISLQKREGLPAFAQVGGWAI
FT                   LVISLTIMPFLHYLKPNNNYQVRLLTIYLTFAPSFIILSISFEALFYFIFTAYIVQWLQ
FT                   IEKNIKVLKDEQKSDSNGIQLLRVAIIGFFLQQIAFFGTGNVASISSFSLDSVYRLLPV
FT                   FDPFPMGALLMLKLIIPYVLLSCGLGIMNIQLDIKDYTISSLIISTSDILSLNFFYLLK
FT                   TEGSWLDIGVTISNYCLAILSSLFMLILEIVGHQLLKNVTRATSSQKKTN"
FT   tRNA            complement(845650..845721)
FT                   /gene_name="tRNA-Glu (TTC)"
FT   CDS_pept        848089..849096
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248193" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20196345"
FT                   /locus_tag="CAGL0M08492g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /protein_id="CAG62690.1"
FT                   /db_xref="HOGENOM:HBG058981"
FT                   /db_xref="HOGENOM:HBG626440"
FT                   /db_xref="InterPro:IPR000420"
FT                   /db_xref="UniParc:UPI00003B7148"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJ80"
FT                   /transl_table=1
FT                   /translation="MQYKKSLAATALLASSGLAAYVPGNPWSTLTPSGTYKGGLTDYSS
FT                   TFGIAVQPIATSSSVAKRAVSQIGDGQVQAATKTQAAPVSQIGDGQIQATTKTQAAPVS
FT                   QIGDGQIQAATKTQAAPVSQIGDGQIQAATKTQAAPVSQIGDGQIQAATKTQAAPVSQI
FT                   GDGQIQATTKTQAAPVSQIGDGQIQATTKTTQAASQIGDGQVQAATKTASAASQIADGQ
FT                   VQQNKDPKDPVGAVSCKVDGTLQMNLKGGILTDEKGRIGSIVANRQFQFDGPPPQAGAI
FT                   YAAGWSLTPQGNLALGDSDVFYQCLSGNFYNLYDQSIGAQCHPVHLSAIDLVKC"
FT   CDS_pept        complement(849926..850558)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248193" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19349522"
FT                   /locus_tag="CAGL0M08514g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /protein_id="CAG62691.1"
FT                   /db_xref="HOGENOM:HBG058981"
FT                   /db_xref="HOGENOM:HBG626440"
FT                   /db_xref="UniParc:UPI00003B7149"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJ79"
FT                   /transl_table=1
FT                   /translation="MQFNKISLLAMASAASAATTSPTTTETKPTTTKFFTPGDNFSTFA
FT                   PNATFSGAAVNFTSTFGIAVQSIDSKSVVSKSLVSTSTTSTLAPSSSTSSAASSTTSSP
FT                   NITIVNKSCKADGTLVMELENGILRDGKGRIGSIVSNRQFQFDGPPPQAGAIYAAGWSV
FT                   TPEGNLALGDSDVFYQCSSGNFYNLYDEYIAEQCHPIHLEVLSLVDC"
FT   CDS_pept        complement(852150..853376)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21045130"
FT                   /locus_tag="CAGL0M08536g"
FT                   /product="Similar to uniprot|P36052 Saccharomyces
FT                   cerevisiae YKL162c"
FT                   /protein_id="CAG62692.1"
FT                   /db_xref="HOGENOM:HBG124105"
FT                   /db_xref="UniParc:UPI00003B714A"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJ78"
FT                   /transl_table=1
FT                   /translation="MSRCLSKSLRDYLAWVNLPVARSNFFITYDYRLRHQRQQNALTAD
FT                   LLRSVATCLAKYLLVDYKLNEYPYYDLTVVNVFSNYRQSMEILSAAMRYLEPVVDRQLL
FT                   SRVKVYMMPLYPSPQHPGETRQVSENVWVLGDDQAVFGTPATLQDMRLADLLPLEYSTA
FT                   SSIAEEDPVHVVMFDDVLQNLAPDLVRVRPDCGNVNTSAGAGGSASGSASAGEWEQCFV
FT                   NTSDMSRTYLGQGMGMDPLCELAVQLCLPPAENVACGTEVYVPSQAALLFSHLKRRFPE
FT                   HKLFAVDSFEVTHETMYFRWKSWLAAIMGFGTRGITGTGTGSASAPYGIESSSLVLGYT
FT                   SGTGTSTSYSHRALKLVPNAHQCQLLYTGINDGRKACTVEPLDTFIDKWRGSDLPAPEA
FT                   GPFSVMYQE"
FT   CDS_pept        854646..854813
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000274029" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17440079"
FT                   /locus_tag="CAGL0M08552g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAR58076.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG741476"
FT                   /db_xref="InterPro:IPR000612"
FT                   /db_xref="UniParc:UPI00017BD8F4"
FT                   /db_xref="UniProtKB/TrEMBL:B4UN60"
FT                   /transl_table=1
FT                   /translation="MDSTKIVNIFLAIFLPPVAVFSARGFGTECILSIILTICAWFPGM
FT                   LYALYVVLTD"
FT   CDS_pept        complement(855046..855342)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17440080"
FT                   /locus_tag="CAGL0M08558g"
FT                   /product="Similarity"
FT                   /protein_id="CAG62693.1"
FT                   /db_xref="HOGENOM:HBG124106"
FT                   /db_xref="UniParc:UPI00003B714B"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJ77"
FT                   /transl_table=1
FT                   /translation="MFISFFSLNCGYMTQTLYTRIHTISTHIKKYHGIADTRSSRAITG
FT                   ACLQDVPAGVQCAHLAAVGTNPTTRCDRYRTVRSPAHRLLYPTHSILPEDIRL"
FT   CDS_pept        complement(855443..856036)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17440081"
FT                   /locus_tag="CAGL0M08580g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /protein_id="CAG62694.1"
FT                   /db_xref="HOGENOM:HBG124108"
FT                   /db_xref="InterPro:IPR003892"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="UniParc:UPI00003B714C"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJ76"
FT                   /transl_table=1
FT                   /translation="MSIDGYSYLQKYLVFADIKQLNTEVEQNVHYEKLVKAFPTVDKLI
FT                   IRAILLAARGDLAPAFNALLSLTGEDIQLGLPMRRYEFLPDKTLMEQALRAKQEDMLEQ
FT                   LSQLQEPSSKAKSAGSETKEKSVPTGDGVSTEAMTGEAQSEPQMMENNAEDPKDITDKG
FT                   LISDTKSEEANISVVEPQVENGKSVNPFELLQDE"
FT   CDS_pept        complement(856349..859387)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000250397" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18501697"
FT                   /locus_tag="CAGL0M08602g"
FT                   /product="Similar to uniprot|P38995 Saccharomyces
FT                   cerevisiae YDR270w CCC2"
FT                   /function="ATP binding"
FT                   /function="copper-exporting ATPase activity"
FT                   /function="metal ion binding"
FT                   /biological_process="ATP biosynthetic process"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAG62695.1"
FT                   /db_xref="GO:0004008"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006754"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="HOGENOM:HBG283308"
FT                   /db_xref="HOGENOM:HBG507745"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR005834"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR006403"
FT                   /db_xref="InterPro:IPR006416"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniParc:UPI00003B714D"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJ75"
FT                   /transl_table=1
FT                   /translation="MKEVVLIVRGMTCASCVNAVVGQVEALEGVSSCDVSLVTSECKVV
FT                   SEDSVATDGIIEAVEDCGFDCELIREKSMAPALCRGFIGIKGMTCSSCVATVTKQLEAI
FT                   EGVSDVDVSLMTEECTVVFDPQLVAIEDIKETIDDCGFDGTVSSSEPVGGADSRAKYVD
FT                   LRLLGFNSKDDNELDQLTDKLRGFKQDNAGILDMALNTEDYCLSVHFDTQIIGIRKIID
FT                   ILESLGINAVVDVSFDKHTQLNLLTKASEIRYWKSACVKSCIVAFVTMVLYMGLPALFP
FT                   SLMKDKIFPYSSVGAVNGLYYRDIIGFFLASYVQFVIGATFYKSAWASLKHYAGTMDTL
FT                   VCFSTTCAYLFSLYSMTECIVSPPASGKLPKVIFDTSVMIVAYISIGKYLENKAKSKTS
FT                   TALSKLISLTPSSCIIVDKDDDSITQEIGIELLEVGDIAMVKPGAKIPSDGIVTKGISE
FT                   VDESLMTGETNLVVKEIGSVVTGGTINGSGLIYFEVTSVGDDTKLANIIKVMKNAQLKK
FT                   ASIQRYTDYVASIFVPTVLILSLLTFIVWTSLTRSEKIISKLSIFGETSESRFYMCLQI
FT                   ATSVVIVACPCALGLATPTAIMVGTGVASENGVLIKGGDVLEKFNEVNTFVFDKTGTLT
FT                   TGHMTVQQFVGNAEMIKNLFYLECIERAEALSDHPVSKAVVKYCRDLLGESFEGTSMII
FT                   EDEQLITGKGIKCTVKAADKTLRITVGNKSLMDEDSLGEFWQMYGRAGPCTVTYLAIDD
FT                   KVCGRFELLDEVKSDAKDVIRYLRNNNYEVFMVTGDTHKSAMKVAEMVDIPPNNVYSEV
FT                   TPDGKSQTVEYLREEGRVIAFIGDGINDSLALVTSDLGIAISSGTEVAIEAAGIVILND
FT                   PDTDEPTLKGVVNALDLSIRTFRRVKLNLFWALCYNVFMLPIAMGILVPWGITLHPMVA
FT                   GLAMAFSSVSVVVNSLMLKWWKAPELTSKNSHSSKGYGYYTKGTEQLNRLLGSASTGMS
FT                   DDTEIEIQDLELQPTSLSSQRTL"
FT   CDS_pept        complement(859796..860809)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000059940" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18501698"
FT                   /locus_tag="CAGL0M08624g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /function="ATP binding"
FT                   /function="tryptophan-tRNA ligase activity"
FT                   /biological_process="tryptophanyl-tRNA aminoacylation "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAG62696.1"
FT                   /db_xref="GO:0004830"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006436"
FT                   /db_xref="HOGENOM:HBG003090"
FT                   /db_xref="HOGENOM:HBG293263"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002306"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniParc:UPI00003B714E"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJ74"
FT                   /transl_table=1
FT                   /translation="MVQPTGKFHLGNYLGATRVWKDLCDIKQPGQRLIFGVADLHAITI
FT                   PKPDAAQFKQLRREAIASILAVGVDPARASIMYQSAIPAHSQLYWLLSTVAPMGYLNRM
FT                   TQWKSKSNLREDKDATAKELGEVKLGLFGYPVLQAADILLYKATHVPVGDDQVQHLELT
FT                   RTLAENFNKLYKKQVFPLPRTLLAPTKKILSLTHDTKKMSKSDPNQDGVIYVNDPPETI
FT                   IRKIKKARTDSITDKFYYDPVHRPGLSNLINIVSGITKQPVHAVEQELQKFDNYRDLKA
FT                   HVSEVIIEELRVPREKFHQYMEDPQFLDDTVQQGTQRASEIAASTMKETMQTMGFI"
FT   CDS_pept        861488..862501
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000208901" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17440082"
FT                   /gene_name="CIA1"
FT                   /locus_tag="CAGL0M08646g"
FT                   /product="Probable cytosolic iron-sulfur protein assembly
FT                   protein 1"
FT                   /cellular_component="cytoplasm"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG62697.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="HOGENOM:HBG051997"
FT                   /db_xref="HOGENOM:HBG520580"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="UniParc:UPI00003B714F"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FJ73"
FT                   /transl_table=1
FT                   /translation="MPLQLAKSLKLHNDKVWSIDFEPVRGLLATGSTDRAIKVLQLKNG
FT                   KENLLDVLDDTVHKKAVRSVAWRPHSDLLAAGSFDSTISIWTQSDLDLEEGAKLEMELL
FT                   AIIEGHENEVKGISWSQDGCLLATCSRDKSVWIWETDEAGEEYECISVLQEHSQDVKHV
FT                   VWHTKHNLLASSSYDDTVRIWKDYDDDWECAAVLTGHEGTIWCSDFSKEEDPIRLCSGS
FT                   DDSTVRVWKYIGDDEDDQQEWVCESTLPNAHRSQIYGVAWSPSGRIASVGADGVLAVYK
FT                   EKQNDSEVSEWEISATYKAAHTVYEINTVKWVNIDGKEMLITAGDDGRVNLWNYQD"
FT   CDS_pept        862981..864954
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248301" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18501699"
FT                   /locus_tag="CAGL0M08668g"
FT                   /product="Similar to uniprot|Q05580 Saccharomyces
FT                   cerevisiae YDR266c"
FT                   /function="zinc ion binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAG62698.1"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG192102"
FT                   /db_xref="HOGENOM:HBG398572"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="UniParc:UPI00003B7150"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJ72"
FT                   /transl_table=1
FT                   /translation="MSSEQQQNGSKPKNRNFRRTQTGGRSNGESGNGRKAKKITGNPDF
FT                   LQKEIKSGKKSNIEKKVEEFNAREEDDDTELCIICARVLVYASLSPCNHTTCHVCSFRQ
FT                   RALYEKKSCLICRTENDRLTFTDNIDAQYSEITDFSGSDDKFGIDFTSDEVKNATLDLL
FT                   KYACPLCPDNEQHVSTTYKKYNEHLKSAHNRMICLICAGNKHSFPREMKIYTANQLKNH
FT                   HSRGDSEGFKGHPMCAFCTGKRFYSDDELYIHMRNDHEKCHICDRIDHTQPQYFKDYEQ
FT                   LFEHFRTSHYVCTVQSCLDDKFVVFKDDMELQAHILKEHGDILRGKPKFFQSELSTFIS
FT                   APSQVIRERDSYNYDMGSVGSSNIEESSNPEVNRLRMNERAKHYLNSSLEGFQKFETLN
FT                   ENYDSSVLTASQLVQEYKKLFTDTHADIYLLVHNLSALYPKNSKKFKDLDVIYQEYEQT
FT                   EKRKNALPSLLDDHIQTVPGGAWGSSTGRSKSHSSIKNLNQLPSLGGVSSSFDPFKNPN
FT                   KAPVYKGLRQSPKPVVSATQRQTPMRISARPTASNRVEFNGGSTTKAATPSWGSQPSSN
FT                   SSSKNKLADLNLPTLPAPKPKVYIPPVHEPVIPDPKKWGQKGEPAPQLTEEQQLLESLN
FT                   LNGNSKSKKKGKQKQLLFHIGV"
FT   CDS_pept        complement(865182..866168)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000180194" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21045131"
FT                   /locus_tag="CAGL0M08690g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /function="zinc ion binding"
FT                   /biological_process="peroxisome organization"
FT                   /cellular_component="peroxisomal membrane"
FT                   /protein_id="CAG62699.1"
FT                   /db_xref="GO:0005778"
FT                   /db_xref="GO:0007031"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG059227"
FT                   /db_xref="HOGENOM:HBG717253"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR006845"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR017907"
FT                   /db_xref="InterPro:IPR018957"
FT                   /db_xref="UniParc:UPI00003B7151"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJ71"
FT                   /transl_table=1
FT                   /translation="MVEEDRRWKLPFAGAPSIVQAHQKDEQIETMLSVKVSELLRGVRG
FT                   QLFINNYQKEISVVVKLIYLGLTTALSRRTLGEEYVDLIYVNKRGSQLVRGIKRVLFVL
FT                   SYTSIPYLVTKLSKKVNNRSTNNEESDDGNESTYTDILSTMIDLHLMVFYITGTYYDVF
FT                   KRFWGMRYALGHTLSQEEENYRDKSSKSYKILGYIILLQHISKVKPIINKVLSILPQTK
FT                   ETLNAGSNGVGLKEGFAPAATPGLLTDVPENFNIDHIKLSNGKELAFIPTESRNCILCL
FT                   MEMTDPSCLPCGHVFCWDCITDWTKENPECPLCRQRSYPQQVLALRA"
FT   CDS_pept        866454..868745
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000033883" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19349523"
FT                   /gene_name="AKR1"
FT                   /locus_tag="CAGL0M08712g"
FT                   /product="Palmitoyltransferase AKR1 "
FT                   /EC_number="2.3.1.-"
FT                   /function="acyltransferase activity"
FT                   /function="zinc ion binding"
FT                   /cellular_component="Golgi membrane"
FT                   /cellular_component="early endosome membrane"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAG62700.1"
FT                   /db_xref="GO:0000139"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0008415"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0031901"
FT                   /db_xref="HOGENOM:HBG059226"
FT                   /db_xref="HOGENOM:HBG395499"
FT                   /db_xref="InterPro:IPR001594"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniParc:UPI00003B7152"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FJ70"
FT                   /transl_table=1
FT                   /translation="MEDNSEQASVSSQASMRPLVSDNGDREAGAGVEVNIANDNDTSVG
FT                   VDGENGNEDDDPILSKYHNACQRGDLEVVREMIHGGQVNVSSDADREGVTGLHWAAINN
FT                   RLNVVDFLVREGANVESKAGALEATPLHWAARYGFVYVVDYLLQHGASATTTDKQGFNL
FT                   LHLSVNSSNIMLVVYVLFFVVSKGIIDIDYVDPKGRTALLWAAYQGDSLTVAALIKFNA
FT                   SVKIADEGGFTPLHWGTVKGQPHVLKYLIQDGADFFQKTNDNKDCFVIAEEMSNTHSFQ
FT                   EALRHNNFDKNGYPINKLVKRDDHAKIITFLIPLLVLGFAFFGFSHLHILFALPVIILL
FT                   LLASNKFIKSFLLPSYETKGTNSASLLKSPLIAGILFGSIFWLAFVWILRILPYTFTKR
FT                   PLGNLTFCAILCFVCYSLFLLAFSDPGHIGSENDHEKIRETISNLLKEGKFDTRSFCLE
FT                   TWVRKPLRSKYSYLNDALILRFDHYCPWIYNDVGLKNHKLFIFFILALELGIFSFVKVC
FT                   LKYFDELDMDGDCFILGDDDLCSGLIGDRFTFLIMTWACIQAVWIFSLVIVQLFQITKG
FT                   LTNSELNALIREGRRVDIDSQTHNEFFNTVPEGFINNKDTEEEAAPPVRNNTNERISTT
FT                   FSGNLPKPRTCMGMICAVTGLHQCVAIIKDTFGIARHGSSRSTNTRSLLSSISTDYGWR
FT                   RNWCDFWLLSDTNTPLWKRIFFSPPSTKALLNGKEADYATLYEVPNKNHGSVSQLQELQ
FT                   DPLSEIDDMV"
FT   CDS_pept        complement(869007..869768)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000065942" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20196346"
FT                   /locus_tag="CAGL0M08734g"
FT                   /product="FAS1 domain-containing protein CAGL0M08734g "
FT                   /cellular_component="vacuole"
FT                   /protein_id="CAG62701.1"
FT                   /db_xref="GO:0005773"
FT                   /db_xref="HOGENOM:HBG059223"
FT                   /db_xref="HOGENOM:HBG203230"
FT                   /db_xref="InterPro:IPR000782"
FT                   /db_xref="UniParc:UPI00003B7153"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FJ69"
FT                   /transl_table=1
FT                   /translation="MVALKYVLVPVALVAAKNIVEMITFRDENGKLHRRLAPEEYRGGV
FT                   LDGEESRLLQKRDLEMHPPVDLGVYFSNRPIHRTIDVPDIYLDSQISVLTELDIFASYS
FT                   RNDEKSYDMFRDPESDLIVIAPTNAAITALAKKPWQFPMDIDTMEQAGSSERDIDNAIH
FT                   NNIVNFVRSHVVAYQKDTKTSKDGTVLLQSKQYSMQHSNGKGGDVLLKREGEKYCVASV
FT                   VDEVFHDVQNIYSTKNGVILVIDATLSRPGA"
FT   mat_peptide     complement(869010..869720)
FT                   /locus_tag="CAGL0M08734g"
FT                   /product="FAS1 domain-containing protein CAGL0M08734g "
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FJ69 "
FT   sig_peptide     complement(869721..869768)
FT                   /locus_tag="CAGL0M08734g"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FJ69 "
FT   CDS_pept        870824..872533
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000114462" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17440083"
FT                   /locus_tag="CAGL0M08756g"
FT                   /product="Similar to uniprot|P52911 Saccharomyces
FT                   cerevisiae YDR261c exo-beta-1 3-glucanase "
FT                   /function="actin filament binding"
FT                   /function="cation binding"
FT                   /function="hydrolase activity, hydrolyzing O-glycosyl
FT                   compounds"
FT                   /function="protein binding, bridging"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /protein_id="CAG62702.1"
FT                   /db_xref="GO:0004553"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="GO:0030674"
FT                   /db_xref="GO:0043169"
FT                   /db_xref="GO:0051015"
FT                   /db_xref="HOGENOM:HBG176634"
FT                   /db_xref="HOGENOM:HBG735468"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR018087"
FT                   /db_xref="UniParc:UPI00003B7154"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJ68"
FT                   /transl_table=1
FT                   /translation="MLHLFVVIFLALGVLGYDNSGLTTDELQSLQKRFQDYYNDGEVQV
FT                   KGITIGGWLVTEPYITPSLYETAFTHVNKTLNGTNSTTFQNSTFGNYSIVDEYTLCKEL
FT                   GYQNALTLLKDHYETFITEDDFAQIKENGFNLVRLPIGYWAWKKNSNDTSRYNYVGNIS
FT                   YDDPYVSEGLQLQYLLKAIDWASKYELNVWIDLHGAPGSQNGFDNSGQRILYDDLGWLH
FT                   ADKTKPLTLAIWKDMFEKFVRTNNYNGYNTSSVVGLEIMNEPLGPKIGMRNIAQSYYEA
FT                   FDMFKTAEAENNNPQNDNLTFVIHDAFQSIGYWNLHLNPDYRNVSNQYYNLTNVTYNSQ
FT                   SVLVDHHHYEVFTDFQLKNNQYNRIMDIINYGDSISKELDFHPAVVGEWSGAITDCARW
FT                   VNGIGIGARYDGSYYKTTAFQSDSPPNGTCISQNDISTWSESYKTRVRQFIEAQLATYS
FT                   AKTTGWIFWNWKTENAAEWDYLKLKENNLFPQPFDNFTYFNKDGQINSSFSTSLSIEAF
FT                   GSPTSSRVSSTKHKNFAISTKMRTSITGSSNNNTWMYFLSAALGMLAVCCVM"
FT   CDS_pept        873232..873642
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18501700"
FT                   /locus_tag="CAGL0M08778g"
FT                   /product="Similar to uniprot|Q12379 Saccharomyces
FT                   cerevisiae YDR260c"
FT                   /protein_id="CAG62703.1"
FT                   /db_xref="HOGENOM:HBG124109"
FT                   /db_xref="UniParc:UPI00003B7155"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJ67"
FT                   /transl_table=1
FT                   /translation="MTYNNSHFNYHHLNRSHYVLYSEWNKDEFPNPTRTALGSRLEGPS
FT                   KDSANPNDLKIDDEYWDNYLEEEDYQLFKNAKLESNGVVTFTIANLSLPLPSQNTALEV
FT                   HNEESSTLTGSIFVRDGRVIAKAKHRQLTGGL"
FT   CDS_pept        878328..879119
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18501701"
FT                   /locus_tag="CAGL0M08800g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /function="protein dimerization activity"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="sequence-specific DNA binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /protein_id="CAG62704.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0043565"
FT                   /db_xref="GO:0046983"
FT                   /db_xref="HOGENOM:HBG124111"
FT                   /db_xref="InterPro:IPR004827"
FT                   /db_xref="InterPro:IPR011616"
FT                   /db_xref="UniParc:UPI00003B7156"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJ66"
FT                   /transl_table=1
FT                   /translation="MGQVNMRPSLASQPAHYQLPSIAPNIHPHQYTTSQPPHQQHYHVV
FT                   HTPISRISSENGQQQHMMPPSMNPTAYQGPEQVIIDHGIPTFQYAHQPQHVLRSSIMTG
FT                   ANMSPGQPQPQTIVMGPQPIQHAIDGHLASQTIATPMGTTLLTSSAQLQGQKTKKNTKR
FT                   AMQNRKAQKAFRQRKEQYIKLLENEAKLIDDVMKKNQDLTSENEQLRDCLNRLIEKLKD
FT                   NGIEVDIPSDFLDKINASISASRRLQEQHEEISKSIAGEKS"
FT   CDS_pept        880145..882508
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000218211" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17440084"
FT                   /locus_tag="CAGL0M08822g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /function="ATP binding"
FT                   /function="nucleoside-triphosphatase activity"
FT                   /protein_id="CAG62705.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0017111"
FT                   /db_xref="HOGENOM:HBG229122"
FT                   /db_xref="HOGENOM:HBG413133"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR013093"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="UniParc:UPI00003B7157"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJ65"
FT                   /transl_table=1
FT                   /translation="MLSRVCRSSLRNSVARVSRYAGPRALALSMVVSGRQVSGSWQTCA
FT                   YGVRYIHSSRPRYVQMRMNPNQGEPEKPPLEQFGTNLTKLARDGKLDPVIGRDEEISRA
FT                   IQILSRRTKNNPVLIGRAGVGKTALIDGLAQRIVAGEVPESLKDKELVALDLGALIAGA
FT                   KYRGEFEERLKKVLEDIDKADGKVIVFIDEVHMLLGLGKTDGSMDASNILKPKLARGLR
FT                   CISATTIDEFKIIEKDPALTRRFQPILLNEPSVQDTISILRGLKERYEVHHGVRITDTA
FT                   LVSAAVLSNRYINDRFLPDKAIDLVDEACAVLRLQHESKPDEIQRLDRAIMKIQIELES
FT                   LKKETDPVSIERKEDLEKELERKNEELQRLTKIWEEEKAEIESIKNSKADLEKARIELD
FT                   RCQREGDYAKASELRYAKIPALEEKVKLSETKDSNKENLLHDAVTSDDISKVIAKMTGI
FT                   PMETVLKGDKDRLLYMENSLRERVVGQDEAIEAVSDAVRLQRAGLTSEKRPIASFMFLG
FT                   PTGTGKTELTKALAEFLFDDESNVIRFDMSEFQEKHTVSKLIGAPPGYVLSESGGQLTE
FT                   AVRRKPYAVVLFDEFEKAHPDVCKILLQVLDEGKLTDSLGHHVDFRNTIIVMTSNIGQD
FT                   ILLSDTKLDDEGKIDPSTRNEVIEAMKRSYPPEFINRIDDILVFNRLSKKVLRSIVDIR
FT                   AKEIQERLNDKRMTIEISDTAKEWLTEHGYDQLYGARPLNRLIHRRILNPMATYLLKGQ
FT                   IRNGETVQVDVENKELVVKSNHAEGEIVDEEPEK"
FT   CDS_pept        882940..884472
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000247886" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20196347"
FT                   /locus_tag="CAGL0M08844g"
FT                   /product="Similar to uniprot|Q12504 Saccharomyces
FT                   cerevisiae YDR257c"
FT                   /protein_id="CAG62706.1"
FT                   /db_xref="HOGENOM:HBG058928"
FT                   /db_xref="HOGENOM:HBG397373"
FT                   /db_xref="InterPro:IPR001214"
FT                   /db_xref="InterPro:IPR011383"
FT                   /db_xref="UniParc:UPI00003B7158"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJ64"
FT                   /transl_table=1
FT                   /translation="MADNYTETTTEYVSWLTNNGVKISPKLKVEDNRYKDEGRCVVTTT
FT                   DIQKDELLFEIPRNVLLNCETSQLVKDIPAVLTELETFSGSEPLSWEPLILCLFYEMYI
FT                   LKDKSRWWPYFEVLPTLEDMNVLVLWSDEDLAALEPSYVLSCIGKEQVENMYQLLKRFI
FT                   EASDHEQLKSNLNKFSWDSFIRIGSLIMSYSFDVGKEIHNEGKEGESMNENDNMTNGDE
FT                   DEDEDEEDLEVEMIKSMVPLADTLNADTKKCNANLLHSKQTLRMIAIRDIPSGEQVYNT
FT                   YGELSNSELLRRYGYVEWDGSYYDCGEISKSAIHKSLLQLFPTSTETLERLDAVIDENE
FT                   KVLDLFDDDTIVEDTYIFESDGEIPFKFLFYIQLMALLLQNSRIEKMGPIALNKCMAPT
FT                   IDKTSKILQEQKVTRKALDVLNDSLDTRMKQYEQKITDSGEDSLEPPSHEASTKEKRMR
FT                   MVKMILLSEYKSLRKCSEVIREEFGPLSDSDVLSEIKQSKEEKRPKKRAKTR"
FT   CDS_pept        884842..886491
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248734" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19349524"
FT                   /locus_tag="CAGL0M08866g"
FT                   /product="Similar to uniprot|Q03370 Saccharomyces
FT                   cerevisiae YDR479c"
FT                   /protein_id="CAG62707.1"
FT                   /db_xref="HOGENOM:HBG058927"
FT                   /db_xref="HOGENOM:HBG397266"
FT                   /db_xref="InterPro:IPR010482"
FT                   /db_xref="UniParc:UPI00003B7159"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJ63"
FT                   /transl_table=1
FT                   /translation="MDSVTNFFWNDTYGRGSASTIDTVGSDSNDKDKNTNGTPTTNRHN
FT                   RRFSNSLEKMNSRDSGSNVQGSFANTAFSTSGGLQKAMTDTLVEKIIKMAIPASSELAA
FT                   NTIKNRMAAGKERPSLSVPITSRNFILMNSRLSVPFLVIDEIIKILNWVDPAYTLSMAL
FT                   IYTLIVLRPLQVLSSLPILYLLFGIMVPEYLHIHEPSENVYLDTNRVPAQGPPLRKAEV
FT                   PKPVPEFSQEFVLNLTDLQNHMLLYVQLYDSIIYVLQKFAFFVNEQISAVAFVLLMILA
FT                   VTNIIFIDVLVRIIPIKLILVATGWAFIIICHPKYRDNFFNKVNSEETRLRLLKLTSSY
FT                   DDWVNDNLGYVEARETKVVIIYEMQKYKDKHKEWHPVGYANDDFTLFSQFRINENAIES
FT                   VAVPSLDSISPPTGWEWAENSSWVLDLDPTGWVEEGFIQFVQIDPETKWVYDINLDGKR
FT                   GKYRRRLWTNTCVRQIHAGVDERNASDKLREVSNPLRSDETHSRSIHGVSKGSMSGNVK
FT                   TEADIEENAFTDEDDSHITDDSIASNILNTTI"
FT   CDS_pept        complement(886536..887063)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000142065" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17440085"
FT                   /locus_tag="CAGL0M08888g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /protein_id="CAG62708.1"
FT                   /db_xref="HOGENOM:HBG124112"
FT                   /db_xref="HOGENOM:HBG203317"
FT                   /db_xref="InterPro:IPR007175"
FT                   /db_xref="UniParc:UPI00003B715A"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJ62"
FT                   /transl_table=1
FT                   /translation="MNRDQKIQFRDKQIRHKYALLHAMPTIDVPELSGMYLKNFYNSVK
FT                   RYQLNLPDHIVQPDKKFCGECGYIQIPDHSVDINIISGERPEISSIAKFKCKKCGHHYD
FT                   ETVLCRKQKVADSANISKDIGQVKKKTNNAKMRAKMRKQNSLTSLLSKKDKEKKDVTKS
FT                   ASMLSLDSFMKR"
FT   CDS_pept        complement(887703..889541)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000233016" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17440086"
FT                   /gene_name="SNF1"
FT                   /locus_tag="CAGL0M08910g"
FT                   /product="Carbon catabolite-derepressing protein kinase "
FT                   /EC_number="2.7.11.1"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="carbohydrate metabolic process "
FT                   /biological_process="protein phosphorylation"
FT                   /cellular_component="nuclear membrane"
FT                   /protein_id="CAG62709.1"
FT                   /db_xref="EMBL:AAB48642.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="GO:0031965"
FT                   /db_xref="HOGENOM:HBG537393"
FT                   /db_xref="HOGENOM:HBG755340"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR013896"
FT                   /db_xref="InterPro:IPR015741"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="InterPro:IPR020636"
FT                   /db_xref="UniParc:UPI00003B715B"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q00372"
FT                   /transl_table=1
FT                   /translation="MENKEHHHHHHHHHHHHSNGSYVSNKVSSLADGSRVGNYQIVKTL
FT                   GEGSFGKVKLAYHVTTGQKVALKIINKKVLAKSDMQGRIEREISYLRLLRHPHIIKLYD
FT                   VIKSKDEIIMVIEYAGNELFDYIVQRNKMSEQEARRFFQQIISAVEYCHRHKIVHRDLK
FT                   PENLLLDEHLNVKIADFGLSNIMTDGNFLKTSCGSPNYAAPEVISGKLYAGPEVDVWSC
FT                   GVILYVMLCRRLPFDDESIPVLFKNISNGVYTLPKFLSPGASDLIKRMLIVNPLNRISI
FT                   HEIMQDEWFKVDLAEYLVPQDLKQQEQFNKKSGNEENVEEIDDEMVVTLSKTMGYDKDE
FT                   IYEALESSEDTPAYNEIRNAYILIKDNKSLIKDMKQDNNVTQELDTFLSQSPPTFQQNG
FT                   DGMKASEDQKKKHSGRRLASSVTQQRTFHQPPFMDQSKEEDSTISILPTSLPQIHRANM
FT                   LAQGLPAASKISPLVTKKSKTRWHFGIRSRSYPLDVMGEIYIALKNLGAEWAKPSEEDL
FT                   WTIRVRWKYDSDESRLIEDGVKKIPNLMKIVIQLFQIETNNYLVDFKFDGWESTYGDST
FT                   ISTNMSEDEMSTFSAYPFLHLTTKLIMELAVNSQGN"
FT   CDS_pept        889916..890548
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000001070" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17440087"
FT                   /locus_tag="CAGL0M08932g"
FT                   /product="Similar to uniprot|Q03362 Saccharomyces
FT                   cerevisiae YDR476c"
FT                   /protein_id="CAG62710.1"
FT                   /db_xref="HOGENOM:HBG124113"
FT                   /db_xref="UniParc:UPI00003B715C"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJ60"
FT                   /transl_table=1
FT                   /translation="MDAADIAKWNTERAHNLKDILCVYGKVKQRPYAVKLQGVDAQAME
FT                   LNFKNHESDTQMTKFVDIRDQLEGVSPDYNEVVMSLARQSARKLNKSFNKLDKVLYPCG
FT                   VADLLVILAVLLPPLCYLYRPLLHWLFPPQVPVLGQLGQLVDSDYRLLAVIVLEFAIHA
FT                   GEVYLGLWPLLHYYRITESPDLLIEYTLFGLLEGYGPIRRLKSLQWD"
FT   CDS_pept        890764..893316
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000113132" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18501702"
FT                   /locus_tag="CAGL0M08954g"
FT                   /product="Similar to uniprot|Q99248 Saccharomyces
FT                   cerevisiae YOR019w"
FT                   /protein_id="CAG62711.1"
FT                   /db_xref="HOGENOM:HBG203315"
FT                   /db_xref="HOGENOM:HBG429321"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniParc:UPI00003B715D"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJ59"
FT                   /transl_table=1
FT                   /translation="MEQDESLRSFYRRVKVYRRSVGDGEPGLGGDIGNLDSRLCESESA
FT                   LSGNDSLEPGTPVLDAVDGRKKQRSVSVRANAKVRPCVSFNTVPLPSKHTLLDEYEQDF
FT                   PGVQLFPQEYTMEEYYDDESGYVSEDNQNYMLHNSYITPEIVERLNKNATTRSSSPPPL
FT                   DREYPSAGKQKKMSSKQQANITKMFKIAKNGRIVREDYPSRPTLVNDAFILNRDLNDWH
FT                   NTWRSRRHTIEQRKEDLSETFEYPQLLFPQQTKPSEPVIMMGEDYKPLTKEQRKKEKII
FT                   HKKIESTSGPRVVLCHISGKRHTWVGLDWTIKRLSNDGDHIVVLAHIPRMISSRRLITS
FT                   ASASRSRSRTRSRSRDVNRKAYNKGDYEASAFSLGQDNNENLNKHEDFVEWASGYSQED
FT                   VETTMENIFDYIANILPEERSVKITVEVVVGAALHTIIDATNAYQPDLMVASTLRWERT
FT                   DNLVLWKSNLLIDKLATVFPLPLFVVPARRMFLFEHGLEEESKQIEISLEKENIEMEKE
FT                   NNVTGDIVESEADKKIVPPKRIGTIGPPERRLVGADSFTAGFNMKRPSLGTSVSAPIAE
FT                   NVFEEESGSETGSDVDSELSDLSSDEGNDKLTVREKLHLKARSYRLQTAQYLKDLDNNK
FT                   SISHEEIQIKKVETIINQTIKFSLAIEDLGSESDDDDDVGLTKLKRVITGGAVLNPQSG
FT                   SKKSMLSVLDNPKTTRKKKSLSATTSGVSGNRVPRSSQIKFASSVKHKDGNNALGNSVV
FT                   HTKPQIQVHAASEDSSPKLTPIRSYNTGSSNQAGLKTMKSNNSLRRVKSNDSSRISQSS
FT                   KKSSSSTSSGGFMSLFKGKSKERSESPSSKRKSGLKFW"
FT   CDS_pept        893866..895236
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000205412" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18501703"
FT                   /locus_tag="CAGL0M08976g"
FT                   /product="Similar to uniprot|Q03338 Saccharomyces
FT                   cerevisiae YDR473c essential splicing factor "
FT                   /protein_id="CAG62712.1"
FT                   /db_xref="HOGENOM:HBG058922"
FT                   /db_xref="HOGENOM:HBG396175"
FT                   /db_xref="InterPro:IPR010541"
FT                   /db_xref="InterPro:IPR013881"
FT                   /db_xref="UniParc:UPI00003B715E"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJ58"
FT                   /transl_table=1
FT                   /translation="MPPKNTTSRKPRSGRGLDVELHPALASSNANIIKAQQKQVNPYLS
FT                   DIGQQNGKVFKKYKDGLRFYKKGEISAQLHKEREELARRLKEEELRAAAEKAHRVSLAE
FT                   QKRERIANAEIPDDSIGEELYMQRFKDIPNYEWWDESYLDKSGNILPKYTTEYPEDMDS
FT                   DYDSDDMNSGVECMKSQTEETGPPSIRYVQHPVPIKIPEEITAPKMYLTKLEHKKARRR
FT                   NRKLQREEKMAKVQLGLEPKPETKVKLSNMMNVLDNNKNISDPTAWENMVKDQIEERRQ
FT                   RHIQENEKRHEEAVLRKKSKVSDQIEGSEDLFCKAFYFQSLQNPKIRYKLKMNSQQLNL
FT                   KGFCLRVGEGGPGIIVVIGKEKSCNFYKKLVCTRIKWNENFKIKDATNNGELIDMTGNY
FT                   AVEIWDGLLKETKLRNWFMKICQTEDEMKNILQQNDALSFFNLFIENKAENTNLSQQ"
FT   tRNA            895492..895573
FT                   /gene_name="tRNA-Ser (AGA)"
FT   CDS_pept        complement(896312..897358)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000168307" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21045132"
FT                   /locus_tag="CAGL0M09020g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /function="binding"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="mitochondrial inner membrane "
FT                   /protein_id="CAG62713.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0005743"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG541806"
FT                   /db_xref="HOGENOM:HBG735918"
FT                   /db_xref="InterPro:IPR001993"
FT                   /db_xref="InterPro:IPR002067"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="UniParc:UPI00003B715F"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJ57"
FT                   /transl_table=1
FT                   /translation="MSSSKKKSSNPVVNLVAGGTAGLFEALCCHPLDTIKVRMQIYKRQ
FT                   AAPAAAAVASMAGGAGGAATATVGGGDATAAIKPPGFIRTGRNIYAQEGFLALYKGLGA
FT                   VVIGIIPKMAIRFSSYEFYRTLLADKQTGVVSTSNTFIAGVGAGVTEAVLVVNPMEVVK
FT                   IRLQAQHLNPNHDLAKPKYTNAVQAGYTIIKEEGISALYRGVSLTAARQATNQGANFTV
FT                   YSKLREFLQEYHGTETLPSWETSCIGLISGAIGPFSNAPLDTIKTRLQKDKSTSFKGES
FT                   GWKRIAHIGTQLLKEEGFRALYKGITPRVMRVAPGQAVTFTVYEFVRRHLENLGVFSKP
FT                   TPKPKKLN"
FT   CDS_pept        901459..902817
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17440088"
FT                   /gene_name="ime1"
FT                   /locus_tag="CAGL0M09042g"
FT                   /product="Putative meiosis-inducing protein IME1 "
FT                   /protein_id="CAG62714.1"
FT                   /db_xref="EMBL:CAD59555.1"
FT                   /db_xref="HOGENOM:HBG124114"
FT                   /db_xref="UniParc:UPI000006CBE8"
FT                   /db_xref="UniProtKB/TrEMBL:Q8J0L9"
FT                   /transl_table=1
FT                   /translation="MNNSCPGVTEKDKFIIRRNLILFDEDEEFKRLTDIRSSYIPLSRA
FT                   MHSSSPNFKEAKVASRGCKTYRQSEDINGDNSHEISTLNNYFFDGGNPHPTTNNTIKLA
FT                   TNWDDTDKYINFSVCEELTPVTDYKNCIIDQDPLLLADSPLNMSVSTDMIDNDLGSAYS
FT                   ELDFHSNYDFEDYSISYDNNYRGDYFNDSTEDVSPNFSKSTNYTSKLPIEIIHTQPHKL
FT                   INPKILSTTFDIELSSFINEETYLLSSKYSEASSFSSIFSYDIDNIQNIASITNSSGEL
FT                   MKEANFCNEQNERDSVVTIKLETKNNKKTTKYSIKKETHFPIPDQHKFNDNIEYYYYFD
FT                   PDEGNPIILPEYPPLRTYEVSTGFKKKKRINKEPKPVIKTKKSQANSYVHRTSKNRIRK
FT                   SKDSKSNKEFFTSLLSKLDRYCVNAYGRRSRNQEYYDKVRFQEILYKFSKTYF"
FT   CDS_pept        903560..904543
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000000819" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17440089"
FT                   /gene_name="FIP1"
FT                   /locus_tag="CAGL0M09064g"
FT                   /product="Pre-mRNA polyadenylation factor FIP1 "
FT                   /biological_process="mRNA processing"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG62715.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006397"
FT                   /db_xref="HOGENOM:HBG060034"
FT                   /db_xref="HOGENOM:HBG272188"
FT                   /db_xref="InterPro:IPR007854"
FT                   /db_xref="UniParc:UPI00003B7160"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FJ55"
FT                   /transl_table=1
FT                   /translation="MSSSEDEDDKFLYGSDNEEPKNEKKRPREAAEDDNEGPTSDKVVS
FT                   QHNNDLKRPKLAKDSLANASSDEEESGSESDSDIEFIISTGPDPHRLDSSTVPGSNNAI
FT                   VTVSEGANVGGETMSKSTATATTAEISTLNALGDTEVAGTSELDNETLGPETTTKSGTS
FT                   AEGIDLDKEGLYNDEPVSTIDPEVLKEKPWRQPGANISDYFNYGFNEYTWMEYLHRQEK
FT                   LRQEYNPRRILMGLMTLQQQGRLDQPQGGHQSMPDNMAINNPQPTNNDNMMHKPTPPLP
FT                   NFPMPPMFGGFSPFMPPGMMAPMNRMPNQNQNQGQNQNQNQNQLSK"
FT   CDS_pept        complement(904879..909219)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17440090"
FT                   /gene_name="BUD4"
FT                   /locus_tag="CAGL0M09086g"
FT                   /product="Bud site selection protein 4 "
FT                   /biological_process="cell cycle"
FT                   /biological_process="cell division"
FT                   /cellular_component="cellular bud neck"
FT                   /protein_id="CAG62716.1"
FT                   /db_xref="GO:0005935"
FT                   /db_xref="GO:0007049"
FT                   /db_xref="GO:0051301"
FT                   /db_xref="HOGENOM:HBG124115"
FT                   /db_xref="InterPro:IPR001849"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="InterPro:IPR012966"
FT                   /db_xref="UniParc:UPI00003B7161"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FJ54"
FT                   /transl_table=1
FT                   /translation="MEAETTVDSLLKEIDMEMEMQSGNDVAQSNGYLLPLQEIGDETMD
FT                   MLVQYNTENNANSNVNANANANANQWNKVDDPQDLLPMENNYDDDEEQGDESDTTNLLS
FT                   GNKHLTEEESEQVLVDSKNLVLPPSSSKSNLINNLKQVVEDEVSDSQLSNDMDDTRTLN
FT                   FSVKGTEPLLADELQDKEPDMIEVSTIYDGPDMISMADDSDTEDIDLLSKAKKPVSPSK
FT                   IPITNAQTINYFKDAPVEDAKLQTVPDDIPLETKQTTVSNDILSNVETLLPPTLERPSF
FT                   VISNLKEASQSVENLGFPDYEEDSQSEQETSVLHHTPTDFHAHEFEVFATELPDINVTP
FT                   SIKPIDIDNNCEHENRLVSEEESKGVISSVPENENLPAVKSNPSSNSISDMLEIRQENK
FT                   LDETLNMIDHQLSSNKSIDSVKTVSDNNISKSANDGSVEDVADSGKETSDIARNIEESH
FT                   NSLINLTSGNNFDQSMHNDLIEESNTRVNVTESDITASEDSFNGSHDQNSSLNNLTKND
FT                   NGIQQNLEDNHTGIQPEMVVPEEVTTTLPEVNILPASENMLENTSESEISVQFLQNRDN
FT                   EDKVSSDPQLEENIRSTETVMNTQETFEPKPAKKNQYTDREIEVLNSQKDISEATDNSA
FT                   VNSRISSSASNFTPVLPPLPKLEKLSIDDPFDDEFETSNESMQMKNSVKPTDYLSIWHL
FT                   QEQTTKAVSPALSSNSQFSYNSNSTKSSVASPVPATAFKFKPKIVSRSKYYYPDNNIQQ
FT                   EQSMDFIYTKLPSILDPMRRNTINSKKIRQTVIDKRKSHPSFSVDEGNTITEVNIEPEV
FT                   KVQPISIENDSSSLKANNQDDNESCSSGSQAFVTPSATMDNFDSQFNELGTSFENDLEN
FT                   VLNYFDKDINTNTSSDLIEETTTKNQALPTSKVWSESVDYSLPTGEEPNVDHNIMKKLL
FT                   NTENSELNECRSDQEHHIIDNAGLGIWRSTANDIATGNVDMFALNGRDISISKSEMTND
FT                   IDMGIFSDKKSLVHTPELSPVKSTHVGSPFKVISPKKNTQKDLKDGTTAEKRVSSESEA
FT                   AQISIMSAVGEITNKDTAVVDDASNKDNIDAGQVGNEGEPIVDKGLLYLHLQGTTKLSL
FT                   AGINAHHPKYSIEFDNGKNVVRTDWTELDSRGTISLNKEFEIPIDQSINKLIITLMIKY
FT                   TRLTNELVEVTKRIPIGKKFPFGKMKYRTETQFVERSTVKDEWDYLFARDGSFGRCEIL
FT                   LDESLFEKIRFKEQDLSFDLLNKWSRLQNNSSSKVTQEALYDLPRRPAYKVGSLKVKGC
FT                   FLERVSNDEKFPVSLKKAKSIVEKYRSQQDITKEGYLLQEGGDLSSQMKNRFFKLNGVE
FT                   LVGYHEVSMKPKIRINMLKVVKVIGKDDVVTGKDNVRNFTTWVLMNDCFQLVFDDGEVI
FT                   TFSDESSLADEQSWYMKLKEVVELNAFHQPWVKRFSENMIINDI"
FT   CDS_pept        910473..913802
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000113136" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17440091"
FT                   /locus_tag="CAGL0M09108g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /function="RNA binding"
FT                   /function="nucleotide binding"
FT                   /protein_id="CAG62717.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="HOGENOM:HBG060044"
FT                   /db_xref="HOGENOM:HBG203961"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR001313"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI00003B7162"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJ53"
FT                   /transl_table=1
FT                   /translation="MEKKFTNIPEVIDPGITIPIFEEDVDAMSLEQPQKLGSYRARAGK
FT                   FSNTLSNLLPSISAKLHHSKKQGKGAGADPNASTPDSSESAIGNLSAKSSQMFMMNTDQ
FT                   GMPSMTAAVAADMGPPRPAHVEGFSARGAAQDNTTPPRDADKLVHFPESTEYLISRPRT
FT                   SNDSFGNNLPRQISRTRNNTMSSQITSISSIVPKPLPNTVWNNNDTVNQQYQQQQQQQQ
FT                   QQQQQMVPQINTYNAMDMGQQPNYGDTMNQQMGGNNLTVNNAWNSNRPRSHSNASSIYT
FT                   DAPQYDTVGRSRAASSYAHGNSNIPLVADEVDPRSLNWVTTDLLVPPINQISNLLPTNT
FT                   ISISNVFPLQQQQPHLNNAINLTSASLATLCSKYGEVISARTLRGINMALVEFDSVDSA
FT                   IRALDALQGKEVSMIGAPSKVSFAKILPMHYQQSNHTQQQNAQTTQAESVSQPLLQEQL
FT                   NNGAVTFHQQGNISIPVFNQNQYSNGQNTNNNASSHPGTSSSSDKEQCPFPLPPPPLSG
FT                   KKSELEQVVLQFNSDHDESQVASLINNSLKTKPTSDVNNFGPLPGSVSNKQFDAPKLRE
FT                   LRKAIDSNSLSDIEIEQLAIAMLDELPELSSDYLGNTIVQKLFEHSSDIIKDIMLRKTG
FT                   KYLASMGVHKNGTWACQKIITKATTPRQIKLVTDGIKDYCTALFNDQFGNYVIQCVLKF
FT                   GYPWNSFIFESILSNFWTIVQNRYGARAVRACLEAHDIVTMEQTLVLSAMIVIYAEYLT
FT                   TNSNGTLLVTWFLDTCVLSNRHSILAPRLVNHIVDLCRHRLASLTILKILNYRGDDAAR
FT                   KTILNTVFGNCETDEPQQILYQILCDVNYGPTFVYKVLSMPLLEDDIRIHIIAQVRKIL
FT                   MESNTAQHHRRLMEEVGLMTTGNNNNQTSNNKHRKNSSHTYVQDNNGHMRGVSVSSVRS
FT                   GGSRQTGLTPNIPQTFQMPSLPNTSMSTVVSGNMSLNQLPTQMQQQQQSGVLPQTVQQQ
FT                   QQQPMVGSNQNNAMSYMNYPGVFPMGYPNNNSSYGINDDLVSKLDMLTLGNGTHLSLPQ
FT                   LSVTNHENNTNYSNNNNNNNNNNNNNNNSNGNNNTNGGNPMNLMNSSLNNTQEFGGSSL
FT                   WN"
FT   CDS_pept        914811..918188
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000112822" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21045133"
FT                   /locus_tag="CAGL0M09130g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /protein_id="CAG62718.1"
FT                   /db_xref="HOGENOM:HBG059230"
FT                   /db_xref="HOGENOM:HBG202254"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="InterPro:IPR006553"
FT                   /db_xref="UniParc:UPI00003B7163"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJ52"
FT                   /transl_table=1
FT                   /translation="MDITNQNHSIDTPMPDTRPDIEFGFGYNAGTTRGGPSLASMQIQQ
FT                   GTNTHHQINNDISFNIGNNDTNSNDTNENIHVDSLRNNGNIQRFTAGDRLPNTIGNQSV
FT                   AMARSIPGSIESRNGFPQDGEALMDMSNVESIDYNAPAKIFADMDINRLFYDPNLSSLQ
FT                   AEDIIKLHNFKEVVHRKIENFIEVIQKRRERILKEIELGNQRLEGVDLETSVSAMTYLN
FT                   KLQRIRISALKSETMELQNLRIQIVSIVDEYKKAMAEYSKLNQEGRNAVNPTPYFQRWI
FT                   KSLNPEDISGLNKELIELQMYSKQLSDIPELASIEYQVSTPQTSQFPLRSLPSEILHLV
FT                   LDKITQKADIVNLLRVCKLWALIIVKILYYRPHINRKHQLDLFMRTMKLTKDETVFDYR
FT                   SMIKRLNFSFVGDHLHDEELYNFVGCRNLERLTLVFCKHITSDPVAAVLKGCKYLQSVD
FT                   ITGIKEIYDNVFDTLAESCKRVQGFYVPQAKLVSYNALTNFVSNAPMLKRIKVTANANV
FT                   NDEFLDLLAEKCPLLVEVDITLSANVHDSSLTKLFMKLTQLREFRITHNANVTDKFFLD
FT                   LSKNVNQLPSLRLLDLSGCENITDKTIDRVVQLSPKLRNIFLGKCSRITDLSLFHLSTL
FT                   GKNLQTVHFGHCFNITDRGVRALIKSCPRIQYVDFACCTNLTNHTLYELSYLSRLKRIG
FT                   LVKCSQMTDDGLLNMIALRGRNDSLERVHFSYCSNLTIYPIYELLMACPRLSHLSLTAV
FT                   PSFLRPDITAFCRPAPSDFSDNQRQIFCVFSGKGVHKLRHYLMSLTTPTDGPQIDVGDT
FT                   LEQYVISKHLLRPGEYLNDGIRRITSELNQDSAAILAATGLNQMNGMNSDFPFQNIDFE
FT                   RLDEVFNWINMSMDGHSLNSDELNDLISEVDRDFCDDPFDEDYNSRDSIVAPGANTGLN
FT                   SELCHIVKKFHRLDDQICDFEVNVSSLARVQFQFTGFLLHEMAQAYMNMVEINRQIWHI
FT                   QKTTLEAGVESDIKALLVWRILFIDKFTALLHKYQISTVVLRLYLKDSITLLTRQRELF
FT                   LAHQRTPWNPTIVEEAPDSNYWQLVGDRIQLLPEQMRVMPFGLRNPAIANNAQQNAAEA
FT                   QNDDRSETPEDDVAIEDF"
FT   CDS_pept        921030..921911
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000141855" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19349525"
FT                   /locus_tag="CAGL0M09185g"
FT                   /product="Similar to uniprot|P47133 Saccharomyces
FT                   cerevisiae YJR088c"
FT                   /function="binding"
FT                   /protein_id="CAG62721.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG058449"
FT                   /db_xref="HOGENOM:HBG202252"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniParc:UPI00003B7164"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJ51"
FT                   /transl_table=1
FT                   /translation="MRDLRREKLLTVMTTRAYTRFEPQELVQLYNELLMRMGKLERSSE
FT                   PNDVSLLEMYFYVCCYLGKDQEMSLVFQRLRDRFGESSPRVAVMKATMMEVEGNDSSAA
FT                   KQYLEGRLKELEYDADSVSYVMLSKKLLALKMRDLKKNPQQQLKETLALIEKFPLDPEL
FT                   QWVCSELYYSLKDLDKAIYCIEEVLVAMPFNYVAFARLSELLYYKYVREFQDKPAKRRD
FT                   TAALQQALDNALRSVELSELFLKGWSLVATISKELDKPQLLQLSKKKLQEISEVSNSND
FT                   ARIAKKFLQKMA"
FT   CDS_pept        complement(922042..922308)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000210889" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19349526"
FT                   /locus_tag="CAGL0M09207g"
FT                   /product="Guanine nucleotide-binding protein subunit gamma "
FT                   /function="signal transducer activity"
FT                   /biological_process="G-protein coupled receptor protein
FT                   signaling pathway"
FT                   /cellular_component="heterotrimeric G-protein complex "
FT                   /protein_id="CAG62722.1"
FT                   /db_xref="GO:0004871"
FT                   /db_xref="GO:0005834"
FT                   /db_xref="GO:0007186"
FT                   /db_xref="HOGENOM:HBG058451"
FT                   /db_xref="HOGENOM:HBG397684"
FT                   /db_xref="InterPro:IPR015898"
FT                   /db_xref="UniParc:UPI00003B7165"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FJ50"
FT                   /transl_table=1
FT                   /translation="MEVSQSQLDLKIKYLKLKRINELNDKLRDELQRERITASNACLQL
FT                   IAYTTSTRDYALPTLWGYPPADTNHFRDFQTQHADDATCCTIM"
FT   pro_peptide     complement(922045..922053)
FT                   /locus_tag="CAGL0M09207g"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FJ50 "
FT   mat_peptide     complement(922054..922308)
FT                   /locus_tag="CAGL0M09207g"
FT                   /product="Guanine nucleotide-binding protein subunit gamma "
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FJ50 "
FT   CDS_pept        922638..922955
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000211932" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17440092"
FT                   /locus_tag="CAGL0M09229g"
FT                   /product="Similar to uniprot|P47131 Saccharomyces
FT                   cerevisiae YJR085c"
FT                   /cellular_component="membrane"
FT                   /protein_id="CAG62723.1"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG329230"
FT                   /db_xref="HOGENOM:HBG467849"
FT                   /db_xref="InterPro:IPR005349"
FT                   /db_xref="UniParc:UPI00003B7166"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJ49"
FT                   /transl_table=1
FT                   /translation="MEHPAFTLSALTTIGGVVGYMRKKSLPSLVAGLTFGGLYAISGYL
FT                   LHLNRDYGLELALGSSALLTVSGAMRGGVKTPLKPIPFLLTVCGATGSYYYWSKYKEFY
FT                   P"
FT   CDS_pept        complement(923094..924443)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21045134"
FT                   /gene_name="CSN12"
FT                   /locus_tag="CAGL0M09251g"
FT                   /product="COP9 signalosome complex subunit 12 "
FT                   /cellular_component="cytoplasm"
FT                   /cellular_component="signalosome"
FT                   /protein_id="CAG62724.1"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0008180"
FT                   /db_xref="HOGENOM:HBG124119"
FT                   /db_xref="InterPro:IPR000717"
FT                   /db_xref="UniParc:UPI00003B7167"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FJ48"
FT                   /transl_table=1
FT                   /translation="MEYSRFVDCFERRSYTAEFLEFVGFKLSSEPLGATALILGGSQAK
FT                   QARYGDVNALYDAIVQIKLKESLTSLRELDPNAAVKKNKQRKVHQRVVDVFQALTNELR
FT                   ILNKILERSDDSVWLVYPVYTVCHDVSTFLRDTGKYMQLESRKQLWEECIRVIHRSFMI
FT                   CLNDKNPNMQENKRGGCILFANLEMMFYKMLRNRDMMKNLIKVLESTGMTDISRQRDNK
FT                   VLKRHRSQKIIFNYFIGEYYGCYLFQFNKAQEHLQVCVSEFPVKYTSSKWFKRIIHLYT
FT                   QFRMLATSNKLIHVELPRETNEKFANAYDSDLMNKCYKNGDTIVFDELIKEHAAQYLID
FT                   GTYSAMLLIKELVFLRLVKVCYKVNDKKSILPLDLIAAGYRIHFRNHDNEENRVTTTNP
FT                   RKLQKKNEDLLDELECRIANLIANGRIKGYLSHSQRCMVLSKTEPFPLAS"
FT   CDS_pept        924718..925602
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21045135"
FT                   /locus_tag="CAGL0M09273g"
FT                   /product="Similar to uniprot|P47129 Saccharomyces
FT                   cerevisiae YJR083c"
FT                   /protein_id="CAG62725.1"
FT                   /db_xref="HOGENOM:HBG124120"
FT                   /db_xref="HOGENOM:HBG202250"
FT                   /db_xref="UniParc:UPI00003B7168"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJ47"
FT                   /transl_table=1
FT                   /translation="MSERIVSNPIELHKLSLVDKQKGDTSGSSGAAGTGSGANDGNSNA
FT                   GNSNAGNSNAGGAGVTGTPVKQRARPVVPIASPTKVKEEPKSEDGLYKLASKQREIFEL
FT                   EQKLKQARVELKQLEEEVGKSLGYAGMPQESLRNRLQKRIEEVNRSPNVIRTKQSMSNL
FT                   IQRGNTLFMDGSSSARGATDRDMRTDQRRSAHAHAAAPAQAQPSAHRQNGPPLPSRPRE
FT                   PQKNFFKSIVDKFHEMTQEEEDFDDQTTSNHKDKYYIGETYGYDQDEEDEDPEDHGEPL
FT                   EHINDIPTTLFKR"
FT   CDS_pept        925881..926156
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000000817" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17440093"
FT                   /gene_name="EAF6"
FT                   /locus_tag="CAGL0M09295g"
FT                   /product="Chromatin modification-related protein EAF6 "
FT                   /biological_process="DNA repair"
FT                   /biological_process="chromatin modification"
FT                   /biological_process="regulation of transcription "
FT                   /biological_process="transcription"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG62726.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006281"
FT                   /db_xref="GO:0006350"
FT                   /db_xref="GO:0016568"
FT                   /db_xref="GO:0045449"
FT                   /db_xref="HOGENOM:HBG058457"
FT                   /db_xref="HOGENOM:HBG202249"
FT                   /db_xref="InterPro:IPR015418"
FT                   /db_xref="UniParc:UPI00003B7169"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FJ46"
FT                   /transl_table=1
FT                   /translation="MSDEYQSVKQELKALLADRKELEDKLDKLQQEIYDKESEYFDVDG
FT                   GSKSYHNILRGFDGMSRTQSNNSNMTNNDRIFSLSSASYVKQVQDQ"
FT   CDS_pept        926244..927407
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000066089" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17440094"
FT                   /gene_name="AIM24"
FT                   /locus_tag="CAGL0M09317g"
FT                   /product="Altered inheritance of mitochondria protein 24,
FT                   mitochondrial"
FT                   /cellular_component="mitochondrion"
FT                   /protein_id="CAG62727.1"
FT                   /db_xref="GO:0005739"
FT                   /db_xref="HOGENOM:HBG253069"
FT                   /db_xref="InterPro:IPR002838"
FT                   /db_xref="UniParc:UPI00003B716A"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FJ45"
FT                   /transl_table=1
FT                   /translation="MLKSRFKVVGKEALMASLPLEPSVPMCIRKGCLVSVMAGGAHGSG
FT                   KTASLVIGHKWVNFWTNLARFRSWNSSLYHVLTTSGKENRALVAPNISRGSPWLSALKL
FT                   VVSILSKNSKGITITDPQRSIYPLELDGTQDWNVWGRDSLIAFEQNDSLDIKPASLSSS
FT                   LKRDALFSHSHKYQVVTGRGSVLLGGYGDIYSIDLKNSTDDIVINAQNILAVSGKGQTE
FT                   TMNAIENNPFIISHTAASNIPEFTSNVQELAAFEDPKQQQSQTIVQKTVKEAARASKAV
FT                   WHWISYVYKKTVIFSNNNGHNITSPAFVKIKGPRTIIIQTSHETTQPVSVSTVDILPRT
FT                   VENAIPEVVETPKAKSDSYINYATVQPDGNVTFRSVSNFNETIAERY"
FT   CDS_pept        complement(927557..928153)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000066068" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17440095"
FT                   /locus_tag="CAGL0M09339g"
FT                   /product="Similar to uniprot|P38162 Saccharomyces
FT                   cerevisiae YBL107c"
FT                   /protein_id="CAG62728.1"
FT                   /db_xref="HOGENOM:HBG124121"
FT                   /db_xref="HOGENOM:HBG204246"
FT                   /db_xref="InterPro:IPR016805"
FT                   /db_xref="InterPro:IPR019171"
FT                   /db_xref="UniParc:UPI00003B716B"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJ44"
FT                   /transl_table=1
FT                   /translation="MAKQGQEELTVSFSEQLLDPNLSFPDYQQTTRQLTLNRARCVDPT
FT                   LIDTFLRNLRHGSDDVIKQKLNNYSKQTEHRNDTRLQKCDSLIHREIYPNWQVRDSIID
FT                   FCAAQATQLKYELDQQKSSEVIRTTVDTRLDPYSVRDLQHEEEKKYKQWNDLNNWVENN
FT                   RTIEGILRGSSDHFLKQNCDQNVDYLRKFWDLSSK"
FT   CDS_pept        complement(928484..931918)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000176156" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17440096"
FT                   /locus_tag="CAGL0M09361g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /function="ATP binding"
FT                   /function="metal ion binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /biological_process="signal transduction"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAG62729.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="GO:0007165"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="HOGENOM:HBG055849"
FT                   /db_xref="HOGENOM:HBG396709"
FT                   /db_xref="InterPro:IPR000008"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR000861"
FT                   /db_xref="InterPro:IPR000961"
FT                   /db_xref="InterPro:IPR002219"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR008973"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR011072"
FT                   /db_xref="InterPro:IPR015745"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="InterPro:IPR017892"
FT                   /db_xref="UniParc:UPI00003B716C"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJ43"
FT                   /transl_table=1
FT                   /translation="MLSQVEQDIRRKIAVEENIIKGSSALKKKTDNVMVIQKCNTNIRE
FT                   ARQNIEYLEETLKKLQLSQSQQGQTDSQQQQANDDSTVTEIDRGQGYRQLSTIAPEEHV
FT                   FSRLDLVKYDCPSLAQKIQYMLQQLEFKLQVERQYQEANNKLTKLYQIDGDQRSSSAAE
FT                   GGALESKNRVQLLKKALKKYQAINVDLDQYYKHHNDESLKDMQPKLREKQLTGMLTIGI
FT                   TAIRDVDHIQSPLFARNPETFITVKIDDVVKSRTKPSRNDRWNEEFSIEVDKGNEIEIT
FT                   IYDRVNESVTPVAVMWLLLSDIAEEIRKKKVGKTNGQGWVRAASIKSQTVHNSQAVANR
FT                   TYASDSRTTSLNNSNSDLNQDMSLSPTQVTTNAWFVLEPAGQILLTLGFHKTSQHQRKN
FT                   LVGGLHRHGAIINRKEEVYEQHGHHFVQKSFYNIMCCAYCGDFLRYTGFQCQDCKFLCH
FT                   KKCYGNVVTKCISKASTETDPSEAKLNHHIPHRFEPVSNRGTKWCCHCGYILPWGKQKV
FT                   RKCTECGIMCHTQCAHLVPDFCGMSMEMANKILKTIEDTKRTQEKKKRKPPQTNASALT
FT                   STSTMIGSSVHDRLDSSPSKSMNASIPSIPSPRKHPYAANQYHEKAEEHQMQNQNRLNN
FT                   YIEDNEAYLKFTSGVGVPGASQDVKAQNMNDAYVDQYGHEYQQDNNDSQLKASEDELEL
FT                   WKQHRERMERELQQEQQMQMSYDNNAEGQIDLYTKQASGDVNMLPAVDETVSSHNNPFR
FT                   DMNHETFEQTQNYVANQLQGDVTDIRSSTEIITAAGNNVSPQKRSSGKHKKRGSKRPKV
FT                   SLDNFVLLKVLGKGNFGKVILSRSKNTNRLCAIKVLKKDNIIQNHDIESARAEKKVFLL
FT                   ATKTKHPFLTNLYCSFQTENRIYFAMEFIGGGDLMWHVQNQRLSVRRAKFYAAEVLLAL
FT                   KFFHDNGVIYRDLKLENILLTPEGHIKIADYGLCKDGMWYGNKTSTFCGTPEFMAPELL
FT                   REQDYTKAVDWWAFGVLLYQMLLCQSPFSGDDEDEVFNAILTDEPLYPIDMAGDIVQIF
FT                   QGLLTKDPEKRLGAGPRDALEIMEEPFFRNINFDDLLNLRIKPPYIPEIKSAEDTSYFE
FT                   QEFTSAPPSLTPLPSVLSTTQQEEFRGFSYMPEDLEL"
FT   CDS_pept        complement(932379..935324)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000246762" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17440097"
FT                   /locus_tag="CAGL0M09383g"
FT                   /product="Similar to uniprot|P38164 Saccharomyces
FT                   cerevisiae YBL104c"
FT                   /protein_id="CAG62730.1"
FT                   /db_xref="HOGENOM:HBG396708"
FT                   /db_xref="HOGENOM:HBG434171"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniParc:UPI00003B716D"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJ42"
FT                   /transl_table=1
FT                   /translation="MALIKKAFNWSYDEFLDYLSVNPTRDEVTHYKVNPDLEGDDSIMK
FT                   MLTVKDFGSITCLDYSEAEVGLTAVGEKNGYMRLFNIINAEDDGEEHFNLGARAKQQRT
FT                   INAVGINTNGLIAIGLDRNRHDPSLQIWDINYQSTESDIINPTFSYCTNESIVSLKFLN
FT                   DTNILTSSTKFLKEIDVRSPNSIYQHPTRLTYDIKLNPFNDWQFSTYGDDGTLAIWDRR
FT                   RLVSNVSNGNLTLTTPLLTFEKLVGAGSASRKYMNSCFRWSPIRDKEFSTLYHGDTIKI
FT                   WRLGSYVNSEVSEDYESFFVSTVHDIETPYDRVATFDYISKNNKDASFLCMRQSGTVYR
FT                   MSIDQNYTNSKFNNRNTLLLSNSNGPDIEEIAVAQDKPKSALENLGAIHKNLSFEDLDL
FT                   RDDYGKSEDDTNDDYEDEDVDDDNHSNVTEHTEGNESKHLLQEGEGNNLYWKAEKLLQE
FT                   DISVIMRKRAQLGYGLDPMTTVEIVDRSRALQNYSYIRNTWRWIAIAKTSDVDGTMVSG
FT                   DLDLGYEGILGIWNGLNGISNQNRHSEDVIISDKQLIREMDKIIRLRKKNKDINSYHGA
FT                   IAKFADSPKFIQRKLCLIISGWDLSPSDYQEKYDIIIKNGNYEKAAAWAMFFGDIPKAI
FT                   EILGSAKKERLRLIATAISGYLVYKDQPGNNAWRQQCRKMSNDLDDPYLRVIFAFIADN
FT                   DWCDILYEPAISLRERLGVALRFLNDSDLTRFLERTSSIVINNGELEGLILTGITPIGI
FT                   DLLQSYVMKTSDIQSAALIAVYGCPRYFRDQRVDEWIDTYRTMLNSWQLFSMRAKFDVL
FT                   RAKLSKTSAGNVTVNVTPRQLYIQCLSCKKNINKPISAEASAAKNKYTHKLSHDKEERS
FT                   VNHSYFCPHCGAPFPRCAICLMPLGTSNLPFVINGIKGNDQDAHTEVHSTEHSDTAEPQ
FT                   ETNVYKRKLKLNEWFSFCLTCKHGMHAGHADEWFERHTICPTPGCTCQCNR"
FT   CDS_pept        complement(935685..937040)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000066067" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17440098"
FT                   /locus_tag="CAGL0M09405g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /function="transcription regulator activity"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG62731.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0030528"
FT                   /db_xref="HOGENOM:HBG124122"
FT                   /db_xref="InterPro:IPR001092"
FT                   /db_xref="InterPro:IPR011598"
FT                   /db_xref="UniParc:UPI00003B716E"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJ41"
FT                   /transl_table=1
FT                   /translation="MEINNEDHELLAEIMGHGGDGSELFGNDADVFLRNGSGSGETQAG
FT                   NADGLALYPQATPAHRHEQMAMMNHGNSEMHSFLDDMFTNSSLGHGQPVTESNLTKNMM
FT                   GNHYEQNLESDIASSLYNSRHPSVSMEHGTAGHPEMLFHQNDNSISSFSESFYGSSLDS
FT                   SISEVSSINSFMSGNSFPAPLPHQIDENSILVNNNMSPSGFRDSIRPGSFLSTSLRAPS
FT                   SMSRQMRNPSYNDSGIPMTVGSVPKNATSHMTPDEKLKRKREFHNAVERRRRELIKQKI
FT                   KELSKLVPPSLLNYDADGNQIKSNRGTILDKSVEYLEYLLYVIDIQKRKREALQEKIAQ
FT                   LSSLSSRTTDDLGMGPRKMTNLPQRISSQATLKANTFNEEKIIDTRGIPDTRGISASQA
FT                   HTDNPLEDFNHNHVDFNATHTDFNNNINDDLQQFLSGDLMEAEDNAKLMFNP"
FT   CDS_pept        937627..938268
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000233384" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17440099"
FT                   /locus_tag="CAGL0M09427g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /biological_process="vesicle-mediated transport "
FT                   /protein_id="CAG62732.1"
FT                   /db_xref="GO:0016192"
FT                   /db_xref="HOGENOM:HBG244788"
FT                   /db_xref="HOGENOM:HBG323920"
FT                   /db_xref="InterPro:IPR007305"
FT                   /db_xref="InterPro:IPR011691"
FT                   /db_xref="UniParc:UPI00003B716F"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJ40"
FT                   /transl_table=1
FT                   /translation="MTDNNDQVNLLRDSLSRWNQGRAQQSQGFNESAKTLFSSWADSIN
FT                   ERAQDVYSRLPVSRQDLIQDEEPAWFNLSRTERLILFVCFILGSAACFTLCVFLFPVLA
FT                   IKPRKFGILWSVGSLLFVLAFGIFQGPVAYIKHLTSRERLPFTVFFFGTCALTIYFAAF
FT                   MKSTILTIPCAVLELIAVLYYAISYFPFGGTGLRMLSSFGINTARGALHI"
FT   CDS_pept        complement(938424..941660)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000708" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20196348"
FT                   /locus_tag="CAGL0M09449g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /protein_id="CAG62733.1"
FT                   /db_xref="HOGENOM:HBG124123"
FT                   /db_xref="HOGENOM:HBG204118"
FT                   /db_xref="InterPro:IPR011022"
FT                   /db_xref="UniParc:UPI00003B7170"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJ39"
FT                   /transl_table=1
FT                   /translation="MVSSSSSRRRSSTIKSALSSLLHGHSNGSGHHGKDSAYARRHSTN
FT                   SISANGSDTSVRSKLSSHGTGSAANARVPSRTPNKSSTMPDVQSNSTGHLNDTMRNTRY
FT                   DSTRYSRSFATDDENAIEFDDQNTSLNSDPSGLTPLPESFNKEYLAEYLHNRGFLNPKS
FT                   VETRENFSIGIATSGDVIFLPTVSSNDDEYLARLNGVGSGESNMELDQGAMDDELTGDD
FT                   FVIQDGVLQRQQQNQGHSATDNSSSTAVASPSGTQSDVPDSGAYQNRSLEFDASMVSFS
FT                   VAVILSVKSPIKLTDLKVELSSRVRIYWHAGVPPTKTFFEEFYQAGYVNWNLNDTNYDV
FT                   FVPTTVSSNTQIVERHNNTPTKIFRNKPISERYYTDKSKLKRQYLDSLLDCEGHLLEAG
FT                   DYVYLLPVIFSNHIPESTYLPSARISYKLKIGTRAIGSSIKRAGSTGSSLSIGQQNQPI
FT                   SSHSSTSSLSSLRDMDHEGKANSSASPHKGLSGNLLKKVKNHLHLPHNQVKPGEIEESR
FT                   ELYTEYPIKVIRTPPPISISTANKPIYINRVWSDSLSYEISFASKYVSLNSRVPIKIKL
FT                   APIAKNICVKRVRVSITEKITFVSKNLEYEYDQVDPVAKDPYNPYYLDFTSKRRKERNL
FT                   ALLEVRTKPKGSRALREEIVENCVNDNLLSFGEIKEPGKADSIPLVEPVSIETRLDFPS
FT                   YMDLDKRHAKNIPPYGIDVYTAIANPEEQQSTSHHKSSVIGILTGIKNSTDSGSSPSKA
FT                   NSDKNTNNSSSAETESAARRQTVSRFHQTSIKANSHPNVKFHTRLNKCKRGLYLDSLHY
FT                   TNVHARHKLEVMLRISKPDPENPSKLRHYEVLIDTPVFLVSDQCNTGNMELPTYDMATT
FT                   VTSTDLTPIPNATNLAPPPTFEEAISVPASPFQSPAASPIGSPVMSPSYDPELLSIQQL
FT                   NLSRSTSFSGPSVHLENTNTGTGGSSVGGISLLQPGSSHRPSISAEASSGRYSNLDRLM
FT                   FASSQTSPPPPLPMDIMQGRRASDAAAVSSSYTNPEQSPRIPIIVETNPFFKKDYTLTP
FT                   RSNEPEADDNSTTPGQLPSKDPPTYEEAVS"
FT   CDS_pept        complement(942333..942659)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000034134" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17440100"
FT                   /gene_name="ATG16"
FT                   /locus_tag="CAGL0M09471g"
FT                   /product="Autophagy protein 16 "
FT                   /biological_process="autophagy"
FT                   /biological_process="protein transport"
FT                   /cellular_component="cytoplasmic membrane-bounded vesicle "
FT                   /cellular_component="vacuole"
FT                   /protein_id="CAG62734.1"
FT                   /db_xref="GO:0005773"
FT                   /db_xref="GO:0006914"
FT                   /db_xref="GO:0015031"
FT                   /db_xref="GO:0016023"
FT                   /db_xref="HOGENOM:HBG059479"
FT                   /db_xref="HOGENOM:HBG104155"
FT                   /db_xref="InterPro:IPR013923"
FT                   /db_xref="UniParc:UPI00003B7171"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FJ38"
FT                   /transl_table=1
FT                   /translation="MLAERDTLEKNYCELFEVPVDGRSNDGDAMLLQEALRGKDNEIRM
FT                   LEERLAVSSKNVERLNDELLGANLEANVLGQKLQDLQQEHDKLLERWMQRVRVEVDKMN
FT                   AQLE"
FT   CDS_pept        942904..945030
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000141873" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17440101"
FT                   /locus_tag="CAGL0M09493g"
FT                   /product="Similar to uniprot|Q03823 Saccharomyces
FT                   cerevisiae YMR160w"
FT                   /protein_id="CAG62735.1"
FT                   /db_xref="HOGENOM:HBG059470"
FT                   /db_xref="HOGENOM:HBG203458"
FT                   /db_xref="UniParc:UPI00003B7172"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJ37"
FT                   /transl_table=1
FT                   /translation="MNGENSWWSRNGENRVSDGGDQVGDERWYQSVWNKLPQLRRPNME
FT                   VNITAATQYSHLNAEQIQYLENDALEKIRARSNTWCWFQDMNALASAGAAGVVSVAGTG
FT                   SSILPLPLPAYPGDTFPGHQLYVKNSLLLPESPLEIYHREPLRTQISNAFKEHYNFPNE
FT                   KHLYLRRPEQTGIVDQKVVVISIVGHLPDKYEKITLGKQPSAYYLTQRFLKTLEHVNPG
FT                   TVVTFSIEADIDTQPMETAFQSLVKVFNNWKFRLKDASAIYIQSVYHSVPIAIKLAKHL
FT                   MLNHIDYGFTDKTSIGLLGLESCIEGYRFWDHSIDISSSTEQEIDKLQQAKEKQLYQGC
FT                   TKQQQTILAQIKEYCDLESEESQNMQNDLDWVLYNWGPARVTLVGKLYDNFMTLSQKLA
FT                   IDYRHSKIMRSLWCNGSYLGLDPKLPEKISVPNSHLKTIKFDCNVQIPEERLFEVSLLM
FT                   IVVLALNLGYTSGTSLAKLIGPYFISRSYNSNTVPPNIRKQQTYDNKIWLQEMEEKWKD
FT                   LNIRESYMDELPKHVSSTHSFLEFSYFQAQRSPDLLQIKSDIYDDDSVYKLFLENTMLT
FT                   RNPRYKKHLQLHKDEYMPSSIFDRANQYDLVWKFHEFLSNFVTARNLPRQNFPPLISFS
FT                   ISLDYSFWKYMYPESNSFNRDTTESRKKLVQLWECYNSWDPPTRGLQKLRNILSVLSIY
FT                   KEPSKFIEDIQRTL"
FT   CDS_pept        945440..946045
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000000709" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21045136"
FT                   /gene_name="ROX3"
FT                   /gene_synonym="MED19"
FT                   /locus_tag="CAGL0M09515g"
FT                   /product="Mediator of RNA polymerase II transcription
FT                   subunit 19"
FT                   /function="RNA polymerase II transcription mediator
FT                   activity"
FT                   /biological_process="regulation of transcription from RNA
FT                   polymerase II promoter"
FT                   /biological_process="transcription"
FT                   /cellular_component="mediator complex"
FT                   /protein_id="CAG62736.1"
FT                   /db_xref="GO:0006350"
FT                   /db_xref="GO:0006357"
FT                   /db_xref="GO:0016455"
FT                   /db_xref="GO:0016592"
FT                   /db_xref="HOGENOM:HBG060115"
FT                   /db_xref="HOGENOM:HBG204148"
FT                   /db_xref="InterPro:IPR013942"
FT                   /db_xref="UniParc:UPI00003B7173"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FJ36"
FT                   /transl_table=1
FT                   /translation="MEMEEFAPSYYYYVEPEMGYQPQQPNPMEDLITVYHLDDISRQVA
FT                   RTNEDGTKAVKLRKSYKNQITDLSGKFSSIPNRENRKGGEIAHILFQNNPDMMNQVHRS
FT                   PDMTDEQWREALMNVDASLFQAPNMDWEVCQSVLSQFDRSYPTEFQNDPNFHVDDLAFD
FT                   LDGTGKSNAKKRKNRSNGSSMATPNSEMQDDVKRRRLE"
FT   CDS_pept        complement(946553..947281)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000246617" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18501704"
FT                   /locus_tag="CAGL0M09537g"
FT                   /product="Similar to uniprot|P38172 Saccharomyces
FT                   cerevisiae YBL095w"
FT                   /protein_id="CAG62737.1"
FT                   /db_xref="HOGENOM:HBG060116"
FT                   /db_xref="HOGENOM:HBG396275"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="UniParc:UPI00003B7174"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJ35"
FT                   /transl_table=1
FT                   /translation="MPPLFRAVTRGILLPTLGFSAGFLTFLKAWPDEAGAITLQKQQGS
FT                   DMQLLQRADVLQKITQSTLYKQLLRADDVDHTRQSDKIPHGHKPYHVGQGILFGKDKLE
FT                   IDPLIFLNEEKGQLTVFYHLGKNLGNEKSQVHKGVISLLMDEALCYCGFPRLPSKRGVT
FT                   AKLNLKFNREIPADSTVILTATVRESKGRKCIIDGELQVFSDKVHTLPSLWGEKEPNVE
FT                   AECILVEPKWFKYFSRLNMF"
FT   CDS_pept        complement(947542..949797)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000246707" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20196349"
FT                   /locus_tag="CAGL0M09559g"
FT                   /product="Condensin complex subunit 2 "
FT                   /biological_process="cell division"
FT                   /biological_process="chromosome condensation"
FT                   /biological_process="mitosis"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG62738.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0007067"
FT                   /db_xref="GO:0030261"
FT                   /db_xref="GO:0051301"
FT                   /db_xref="HOGENOM:HBG060118"
FT                   /db_xref="HOGENOM:HBG396937"
FT                   /db_xref="InterPro:IPR022816"
FT                   /db_xref="UniParc:UPI00003B7175"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJ34"
FT                   /transl_table=1
FT                   /translation="MLANLEEWIKMATDNKINSRNSWNFALIDYFYDLNILKDSENNIN
FT                   FQKASATLDGCVKIYSSRVDSVTSETGKLLSGLSQRKNEQANSKNNKQPGDGNDGDYDD
FT                   ADSSVQIDALTGLPVGKDSDEYLKRRRVHNRVLETTLVEFDNIRMKELDQELNIDPLFK
FT                   KALVDFDEGGAKSLLLNTLSIDESGRVVFDAAMKNEPSLLKEKESNEEPLNENNLPLDS
FT                   SKSMDEDNSHGDRSDKNSTPTPQTPITEPEEEEDSKADITLNKSFSSNFQYSMDDEILA
FT                   LGIDYIKFDDISTSDISPSLQNLRNVIADINKAKGFIDSINNKFDNFLTEDEIKEAVPE
FT                   EEGPNGNDYDDGINQELEYSMGNNEDVLPFDINDGGDNFGEDNEGGIDDEEGDENGGLD
FT                   SMLGSILEKDLMAYFDEKMNRNWRGREHWKVANYKKANTIDNKSSEPNNEIEREATESE
FT                   GTSEENKKSDTKKERKKQIQIDFLNLDPNIESIVFDSKKRSGIDMAIKSRTNDSHYLLP
FT                   DDYHFSTEKITGLFIKPNTKMSIFNRVKRRKMTAAQVDTTSDNLGNGIPQIADEQFWAN
FT                   NYEEQENENNIGGNNDLESSNIVGADIENPFEEEGIDFNQAFEDMSLDENDDAGKDIFT
FT                   QKDEKEDLTKLRQPDKVTYSRVSKKVDVRRLKKNIWMSVKSVVSQLDETSDILQFRFTD
FT                   ITKNLGKFYSPESLSDISTSFCFICLLHLANEHGLQIKSTENYEDLTVIFDKSVVTV"
FT   CDS_pept        complement(951054..952685)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000130111" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17440102"
FT                   /locus_tag="CAGL0M09581g"
FT                   /product="Similar to uniprot|P07251 Saccharomyces
FT                   cerevisiae YBL099w F1F0-ATPase complex "
FT                   /function="ATP binding"
FT                   /function="hydrogen ion transporting ATP synthase activity,
FT                   rotational mechanism"
FT                   /function="proton-transporting ATPase activity, rotational
FT                   mechanism"
FT                   /biological_process="plasma membrane ATP synthesis coupled
FT                   proton transport"
FT                   /cellular_component="proton-transporting ATP synthase
FT                   complex, catalytic core F(1)"
FT                   /protein_id="CAG62739.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0042777"
FT                   /db_xref="GO:0045261"
FT                   /db_xref="GO:0046933"
FT                   /db_xref="GO:0046961"
FT                   /db_xref="HOGENOM:HBG389886"
FT                   /db_xref="HOGENOM:HBG565875"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR000793"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005294"
FT                   /db_xref="InterPro:IPR017458"
FT                   /db_xref="InterPro:IPR018118"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="UniParc:UPI00003B7176"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJ33"
FT                   /transl_table=1
FT                   /translation="MLSRVVLARNALRAVSRASRASRGSVVRTSARCYAAKAQPTEVSS
FT                   ILEEKIRGVSDEAQLNETGRVLAVGDGIARVFGLNNIQAEELVEFASGVKGMALNLEPG
FT                   QVGIVLFGSDRLVKEGEIVKRTGKIVDVPVGPGLLGRVVDALGNPIDGKGPIESVGTAR
FT                   AQVKAPGILPRRSVHEPVQTGLKAVDALVPIGRGQRELIIGDRQTGKTAVALDTILNQK
FT                   RWNDGNDESKKLYCVYVAIGQKRSTVAQLVQTLEQHDALKYSIIVAATASEAAPLQYLA
FT                   PFTAASIGEWFRDNGKHALIVYDDLSKQAVAYRQLSLLLRRPPGREAYPGDVFYLHSRL
FT                   LERAAKMSDKEGAGSLTALPVIETQGGDVSAYIPTNVISITDGQIFLEAELFYKGIRPA
FT                   INVGLSVSRVGSAAQVKALKQVAGSLKLFLAQYREVAAFAQFGSDLDASTKQTLVRGER
FT                   LTQLLKQSQYSPLAAEEQVPLIYAGVNGYLDNIDLGRIAEFESSFLAYLKSNHENILND
FT                   IRDKGELTKDLLATLKSATESFVATF"
FT   CDS_pept        complement(955022..955492)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000204096" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17440103"
FT                   /locus_tag="CAGL0M09603g"
FT                   /product="Similar to uniprot|Q03799 Saccharomyces
FT                   cerevisiae YMR158w"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="CAG62740.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG192816"
FT                   /db_xref="HOGENOM:HBG735443"
FT                   /db_xref="InterPro:IPR000630"
FT                   /db_xref="UniParc:UPI00003B7177"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJ32"
FT                   /transl_table=1
FT                   /translation="MSLVKLANTCAHLQNCSRVRLSLTSLPYTKLQLQFAYNLYKQGFL
FT                   SSVERGSTRGPDDEFIEVTPDNIATRRLWVGLKYRDNKPVLSQCRLISKPNMRIMMGPD
FT                   ELKKVCSGVSVRQVKPLQPGELMLVRTERNTIVDIHEAIAQRHGGELLCRVK"
FT   CDS_pept        955675..956367
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000141874" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18501705"
FT                   /gene_name="AIM36"
FT                   /gene_synonym="FMP39"
FT                   /locus_tag="CAGL0M09614g"
FT                   /product="Altered inheritance of mitochondria protein 36,
FT                   mitochondrial"
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="mitochondrial membrane"
FT                   /protein_id="CAG62741.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0031966"
FT                   /db_xref="HOGENOM:HBG058833"
FT                   /db_xref="HOGENOM:HBG104148"
FT                   /db_xref="UniParc:UPI00003B7178"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FJ31"
FT                   /transl_table=1
FT                   /translation="MALMRLGLRIPARLGSNLPVAQLGIRAAKHRFYATAPRNDGGELP
FT                   SIKKLLMIGLAGTAVFVLAVNSLDKQQPKNSYSESEFESLQRLKRKVALFPGNQLKVYG
FT                   VLGTEKYNKIVSGGKIVDPRKIIEKHRTTAGDRYEALLNILYDKYGAVEYFDMLPQGLM
FT                   VKLVSLYMKDNCSEGDTVVILDFPKSIKDASQFETEVAGISKFIVSQKLKDTDICKYYD
FT                   AVGKLESV"
FT   transit_peptide 955675..955773
FT                   /gene_name="AIM36"
FT                   /locus_tag="CAGL0M09614g"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FJ31 "
FT   mat_peptide     955774..956364
FT                   /gene_name="AIM36"
FT                   /locus_tag="CAGL0M09614g"
FT                   /product="Altered inheritance of mitochondria protein 36,
FT                   mitochondrial"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FJ31 "
FT   CDS_pept        956604..957353
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000763" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17440104"
FT                   /locus_tag="CAGL0M09636g"
FT                   /product="Similar to uniprot|Q03796 Saccharomyces
FT                   cerevisiae YMR156c"
FT                   /protein_id="CAG62742.1"
FT                   /db_xref="HOGENOM:HBG124124"
FT                   /db_xref="HOGENOM:HBG203453"
FT                   /db_xref="InterPro:IPR006551"
FT                   /db_xref="InterPro:IPR013954"
FT                   /db_xref="InterPro:IPR015636"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniParc:UPI00003B7179"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJ30"
FT                   /transl_table=1
FT                   /translation="MKTHKVTILPHLIKFIPQVDSSIADDSLNLYGFDLDHTIIQPKSG
FT                   AVFARGSNDWKFMEFGGKQTLQKLIKLVLGESNAFVVVFTNQGGVVTVPTTAKSCLNFT
FT                   NKIKNLLEHIEGVENGSKFLERLFIYAAPKKPASFGKKKVAGTKSGRVNKSINSMLAKT
FT                   TKEKEQIDNKDIDDQVSIFTKMRKPETGMADAFISDLELIFPKEKYKYNWKLYCGDAAG
FT                   RKSDFSDADKAFAETLKVPFVIPEEFF"
FT   CDS_pept        complement(957350..958915)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000141875" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17440105"
FT                   /locus_tag="CAGL0M09647g"
FT                   /product="Similar to uniprot|Q03795 Saccharomyces
FT                   cerevisiae YMR155w"
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="CAG62743.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG203452"
FT                   /db_xref="HOGENOM:HBG253133"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="UniParc:UPI00003B717A"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJ29"
FT                   /transl_table=1
FT                   /translation="MTDSTTSAGLLILSAALVSLGAGTPYLYSFWAPQFISQCHINAGS
FT                   VSTLSYSLNIGSCILGPMAGYIVDQSPKVACAIGSGATLLAYIVVKICYDRAIGNVPLI
FT                   SFALALIGFGSVAGFYAAVKCCTAMFPRNRGSATAIPIAMYALSAMIYSTIGTTIFKQE
FT                   ESKFFVFLILSCPALIAVGATSFVMPETKYEPIVEDSSGLQAAPVIEGLSNADIWSKNM
FT                   NLNIELRDTRKTFSPGAHEGVTLSPYKIRDDDDLTQRGLTPSSFDIDTKIEDMHTPSSN
FT                   QLELTIKQQVLSAQFFSYYLVLMILQGFGQMYIYSVGFLVTSEVEYANSFGAGFNAETI
FT                   QSIQVTILSLFSFLGRLTSGTISDFLVKRWQLHRLWNIAIAAFLAIIASLILMKNFDSP
FT                   AITPGISAAKLGNLQKIYLSSLLIGLMFGIVFGTFPLIVADTFSQKHYSTIWGLLTTGG
FT                   FVGVRVLSNILSSNMVKNIPLGSTENVCTNSTHCYQDTFKFTASIVSTALVAIFVIIYK
FT                   HRRY"
FT   CDS_pept        959603..961744
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17440106"
FT                   /gene_name="RIM13"
FT                   /locus_tag="CAGL0M09669g"
FT                   /product="Calpain-like protease palB/RIM13 "
FT                   /EC_number="3.4.22.-"
FT                   /function="cysteine-type peptidase activity"
FT                   /protein_id="CAG62744.1"
FT                   /db_xref="GO:0008234"
FT                   /db_xref="HOGENOM:HBG124125"
FT                   /db_xref="UniParc:UPI00003B717B"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FJ28"
FT                   /transl_table=1
FT                   /translation="MNVDRCWEQYYKTLKLIYLEENKETCQREIDHLVDTAIELKEKTY
FT                   SNAVLDLGRQFREVCPKARIMWKTSSIAGNFYPPISISDIYSPVIANVFDQTTRLECRR
FT                   QEYSLRMPLQEEPNFTGIQQHAQVSDCSLVVSLININRYKTTMPVVKQVAENLYATNLY
FT                   FNGAQRRLVLVSTENIPTMQDDPTKQMSVHSANKINKILELGLLKLTSLSYHSEGSNTA
FT                   IDTYRLCGWIPDISSINEFNFLKVHKAFSRGECLIAMGTGGFVPKENIFGVKLRKYHDY
FT                   AVLDIDMINEVVTLRDPLISDTLLTINFDSIRKYFLQVYCNWDSSKLFMFTKDTQIFYS
FT                   DKKFNPYQTLAGKPTFYLKNNSDRDEYAWVLLEFHLDKNNNTTAYLQEIPDRISTVRLG
FT                   YNDNSAETGFQLIKIRLKPKQCIWYFCYSSTDKMLTFHTYSTSSDVVFVRSKMPGCDFD
FT                   VTECAILPENIVPMQYPNHSETDIYYLASIDFSIEGEPGITIITDMVVCLETDDDLVNF
FT                   QMFHWDDLDFNSPIYDEFYMNERMFEKKDLPLTSGERYRIVASTARPPISKGYQCAVSG
FT                   INIHADYPCSYKLRESDVRYNSMMFKLPHVFTLASTGITKISLVNRNKYNKVFMRIYPQ
FT                   TQEDYRYNYRVISADTGEDLVKPGNNIQKLYGGIVIKEFLVSDQTNLELHLSFQDNGRV
FT                   PVELKCQLYVGSVKIITLS"
FT   CDS_pept        complement(961939..963159)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17440107"
FT                   /locus_tag="CAGL0M09691g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /protein_id="CAG62745.1"
FT                   /db_xref="HOGENOM:HBG124126"
FT                   /db_xref="InterPro:IPR007846"
FT                   /db_xref="UniParc:UPI00003B717C"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJ27"
FT                   /transl_table=1
FT                   /translation="MFGNSAGFGSVGDNSSGGSGANRDANNRPSWFQETARRTIPNTVL
FT                   RREVKSSSNSGEDDNGNRGDSTSTGFNTLTFGAKKHMLLGSSNVSTGGNDHMNPLLMDN
FT                   SEAPPTVSISDWKREEGLFDLRNTRNENTINTIGTPTFISPISREKSEVSLFDSNSQSR
FT                   SSSASSIGSESETGNAVVVFGYREAITKQILAYFAQFGEILEDLESELGDTETMRTPGY
FT                   FFQQAPNRRRISREHGRTWTKLTYANHSSYLRALREHGTIYCGAAIGCVPYKHELISEL
FT                   SRDTYNSMNDVKQTNSISTNQLTQHNQSEVPKSNQTFETKPTNETERNQIKTPSAFGSD
FT                   NKGNGSISSGRTKRRLSIKDGSSLFLSGTDNIFSTLDGQPTKKRMINRDRSLIGKISGW
FT                   LFGWNDL"
FT   CDS_pept        complement(963527..964633)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093653" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17440108"
FT                   /locus_tag="CAGL0M09713g"
FT                   /product="Similar to uniprot|P28625 Saccharomyces
FT                   cerevisiae YMR152w YM27"
FT                   /function="oxidoreductase activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAG62746.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG203449"
FT                   /db_xref="HOGENOM:HBG454398"
FT                   /db_xref="InterPro:IPR002085"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI00003B717D"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJ26"
FT                   /transl_table=1
FT                   /translation="MVQQRSITFVDGYSKPAITTTELDLDNCFKDDEIVIKVKCCAINP
FT                   IDMVVYGLSTTWLTGCKPKTFGRDFSGVIVRAGSRVDPQWKVDDEVNGQYVHLLGDRGS
FT                   FSDYLIFNPAKNKSIAHMQKFPRGEGALNYNEGKYDDWVLNASFPLVYGTADSVLADYI
FT                   KKWTPESRILVIGASTQVSNCLIQIAKRHYNIGTVVGICNKNSFEYNEKFGWDHLVSYN
FT                   DGKTIENVTKLMEEKLGGEKFDMIFDSVGNTDFFPVIDKFLKPKSTGSYFLTVVGDNKL
FT                   DYKNPTFRRAMPLSVAWKKINPFLGFNYSTVLVKPIDRYMKLSTEMIQKNQFEPVIDSV
FT                   YEFDQYQEAMDKLLTNKAKGKIVIRVNK"
FT   CDS_pept        964915..966207
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000113516" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21045137"
FT                   /locus_tag="CAGL0M09735g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /protein_id="CAG62747.1"
FT                   /db_xref="HOGENOM:HBG191670"
FT                   /db_xref="HOGENOM:HBG202527"
FT                   /db_xref="InterPro:IPR007150"
FT                   /db_xref="UniParc:UPI00003B717E"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJ25"
FT                   /transl_table=1
FT                   /translation="MKLKLEINGNDYPENFKLLKTTVTTVASLRSLAVLRFDSDRLVII
FT                   STPRVSNGVVAGHGVVARDSGELWCTIPRDVFSLYHVSAERQNNTIALECNVESLKNAV
FT                   LRYDKVMTQGSASTLQLKLRQMPEWNAASANGPDSAGNSRIRVAALAVSFEELVNVYSG
FT                   QGKDDAFMDATQNNTSHAVNKLISHSSKIPVRFLNAQQDERIQEPMMDYNQTMLCRLPS
FT                   ITDEAGGAFLNFLKRIERYTNVNHIKLQGSTSPHISHNRRDAKLRILVDELDWNLVISW
FT                   NGPLELQERADIDEMAEPTSPERPRSETPLLSRISGDNNFDRIDDSEVNTLQESGPDTN
FT                   SHTNGFLEQVQQAEDESSLVQEVIIRSKDLKVCSKLFAAFEEVIMAISHDYACVFHCSL
FT                   SRGLRDTQTQEEKENGQIIYYISRSKALEFA"
FT   CDS_pept        966493..967554
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000141994" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17440109"
FT                   /locus_tag="CAGL0M09757g"
FT                   /product="Similar to uniprot|Q05881 Saccharomyces
FT                   cerevisiae YLR287c"
FT                   /protein_id="CAG62748.1"
FT                   /db_xref="HOGENOM:HBG060043"
FT                   /db_xref="UniParc:UPI00003B717F"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJ24"
FT                   /transl_table=1
FT                   /translation="MGEEVTFAELKELAGSIKEQFVDPYKNDIGALKKISSETKLQGSD
FT                   PLTELEKLAKILKAYSTKLGIICEPSKLHGNYHAAYTELKNYADSLFYLLSLLPLFTRE
FT                   QGKLYASYLNEDVFTQVLGLLNGTEMLCDEICSSSKENEGDNKDRLISVGIIWASCDEL
FT                   CDIVKGGNYGLLSKRIALSCGLVDDVLEDIHGWLEDPQLEGADDFLGDDLDSIDELEDG
FT                   VKKMGIDGDDEEMIEIVKKFLSEWQTKIKMIKLLLSSFSKSITLTTGKNIPNLGSKLDE
FT                   LNKLHKQVILHLDELVSDVFMSGAAFDEDEMGPSIADLNDTLAKMVHIIKEISKQDPKK
FT                   SKWIDVWNNKYFE"
FT   CDS_pept        968440..969993
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000160027" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20196350"
FT                   /locus_tag="CAGL0M09779g"
FT                   /product="Similar to uniprot|P29029 Saccharomyces
FT                   cerevisiae YLR286c endochitinase"
FT                   /function="cation binding"
FT                   /function="chitinase activity"
FT                   /biological_process="chitin catabolic process"
FT                   /protein_id="CAG62749.1"
FT                   /db_xref="GO:0004568"
FT                   /db_xref="GO:0006032"
FT                   /db_xref="GO:0043169"
FT                   /db_xref="HOGENOM:HBG324485"
FT                   /db_xref="HOGENOM:HBG588556"
FT                   /db_xref="InterPro:IPR001223"
FT                   /db_xref="InterPro:IPR001579"
FT                   /db_xref="InterPro:IPR005089"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniParc:UPI00003B7180"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJ23"
FT                   /transl_table=1
FT                   /translation="MIQILLPLLFILSTVFAFDINSKTNVAVYWGQNSAGSQKSLASYC
FT                   QNTEADIFLLSFMNSFPAIGLNFADACTTTFPDGLLQCSQIAEDIKTCQSLGKKVLLSM
FT                   GGASGAYGFADDAQAEAFATTLWNTFGEGSDISVERPFGQSIVDGFDFDIENNNGKGYA
FT                   ALVSKLRQLFSNGSKQYYISAAPQCPYPDASVGDLLANADVDFAFIQFYNNYCNVEAQF
FT                   NWDDWKNFAINTSPNKNIKLYLGLPGAPSAAGSGYISNLDNLSKVIKEISSLANFGGIS
FT                   LWDASQATSNVIDGADYLSQMKNILKSAAGSTETPTTSSSYSMPSNLITNTGEQSSSVL
FT                   VSSVERTTTTLEPTSIISSSSFSDSAPTPTNSHITTTLQPNTNTPPAAAQDSSANVQVS
FT                   VTPSTTTTTPDSPSNHLNDVSPTPSTPAPSSPANPSPDTPAHTIAKQLNAQYAAGQFNG
FT                   KSSCQDGELSCSADGKFAMCAHGSWVEMACAAGTTCYAYDSGNSVFTQCNYVDLKASFV
FT                   "
FT   CDS_pept        complement(970260..971030)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000199189" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20196351"
FT                   /gene_name="NNT1"
FT                   /locus_tag="CAGL0M09801g"
FT                   /product="Putative nicotinamide N-methyltransferase "
FT                   /EC_number="2.1.1.1"
FT                   /function="nicotinamide N-methyltransferase activity "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAG62750.1"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0008112"
FT                   /db_xref="HOGENOM:HBG177325"
FT                   /db_xref="HOGENOM:HBG397955"
FT                   /db_xref="InterPro:IPR019410"
FT                   /db_xref="UniParc:UPI00003B7181"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FJ22"
FT                   /transl_table=1
FT                   /translation="MSDTESLNDALGLFDEPEDFRPEKPKEHYANYERIDVPDISKSKI
FT                   TNLKLQLVGSSPLWGHLLWNAGIYTARHLDKYPELVSNKNVLELGAASALPSLVAGLIG
FT                   AKRAVVTDYPDADLMANIQYNVNTIIPDELKENVRVEGYIWGNEYDPLTIHLDGDKKFD
FT                   LIILSDLVFNHNQHDKLLQTTKDLLATNGKALVVFSPHRPHLLEADLQFFETCKEYGLT
FT                   PEKIEMVNWKPMFEEDEETAEVRSRVYAYYMTHA"
FT   CDS_pept        complement(971284..974670)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000177917" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18501706"
FT                   /locus_tag="CAGL0M09823g"
FT                   /product="Similar to uniprot|Q06685 Saccharomyces
FT                   cerevisiae YLR410w"
FT                   /function="ATP binding"
FT                   /function="acid phosphatase activity"
FT                   /protein_id="CAG62751.1"
FT                   /db_xref="GO:0003993"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="HOGENOM:HBG117938"
FT                   /db_xref="HOGENOM:HBG398541"
FT                   /db_xref="InterPro:IPR000560"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013651"
FT                   /db_xref="UniParc:UPI00003B7182"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJ21"
FT                   /transl_table=1
FT                   /translation="MQEEAKSPSNGQFLNKYTKKAMESIAPILEGFTPKTSSSENMSLK
FT                   LPPPMLDDKPPMYRSGSSNSHCDLSIDEGRKEGAGKTRSYSATVAAHAVAKMRQLALEN
FT                   PPSSDGSGNTSRNDSAVTSPANTPITELPPQSNIPSNTSSRKSSTSQAKPSLPKIGKIG
FT                   VCAMDAKVLSKPMRHILNRLMEHGEFETIIFGDKVILDETIENWPTCDFLISFFSSGFP
FT                   LDKAISYVKLRKPFIINDLTMQKVLWDRRLCLSILNASKVPTPRRLEISRDGGPHVDDE
FT                   LHEKLKMLGVEIKPVEEPNWRMVDDDTLEVGGQIMRKPFVEKPVDGEDHNIYIYYHSKN
FT                   GGGGRRLFRKVGNKSSEFDPALLAPRLEGSYIYEEFMDTDNFEDVKAYTVGENFCHAET
FT                   RKSPVVDGIVRRNTHGKEVRYVTELSKEEKQMASRVSKAFSQMICGFDLLRVGGKSYVI
FT                   DVNGFSFVKDNQEYYDSCARILKETFIQAKKQIDIEKQTLPVIREEKKQKWVFKGLVTV
FT                   IRHADRTPKQKFKHSFTSPIFISLLKGHKEEVVIRKVNDLKIVLQALRIALEEKAGNPT
FT                   KIKLLANTLEKKLELPGTKIQLKPVLTQNNEVEKVQFILKWGGEPTHSARYQATELGEQ
FT                   MRQDFDLLNKNILQDIKIFSSSERRVLVSAQYWATALFGADEFSSDEINIRKDLLDDSN
FT                   AAKDIMDKVKKKLKPLLREGKETPPQFAWPAKMPEPYLVIKRVVELMNYHKKIMDHNFE
FT                   TKDVSKLQERWCTSEDPGLFKERWNKLFKEFVSVEKADPSKISELYDTMKYDALHNREF
FT                   LQNIFDPGELANENISNHSLVDRYPINVLARNNFKIVDSSYAAGTSSSSKTSVGSLGWV
FT                   LESGKTKVNSESKSASPFDGQKYVQFRELYRLAKVLFDFICPKEYGIEDAEKLDIGLLT
FT                   SLPLAKQILNDIDIMKNKEAPACVAYFTKESHIYTLLNIIYESGIPMRIASNALPEFDY
FT                   LSQINFELYESTDANEVKSHSIRLKMSPGCHTQDPLEVQLDDRHYISCIPKMSLTRHLD
FT                   MEYVQQKLRNKFNRVNMPSKFTPVNITSPNLTFRRESLTKTTTKRVKSGSVSASATSSP
FT                   PPVPLSSNSSSTTSIDNTLGK"
FT   CDS_pept        975007..977817
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000217777" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19349527"
FT                   /locus_tag="CAGL0M09845g"
FT                   /product="Similar to uniprot|Q06078 Saccharomyces
FT                   cerevisiae YLR409c"
FT                   /biological_process="rRNA processing"
FT                   /cellular_component="small-subunit processome"
FT                   /protein_id="CAG62752.1"
FT                   /db_xref="GO:0006364"
FT                   /db_xref="GO:0032040"
FT                   /db_xref="HOGENOM:HBG053553"
FT                   /db_xref="HOGENOM:HBG735132"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR007319"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="UniParc:UPI00003B7183"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJ20"
FT                   /transl_table=1
FT                   /translation="MSEVAKRRKLTSTKRYASKIFSPFRVIGNVSNGTPFAVGSLGSTF
FT                   YIVTSVGKSFQIYDANNLHLLFISDRETDEEISCLEAHFHYVYAGFGGKVGIYKRGILE
FT                   HTIEVGNGCKVTKLCVFGDYLCVSTDNNEVHIFKKENSTTDKYATKFYTKFEIPELVGG
FT                   DIVSVLHMPTYLNKIVVVTKINVLLYNVRSGKLLYSSPDFPDQLTVGEAAPALDIIALG
FT                   TISGEVILFNLRLGRKVRTIKVPNMRISSISFRTDGSSHICVGSSKGDILFYDLNRRAR
FT                   IHLLKNVHSEEFGGVTRASFLNGQPIIVTSGGDNSLKEYVFDPSLSQSDEDMVVQPPRF
FT                   LRSRGGHSQPATSIAFADDESHFILSASRDKSVWAFSLRKDAQSQELSQRLHKKNDGNR
FT                   VAGSTMREKFPEVSSIAIENARIGEWENILTAHNESKAARTWDMRSKRVGRWTFETIDD
FT                   GMVKSVAISQCGNFGFVGSSNGGIGVYNMQSGMLRKKYRLHKRAVTGVAVDGMNRKMVS
FT                   CGLDGIIGFYDFNESKYLGKLQMDAPITSMVYHRSSDLCAFALDDLSIVVVDTVTQKVV
FT                   RQLWGHGNRITAFDFSPDGRWLVSASLDSTIRTWDLPTGSCIDGVKIESVATNLKFSPN
FT                   GDMLATTHVIGNGIFIWTNRAQFKQISTKAIDEDAFQKIMLPNASVSGNSQFLEGAFQD
FT                   GGDDHEPLDINNYQSVEQVNSELVTLSLGPRNKMNTILHLDVIKKRSKPKEAPKKPEKA
FT                   PFFLQLAGDKVGDEASGREGISFETPEEIRAREEKQKQSEEAQAELTKFKPGTNRGFQS
FT                   KFTKLLLHGNKQNQYEEFLEYLVSMSPATLDLEIRSLNSFEPFEEIIAFISALTAGLKT
FT                   NKNYELYEAIMNLLFKAHGDVIHANNTNCDLQDALSQWETVHGTEQKMDELVKFCSSVL
FT                   DFVSRS"
FT   CDS_pept        978062..978382
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000067727" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17440110"
FT                   /locus_tag="CAGL0M09867g"
FT                   /product="Similar to uniprot|Q06071 Saccharomyces
FT                   cerevisiae YLR408c"
FT                   /protein_id="CAG62753.1"
FT                   /db_xref="HOGENOM:HBG059070"
FT                   /db_xref="HOGENOM:HBG202580"
FT                   /db_xref="UniParc:UPI00003B7184"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJ19"
FT                   /transl_table=1
FT                   /translation="MPPSTELDALVDKIVNDHSLSEPGQSLKELGDNGKYIMDVQMKKL
FT                   LKLHDQSFIERCFTPMEELKNRYAKVKERSGDLQKEAELVDRDIRIIEMAIQDINKNKS
FT                   HQ"
FT   CDS_pept        complement(978795..979652)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000142323" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21045138"
FT                   /locus_tag="CAGL0M09889g"
FT                   /product="Similar to uniprot|Q06070 Saccharomyces
FT                   cerevisiae YLR407w"
FT                   /protein_id="CAG62754.1"
FT                   /db_xref="HOGENOM:HBG124127"
FT                   /db_xref="HOGENOM:HBG202579"
FT                   /db_xref="UniParc:UPI00003B7185"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJ18"
FT                   /transl_table=1
FT                   /translation="MIGGKSSPKSMKNSIGSTLRKWRSTLRKVTHDTLNSLDEVTANEE
FT                   KIDALFDGEGGKTVNWGPVRTSKNGLVQVHEEDMLEEDVTNDLKSSSFGFEKSTTAQPV
FT                   GIQGLLKSGSIEQISSGSRSLVGGVGGTSMRLSEESEEGGSTTGTSNKHEQLTIMKSSS
FT                   GGSQGVSHKEKLTYDNFDAVAECNKLRQRSDKPFVGGPKIWEKRRKLWCEPSVSAEEIA
FT                   HRRENGRGVFDAIPEAYHTSVYKKLVVDNKPLKEPLNLSHAMKVINAGWIDTKKWANAG
FT                   KGLP"
FT   CDS_pept        complement(980073..981107)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000203649" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20196352"
FT                   /locus_tag="CAGL0M09911g"
FT                   /product="tRNA-dihydrouridine synthase "
FT                   /EC_number="1.-.-.-"
FT                   /function="flavin adenine dinucleotide binding "
FT                   /function="tRNA dihydrouridine synthase activity "
FT                   /biological_process="oxidation-reduction process "
FT                   /biological_process="tRNA processing"
FT                   /protein_id="CAG62755.1"
FT                   /db_xref="GO:0008033"
FT                   /db_xref="GO:0017150"
FT                   /db_xref="GO:0050660"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG058012"
FT                   /db_xref="HOGENOM:HBG738405"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018517"
FT                   /db_xref="UniParc:UPI00003B7186"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJ17"
FT                   /transl_table=1
FT                   /translation="MIEVPVPKELTKENDPLHIIKTRAQTHGRPATIAGPMVRYSKLPF
FT                   RQTCRQYDTDIVYTPMILAREFVRNQQARIADLTTNKNDTPLIVQVGVNNVGDLMKFAE
FT                   MVAPFCDGIGINCGCPIREQIREGIGCALIYNPDLLCEMVKSVKSKYGAKLRLETKIRI
FT                   HDDWDVTVNLCRRLCDSGVDWITIHGRTRTTRSSQPVNLEAIKYIVDKIKDKNVPVVAN
FT                   GDCFTMKDFKHISDYTGVQGVMAVRGVLANPALFAGHDKCPWGCVEWFWYWTTEYNTLP
FT                   FALTQHHLYCMLENMGIRRKLLKEMMLQRSYPELLDWFDTNFVMHRHGDKEFGTTIDPQ
FT                   LKTN"
FT   CDS_pept        complement(981376..982197)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000001144" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17440111"
FT                   /locus_tag="CAGL0M09933g"
FT                   /product="Similar to uniprot|Q06058 Saccharomyces
FT                   cerevisiae YLR404w"
FT                   /protein_id="CAG62756.1"
FT                   /db_xref="HOGENOM:HBG124128"
FT                   /db_xref="HOGENOM:HBG202577"
FT                   /db_xref="UniParc:UPI00003B7187"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJ16"
FT                   /transl_table=1
FT                   /translation="MKFNLTRPLQIAQWVSYILGVGILQIVVILPLAVLLFHDFYTRLL
FT                   PSDSSVWVPLDNFNSNASGLNTRFKQGIVCVSPDKQLPGLKPNGLSQPIALRCHTNYKL
FT                   DMKLEFYCHSLDAIGNSKGTDLQYAVVSLSDDSNLFYRYRQPVICRNQGATNVLEGNNH
FT                   AKSRMEVLRNEWLNSLSLEDIADISPQLENIEISIDLPNSNGEILLEPTSGILLRRSFE
FT                   QGLRNWMLRRWRTTYIIGTAVFYISLSFIFVITCMATFLIFTKVYGKHQKQ"
FT   CDS_pept        complement(982943..984334)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000246749" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17440112"
FT                   /locus_tag="CAGL0M09955g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /function="nucleic acid binding"
FT                   /function="zinc ion binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAG62757.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG190857"
FT                   /db_xref="HOGENOM:HBG396734"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="UniParc:UPI00003B7188"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJ15"
FT                   /transl_table=1
FT                   /translation="MEYNSLMMDAHDVGEYEMGDAFKATHLNVKDGGGQRMSYSVSPSS
FT                   RPLMTAGEEVVHHIPTRGPSDAQAARLRRDSIAHSQGIGGVSWGSLSISSWLRDEVMLQ
FT                   HPSSQQSYQNQERKFSINNGLLQIQMNAPIGQGPISASTNTFLPHLEEQYCKDYSCCGI
FT                   SLPGLHDLLRHYEEAHISTSPGTSMSRPVGGSDASMGMSTGTVQTRNLMDRSMGSHGMS
FT                   PPTPMSSQSKIGSNTSINMHQISGANNNNNIKSKYMVNRGHNSNNIVDTVSTNEVFLNN
FT                   GRGTTSMETSRGTQPIHKHAHPQALQNMMMPPNNGSTQGLHSSNVDIAIDDDDDDEDDD
FT                   DDDEDDEEEEEQDKKEFYIDDPARRLYVMDHEEYKPFKCPVIGCDKTYKNQNGLKYHRL
FT                   HGHQNQTLRENADGTFSVIDPESNEVSTLDAMGNDKDKPYRCEVCGKRYKNLNGLKYHR
FT                   GHSTH"
FT   CDS_pept        984997..986919
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000240610" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17440113"
FT                   /gene_name="DUS3"
FT                   /locus_tag="CAGL0M09977g"
FT                   /product="tRNA-dihydrouridine synthase 3 "
FT                   /EC_number="1.-.-.-"
FT                   /function="flavin adenine dinucleotide binding "
FT                   /function="nucleic acid binding"
FT                   /function="tRNA dihydrouridine synthase activity "
FT                   /function="zinc ion binding"
FT                   /biological_process="oxidation-reduction process "
FT                   /biological_process="tRNA processing"
FT                   /cellular_component="cytoplasm"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG62758.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0008033"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0017150"
FT                   /db_xref="GO:0050660"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG014348"
FT                   /db_xref="HOGENOM:HBG521382"
FT                   /db_xref="InterPro:IPR000571"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018517"
FT                   /db_xref="UniParc:UPI00003B7189"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FJ14"
FT                   /transl_table=1
FT                   /translation="MKRELEGSYESERKRGVAQVKAEYVVGAASNVRVDEEEAGSERFV
FT                   QGEFGGKKNKKKRGQNKNRDNRQQKETHALCPKYVLADVTNQVDLCTFGDNCRFVHDIP
FT                   TYLEHKRPEITDSVFKTCPVFETLGYCPMGFKCRFLSSHMDKETHKLLGEYPSDLASAS
FT                   HEINHITQDQKYDLIKKRFPFSKSELVLEILDSFQEENREMHREAEKVKEDQQDNEDEQ
FT                   KEKAPQVVQRELEAQKRRQRQKDLYLQYKDTRFFAQEKKPLDLRHKKIVSPLTTVGNLP
FT                   YRRLMRTLGADVTYSEMALAVPLVQGTNSEWALPKAHESEYPGFGVQVACSKGWQASKA
FT                   AEALATYIPNGISEINLNSGCPIDLLYRQGSGSALLDNPARMIRCLNAMNYVSGDIPIT
FT                   VKIRTGTKEGHPIADTLVRRLVFETDVAAITLHGRSRQQRYTKVADWDYVSQVAKALRQ
FT                   AEADFMESPQGKESHHDEKTRHTQFVGNGDIFNYTDWYQHLEDPEVDSCMVARGALIKP
FT                   WIFEEINAQQHLDKTSSERLEILKTYSKFAMDHWGTDEYGIALGRRFFCEFMSFFHRYI
FT                   PVGILERVPVQLNERPPLWKGRDDMETLLGSSDVKDWIKLSEMFFGPTEDSFVFTPKHK
FT                   SSSYK"
FT   CDS_pept        987540..996914
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000113101" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19349528"
FT                   /locus_tag="CAGL0M09999g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /function="GTPase activator activity"
FT                   /biological_process="regulation of small GTPase mediated
FT                   signal transduction"
FT                   /biological_process="signal transduction"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAG62759.1"
FT                   /db_xref="GO:0005096"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0007165"
FT                   /db_xref="GO:0051056"
FT                   /db_xref="HOGENOM:HBG059043"
FT                   /db_xref="HOGENOM:HBG204174"
FT                   /db_xref="InterPro:IPR001936"
FT                   /db_xref="InterPro:IPR008936"
FT                   /db_xref="InterPro:IPR023152"
FT                   /db_xref="UniParc:UPI00003B718A"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJ13"
FT                   /transl_table=1
FT                   /translation="MSHFGKSGHRRFSSSGNKPDSRHVSAHHRVPPPRPPRPTTPITNA
FT                   TPNVLSPESGQSSAGSRGSHRQSLSNPIGKSKMTETLVYHLFFDRILPVLPVESTLTTY
FT                   REVESDQFFISCRGVIMNVALSRDLNPVIDYSLQLIESLTESRELISDEINEDVAQSVL
FT                   VLLRLLSDTLEFCWESKESPEDKVKDEPSFENIPIDDNKEYVNMGEQARAGNMFTGSTI
FT                   GYSTHKPGFHRVPPPQIDSTLATRLLSVCTRLKYNTRTLRVLKNMSKNLYGNGTITYSS
FT                   VLPKFQAWLKYHNYPKYTETVDLTIDYILRFIAAANPADYDKYVDSKVTNPLLISHTLT
FT                   ELGIVKYLDFFGCVFLTPENVGPFLETLRHLSGFMKRTIFHSLLLYYSSKAFLFWILSR
FT                   PNEYVQLYYALQNLDSSKSNTFHQGNSNSSIATIPYCVSVLFDDIYSTFNVSSLLTNIY
FT                   DTRGHNGSTTQPVETEQSQATSPGSTNPVLFSPTLTSNDGIITSPTMGSNQIASPLSPL
FT                   PMSLDFNSRTQAQGFPLEETASIHSSKRSYNIDESVYSTMGSTHSNINTPTTNASFTHP
FT                   NEDEIPTSGSGHLQYVLELFSNYEETELSSHTSILRFLLSLILLDTDVFTDINAMTFRY
FT                   IPDTSKIIQQYSQKQGTRDAGAGTHMQNDDPSKEKEKNQSIKQITHGLKKLTNLSSSKK
FT                   KTVKFITMLIRNLNGAQMVSDVSLVDSLKTLVALVTLTSSISLIDSNLPSVLFAKRIFS
FT                   ILGHNLDVGKNWESKTNGFIASCTERNPISHRRLQLEFFAAAIQLDSDKLLSHIHLERE
FT                   LAGLNLRRLLLYTEGFKVFFNLLSSDVLRKKVALSSSNFLKSLFCIIADILLKAFPYFD
FT                   AKVTSIVSSILDGSILEKYDTIKTLAGLEPSNPPVLDRTDSSVKLKLQKKITNWDVHEV
FT                   LPTLSAVSSSSDINLSDTGKSIAESTERRSNTSTPAHTSTPANLTHNPLSTIASPPSTP
FT                   GSIGNYRNNPGMNVLSPHARRLQNVKIDSPQVEGERTRQSPYYFGATSTGEYSNQSVSH
FT                   SSLPKTTRSSGSQEKSRRSSDDKNKPQLKMQDSDDVIVLKTNENDDARRIMINIFSIFK
FT                   KMTNYFILPHDQNLNTIWVSKDFRNIMKPIFVAIIDTDTRLQTTAQSFMDVLIRYISKF
FT                   SSDITARSLNEHYLLCNYTITLFAASLFDLKLDNKKREIILRIVVKFLNVKSDLSRIAA
FT                   QKDLQYALYSTELVTFPLLTATVGGGLFISLYCNKGEIPRLLKKGFGEFLFAINCYEKH
FT                   VGEIDRTCIYNLGFIVAMSRDNYAASGSVAFQRRLRNKILHHIKRPDTILLDAMDVIYR
FT                   KWSSYMRKENITQEELIDFRSLAGILASMSGILLSFGETSTDNVPHLFEFRGDLIKKMD
FT                   YFVFKQCQWLNNPDLLTRENSRDILSMELHPLSFNILFDNLRIKIEELRSVNLSQKVHE
FT                   SSFVLLEQIITIVRTVLNRDDDERIMLLFSIRVVSTIDQLSDLVEKIPHSSVKYYKAII
FT                   QMAKLFRAIQHSEISLGIKNHFYLKNKWLKLLTNWFKVTISIDYDFDNLSKPLREMDLK
FT                   KRDLDFLYIDTAIETSKAVAYLTENVPLDIPPSASKDELERASTIVFGNYFTIFLKGLE
FT                   KSTDIQRFPVSLKHKITILNENVILSLTNLSNANVDASLQFTLPMGYSKDKNIRIAFLK
FT                   VFINIVTNYPKLKVESERKKLYAVDQLVQYLIEHPHLAFQAGIICPASDVDAFVAGLVN
FT                   GFDSRNASHILVTQLIKDEIDRASRYADVLRRNSCATRALSLYARSKGQSYLVRTLKPV
FT                   LDEFFESRDSFEIEKILPDDPEAEKNVDMFIHYMSKLINAITESVDYFPPELINICQTI
FT                   FHSVKEKFPDYSFIAVGSFVFLRFLGPAIVSPDAENIILISQTRDKRPLITLAKVLQNM
FT                   ANGSENLTRWPILNKKLDIFKDFSNRIFEFLSKICTIDSKPNIEIRRDPEPYYFEFNFL
FT                   HKFLYEHELEIRKMIVESLVSLDDFDYVRKTFLFVDDIMGVLGRPKVELKNEIPPYIVE
FT                   HMEENPHLYEFMNRNAFKNVSLGDEYEPFMHESMSLDGLPIITITFRKFEAENIEVDAI
FT                   VYRTIQVYSKMWMTKHYLVLDCTGSDSIDMNYNKLTSLFFSLLPDIAIENCIGAIYFNV
FT                   SENFMNQWVNVLRGDNPYLVAQVPHHFINSSSDQEQVKTLGLTGKGADVVQDTRVSLHD
FT                   ISLYHEDTKNLENVSLKIGNRYIQILHEATKQYKLHALNQILNIPFNDVYEIVDLATVG
FT                   VSSITGLPNEFTINFINGKRLVLVSKKYLEIVKMFNYAQLKIEDEYGTESQNRELTSTH
FT                   EESYVKESQEIICHLSLVILNGLFNDDNEVKNISYNLLVVTQNAFNLNFGSRFQKAPEV
FT                   YVPDNTTTFLSTIARALAESSPELTLHMWTYFLEGLENDVIPHEHIPTIICCLSYWVPN
FT                   LYRYVYLVDEEEGANNLSKIIRSLIQLTVKDPDFTTVYLQQIWFLLVLDDRLTSVTVEE
FT                   FVTHALDRDSESRDWKKAVSLLTAFPTVEVACQVIGKLMDIIKSFLPSLKMEVSTHSWS
FT                   ELEILVRISVSLFFESPLLTQMCLPEVLFIISLLIDIGPTHIRYCLHELLMNICHSLMI
FT                   NSSLPKENSERLDGICAVFARQKLNFMSGFSQEKGRILPNFSASSFSSKFGTLDHFVTN
FT                   VFKLMEYGSTSEAAQWKTKYKKYLLGCVFNHESFLSARAIMILGIIGKIDTNEILCRDL
FT                   LAETMKIFAEPVVTDEQLFVGISHIFTYSKIVAGLDPAGQMLPRMFWLATVFVESPHPI
FT                   LFEGGLQFLINCLKHLYEYHYKINNTEKLISELLIESRSFASELLEELEGYTDCLWTKD
FT                   NFEHLILGFITRGLSLAVLRGVALDCLMTAFKYSFREHQMIPRTSHHLNYLFLLYLVSN
FT                   QETFLNLLDSVGFESDYIELDDNIKIPRALVEWISSDNECSNITLYQGALLFASPASDE
FT                   PSKLRFELLTRYLLGISPKCVFRYYFVTRQELRRISSLEQQSDSSTIAFEIAGMLVMHD
FT                   DFDILDIYNKDSVQLLKSRGLFSLTKVNIFGRSFEDIMNSLQENSDQIYNRKRLTTLII
FT                   SKIIYQSQLTL"
FT   CDS_pept        997486..998997
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000141996" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17440114"
FT                   /locus_tag="CAGL0M10021g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /protein_id="CAG62760.1"
FT                   /db_xref="HOGENOM:HBG252654"
FT                   /db_xref="UniParc:UPI00003B718B"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJ12"
FT                   /transl_table=1
FT                   /translation="MDDQTRLRVFEPLDCNSFVSATPNSTHLSKLSVQTPTTSSFIRNP
FT                   YERDQTALENQSGSELLRWKYDQREFMFNSNSTPSKNSNSQTEKYEFPITEKLVKNKNP
FT                   GCKRRTNQLIGAKPSRPSGLQNVTSKLELLDETHFTSLPIPAPKGTKIDNSAILSDIID
FT                   DNSDDIITADDSVILPSKRSFRTPANEIKVHNNGNKRYISYKYSNRYPERESSPSEQMI
FT                   SSGKDTHPIVIVEDYLLSDSERSFTESTRKRKRYNSNNDGLKPKLSLHNLKTKIRSSNT
FT                   DHLPVKKKVHYLKECSTVDSSTNEENEAGSSKCIKEVLNEFLPPKSNSADCDLYISNLL
FT                   SKGTNELKRCVICEKILYEVSSLLYKENDFKELVCGSCTEKYETIAKLLEGCELESTFE
FT                   YSLDSSSFEANTLDSSLIQSSHTVCREVTPPHNSSLQHMRRDSFSEDLIKALQSQLIKN
FT                   SKQIPENSIFPNKALSWFIDARRKLRWRWRVSGLLPEFTINNNNE"
FT   CDS_pept        complement(999113..1001089)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248811" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17440115"
FT                   /locus_tag="CAGL0M10043g"
FT                   /product="Similar to uniprot|Q04093 Saccharomyces
FT                   cerevisiae YDR444w"
FT                   /protein_id="CAG62761.1"
FT                   /db_xref="HOGENOM:HBG058543"
FT                   /db_xref="HOGENOM:HBG396896"
FT                   /db_xref="InterPro:IPR007751"
FT                   /db_xref="InterPro:IPR016445"
FT                   /db_xref="UniParc:UPI00003B718C"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJ11"
FT                   /transl_table=1
FT                   /translation="MKKDGGLLLVHEKNSLGIGGMCRYILQVDHKKLKEDGIDTQELYL
FT                   RFKNLESPLLRPVYLTGPYAFYIDVRPCNYDEDKTYIGSEDVAFCSDLKPDEKFKAKLY
FT                   FNANSRLQTKNARDEIYSWTIDIISQLAVVTFPILKYSFKVGTSKKIVKKSKGKKVTSV
FT                   RGLSLKMWDEKSLWNLPPKYPDKPIHLVILTHGIFSNVGCDMLYMKDKIEQTAMNIEER
FT                   YNPNVVVRGCMDNMGKSAHGIYYLGKRLAKFVVRTVEELRKEYHVDKISFIGHSLGGPT
FT                   QSMAIHYISVMYPDFFNTVSGIKPMHFIALASPFIGVIGDFPLYLSVPLDMGALGLTGR
FT                   DLNLKYTPLTSNEGLSALTLAQENSHLPKNILEIIPQPPAQQVFQLFMNRTLYANIVHD
FT                   GIVPLRTAALLYLDWRSLTQVKDIKKSAGEKSNNKITEDSPTDNESVSTTNKDNKMGEI
FT                   PSESPNSKNFLQWALPQVIIKGPKMNKFKRGQIMDTKSNESSDTDTESSDSKQEQKFKG
FT                   PSEASTFMSALSTLTAPVPTQEYIKNPKVRKDRVVHDRVYEPQDLPEQHYLKRSTMKRV
FT                   VYPNESVNRIQERIARAWQMNMSWRKVLVEIQPDSHNNIVVRRRFVNLYGNVAVSHMVR
FT                   EHFGLEACKKQAGVNNNIKLTKL"
FT   CDS_pept        1002184..1002933
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000208631" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21045139"
FT                   /locus_tag="CAGL0M10065g"
FT                   /product="Similar to KLLA0F09251g Kluyveromyces lactis "
FT                   /protein_id="CAG62762.1"
FT                   /db_xref="HOGENOM:HBG051803"
FT                   /db_xref="HOGENOM:HBG618397"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR010400"
FT                   /db_xref="UniParc:UPI00003B718D"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJ10"
FT                   /transl_table=1
FT                   /translation="MSHHCEDEHFEHDHDHDHGHDHGHSHEAPIATSAAQSLYEQIDTP
FT                   KIKCLNGVGKGATGKELYKYFIKPHEEKYNTEIYLESDADCQLIINIPFVNSCKVHSVV
FT                   LRTNANSSGYSTPRTIKIFNNFKKSLDFDTLSGESKVDFKTEHPNNVGVHKGEASVTED
FT                   SSFVEYHLPRAQFQNCESLTLFIEDNWADDEDELSQLFFLEIRGEITGKLRPENAVPLM
FT                   TVYESAPNPLDHAKLESEVSDGLNLGK"
FT   CDS_pept        1005238..1006344
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21045140"
FT                   /locus_tag="CAGL0M10087g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /function="protein dimerization activity"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="sequence-specific DNA binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /protein_id="CAG62763.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0043565"
FT                   /db_xref="GO:0046983"
FT                   /db_xref="HOGENOM:HBG124129"
FT                   /db_xref="InterPro:IPR004827"
FT                   /db_xref="InterPro:IPR011616"
FT                   /db_xref="UniParc:UPI00003B718E"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJ09"
FT                   /transl_table=1
FT                   /translation="MNNEPFDILGLMQGPHFSNSGDDIYTNGRMEVKYPPIGIDDEGQN
FT                   ISGNGIGLDYAPFTPAGLSGSGQSAMANFQQQNNINSAGFQTQLTPSNIELHNNLQNLR
FT                   TPPDIIKTEQSISPNLDFSTSINGNFNTNNSISGDSNNDKLNTTARSTFSHHRENSNPG
FT                   DNIDDKKKAQNRAAQRAFRERKEAKFKELQRKVRESEIDRDQLLKELEKLRKWNMEINA
FT                   ENRKLLQKERLGNNGVYSGNMECSSSQSLPNMEQTTYIFPSTNECFEQSINQKNLRDKN
FT                   PEQIFERKPVYSAAGRFLQYEDEYPDDVLLTVPETWEYLSQLSENEEFDVHEVMERLVG
FT                   LEQCHPSGPAYSKQRIDNLVKQSIENNR"
FT   CDS_pept        1006975..1008366
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21045141"
FT                   /locus_tag="CAGL0M10109g"
FT                   /product="Similar to uniprot|P36075 Saccharomyces
FT                   cerevisiae YKL090w"
FT                   /protein_id="CAG62764.1"
FT                   /db_xref="HOGENOM:HBG252601"
FT                   /db_xref="InterPro:IPR002625"
FT                   /db_xref="InterPro:IPR003892"
FT                   /db_xref="UniParc:UPI00003B718F"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJ08"
FT                   /transl_table=1
FT                   /translation="MAADNNLLMQLAEMFPDHRLETLARCLEDSNNDVNLACSMVISGT
FT                   HISVGEDLHNDNTTLDELYSLFPQIPRDDIQTAYYEHKGNKEKLFDSNEVVLELLSLES
FT                   IRNQKLEIDQPVLSSTVKADENTSKWGKTHNNIETIIRYTNVDRERASKYYTNNLFSAP
FT                   LAIISIIRDGYEQPIISKTNTTNRKTAFRKGAIRGGRVQSSHGIAHRKQNGLDLKTENS
FT                   FEHLCDVTDNMSDTISTVEAPTYEDVADLKKLLSGEQTLSAFNMEFINKAYRYYHLNLD
FT                   KLASLINYLKLNSASKLTFITAEKMSAESLQHSTDDVGMRVPYSKTIKKKSTVNTSPAL
FT                   TKNMIQGKENFQIANKMVVEFFNTYKLDFHGFLPQEAVRIADICLTQWWAEELSNRELN
FT                   AGKLNMKKSQYMSPVTLITGRGIHSAGGFSKVRIAIVKYLQNNYYIFEEFPSYFIVNGK
FT                   GKVFG"
FT   CDS_pept        1008833..1010461
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000001083" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17440116"
FT                   /locus_tag="CAGL0M10131g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /function="DNA binding"
FT                   /protein_id="CAG62765.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="HOGENOM:HBG058165"
FT                   /db_xref="HOGENOM:HBG202317"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR017956"
FT                   /db_xref="UniParc:UPI00003B7190"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJ07"
FT                   /transl_table=1
FT                   /translation="MDYMNLGLRSRKTGIDVKKNLAKDEYSMENIDDFFKDDDTSFLSR
FT                   RKSRKSSLLPEADIQNRILPSPLTKQHNVRDTDGFKVPQNINVSHRSTIERAPTEFQHS
FT                   VISEDIPEVIPYEGQSATPDRNIEPIDEDELANMPKPRYRSQYNLGAGNDDTDLINLTP
FT                   EKDGRGTYNDVPDLIDDEGDTSKDNTTFNTSDHAMLEDEVEDGFVLESEEDRDYMESDE
FT                   GSLADDTDDASDSGDDIGTQFAAEINRPGNESPLSSDDEDYISENSTGHNRLEDEIDNP
FT                   SLPTRLSKPYDIVDGVRRSKRVKIPPLEYWRNEKIQYKRRRNEPVLDIDKVITYNHSES
FT                   EEESEEEQKKVKKQRKPVTRTRPYNYVPNGRPRGRPRKNISDDPNGNLIRKIENGEEPK
FT                   GEWLKHGMLEATVKNLHGEAKTELVAMAPNVSQSEETKASGEDDYSIEILFDKYNEAFA
FT                   SGMLKVPVDGRKSPADSNTAFITFHVLDGIVEVTLDGKNFICTKGSSFQIPAYNEYAFA
FT                   NIGSNEVRMFFVQVSPPSDFYSEHY"
FT   CDS_pept        complement(1010688..1013291)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17440117"
FT                   /locus_tag="CAGL0M10153g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="CAG62766.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="HOGENOM:HBG203842"
FT                   /db_xref="HOGENOM:HBG537393"
FT                   /db_xref="InterPro:IPR000095"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR015750"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI00003B7191"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJ06"
FT                   /transl_table=1
FT                   /translation="MSAELKSHKLDRSIGSNKAGHEHPISRNYVNNVHNANKHKLSDYP
FT                   MMLTITHIGTSRLSSSSSSSSSSSSNSSSSSSYSRGFISDNLSEYRSMDPKSPNRPVRY
FT                   RSIHSKYTSIREDTQHELVTDKEEIQNNKEVSINILSKPNKHTSIDYHNQGVDTTYQIN
FT                   SGQISRHKQMSKSLPNTPKPLQYQKSLSLSHSPRKLSLKSPSRNFSFKSNSKLNVGTKH
FT                   DQEKKRPVKMKEVFSLFVNSIKVSNNSNNSNDRSDQEVPPKHDLKKVKSISKPYNPKHV
FT                   HHVGFDPVTGDYIGLPEKWQALLESNGITKKEQEKDIKTLLNVVQFYQDVSASKTTDKL
FT                   LQTFPLEKGTICVDDTQVSTPSNITSSADDDAAKPSFNESLMPAISIESRHKNEVNQLI
FT                   LKESFSTEDKFIPSRPAPKPPALQELKAIPPKSPNRPKATRVKNNSSKITSVNSLPNNG
FT                   EPTVQFSNDQKSHKSQRVGTSTDTFRFEKSLSGNKKTISITSTSTSTSKHPTNYRESWG
FT                   IKGHTDKKENSNVIKRDEGNKKAEKDKRMQVVLSRLSKICTPGTPEDKFETYLKIGQGA
FT                   SGGVYLSHSRSDKSQCVAIKQMNLEKQPKKELIVNEIMVMSSSKHQNIVNYIDSYLSGL
FT                   DLWVVMEYMEGGCLTDVVTYCVLTEGQIGAVCREVLQGLEFLHSKGVLHRDIKSDNVLL
FT                   SMNGDIKLTDFGFCAQVNDTVIKRTTMVGTPYWMAPEIVSRKEYGPKVDIWSLGIMIIE
FT                   MIEGEPPYLNETPLRALYLIATNGRPEVQEPDRLSKDFKEFIDKCLAVTVSERAESSEL
FT                   LQHKFITEVAENTEGLSALVKFSRMKKAAEQNSDSEGRSSSSSSKAVASVESGIQ"
FT   CDS_pept        complement(1014414..1018844)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000142004" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17440118"
FT                   /locus_tag="CAGL0M10175g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /function="acid-amino acid ligase activity"
FT                   /function="binding"
FT                   /biological_process="protein modification process "
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAG62767.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0006464"
FT                   /db_xref="GO:0016881"
FT                   /db_xref="HOGENOM:HBG058164"
FT                   /db_xref="HOGENOM:HBG202351"
FT                   /db_xref="InterPro:IPR000569"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI00003B7192"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJ05"
FT                   /transl_table=1
FT                   /translation="MDDHSTDYEMDDHYTDGEEDEVQYVYPDGEEEDSDDDGLGDDYDG
FT                   EGDGMFHSLDEDEDHEGVEDDIDEEIDGDGFDVEGAIPAAFGGRRVRVATQPAMNLQEL
FT                   LGTLSQHMGQAQQNRRNTTNAGDTSTPPANATFSDFISMFSSRMAREGGTGSRNSRMVK
FT                   LVENIANASEDSYIAMESLREISENLLMTNQLLLDRIIPMDELLVAVIDILKDPMLSQE
FT                   SELQVQACRCLHNLYEVNIDSMSSSVDQNIIQILQDKLQQIDFIDLAEQVLETLEYLSR
FT                   IQGKDICRNGEMSIYIRYYDFFTVHAQRKAVYIVTNALTNAIEADFVNIKEVFPSLTQI
FT                   FMNTNDSNVISHILNAYTGVCRNIKNSDQLVSLFLPSLFDKILQILSNVDSQLEDKLKC
FT                   INIMTLLVSQCLDLKRHFLRREEPVQDIMLCLNVYAKNNSTKINDKLMFVPKKLLLSVT
FT                   RFITALLPSEEDSLLSNNVLTEVEIDGSNIYLDRIFKDLTPLLIELYGNTTDFEMKEYV
FT                   LVCMARISTHTKQTDVQKLCKHLLPCLASILSHIQNNDLLATSLDNIISDKQMEQWILC
FT                   TATLSILRILLNKFGDVVANSMKREGINIMINSISEKVKEFTGLNLRSIELKHVSHDNN
FT                   EDESSDSDSANNEDNYDISVPDYVKPKAIKFNLLSYPSPEKTLKYLELYCDELTDIAPL
FT                   YRTNSNEELDSIKQTINFMADIEVETFDAEKCDKLWRMLYSNIFGNDEELSGFEMISTG
FT                   LGKAVATLLEQLSNNYQIRKSFEKIFSSKAINLVTLLQSTLNRVENFPIIDSGISGESG
FT                   VSLLTKLLKLELVIDENLEELGLPKNLETTNVQIHCIATYTNLKDFIKQRFLKVQFLDN
FT                   LLPNSSIRNNESNPNSADALDSLLKEKNMEFYFEDYQIDSNDTIFGGLLKAYEKLDKSI
FT                   RDVWQKSQRIKVKFVSKSDKFEETQGDEKESISRMKSSTPADHDDPALDILKILKFLHN
FT                   CSISAENFVNTKLSSKLARQLDEPLIVLSIRLPEWATLLTKEFSFLFPFETRMFALQCI
FT                   SFDQGRLIQLWKSRVDSSSKINTDEQLEHLGRVVRHKLRIPRKDMFSTGVKVLKRFGGD
FT                   STVMEVEYIDEVGTGLGPTLEFYAIISKEFARKSLNMWHCLDDNMKHVADGTPNDNTMS
FT                   EVYVLNPLFPAPMIPEEKKRDEVLDLFNQLGVFVARSLYDNRILDFRFNPVFFMLCHAI
FT                   TKNEGLSTLTLDSDQVYQQLSILANIDSQLAASLRYIYNNRTNTPLIKSLSLTFTLPGY
FT                   NFELVEHGNDHAVDDLTSVEKYISLVLDMFLGTGIAPQLNSFIDGFSRLFPYKNMLLFS
FT                   PNEIADLFGRVEEDWSPETLFTYLVADHGYTMDSPTIRDLISIISTFDNQEKRMFLQFL
FT                   TGSPKLPLGGFKSLKPKLTVVLKHAEDGLQPDDYLPSVMTCANYLKLPKYSSREVMRQQ
FT                   ILTAMTEGADSFQLS"
FT   CDS_pept        1019623..1020342
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000177263" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20196353"
FT                   /gene_name="MRT4"
FT                   /locus_tag="CAGL0M10197g"
FT                   /product="mRNA turnover protein 4 homolog "
FT                   /biological_process="ribosome biogenesis"
FT                   /cellular_component="nucleolus"
FT                   /protein_id="CAG62768.1"
FT                   /db_xref="GO:0005730"
FT                   /db_xref="GO:0042254"
FT                   /db_xref="HOGENOM:HBG028195"
FT                   /db_xref="HOGENOM:HBG628300"
FT                   /db_xref="InterPro:IPR001790"
FT                   /db_xref="UniParc:UPI00003B7193"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FJ04"
FT                   /transl_table=1
FT                   /translation="MPRSKRSKLVTLAQTDKKGRENKERIFDEVREALDTYKYVFVLQL
FT                   DDVRTPVLQEIREAWVGSKLLMGKRKVLEKALGTTREQEYKENLSKLTKYCSGVIGLLF
FT                   TNETLDTVKEYFEAYSRLDYSRPNSRAPITFEVPEGIVYSRGGQIPIEEDVPMAHSLEP
FT                   TLRNKYEMPTKIKAGKITLEAPYLVCKEGQKLDVRQALILKQFGVALAQFKVIISAYYD
FT                   NESSTVSELNINKKQDA"
FT   CDS_pept        complement(1020895..1022088)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000216359" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17440119"
FT                   /locus_tag="CAGL0M10219g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAG62769.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG058582"
FT                   /db_xref="HOGENOM:HBG738741"
FT                   /db_xref="InterPro:IPR006634"
FT                   /db_xref="InterPro:IPR013599"
FT                   /db_xref="InterPro:IPR016439"
FT                   /db_xref="UniParc:UPI00003B7194"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJ03"
FT                   /transl_table=1
FT                   /translation="MLKVETKQRPRRASSVGNIDLGDTVPGFATMHESKASKVAAKRRH
FT                   ERLATQRNLKMTTKLYLKARDYNYHHMWFLPLCILILTYAAYFGISNKRVKGFLHMFVA
FT                   ISYEQESNPQYYGKGIKDLAFVFFHMIFFTFLREFLMDVIIRRITQWLNITSKYKIKRM
FT                   MEQMFSIFYYGFSSPFGVYVMYHSDLWYFRTNTMYNTYPDILIPKLFKAFYLIQAAFWA
FT                   QQAFVLVLQLEKPRKDHKELCFHHVVTLLLIWSSYVFHFHKMGLAVYITMDVSDFFLAL
FT                   SKTLNYIDSPLTEVVFGMFVLVWIYLRHVINGKILWSVLTEFRTEGPYILNFATQQYKC
FT                   WISLPIVFVLIFALQVLNIYWLFLIFKVLYKIVWQGVTEDVRSDEETDSGSDELKKD"
FT   CDS_pept        complement(1023374..1023655)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000215577" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19349529"
FT                   /locus_tag="CAGL0M10235g"
FT                   /product="Similar to uniprot|P43682 Saccharomyces
FT                   cerevisiae YKL006ca SFT1"
FT                   /protein_id="CAR58077.1"
FT                   /db_xref="HOGENOM:HBG398768"
FT                   /db_xref="InterPro:IPR000727"
FT                   /db_xref="UniParc:UPI00017BD8F6"
FT                   /db_xref="UniProtKB/TrEMBL:B4UN61"
FT                   /transl_table=1
FT                   /translation="MSRYQEADNDKKLESLATKLSTFRNINEDIGRQAQIDSSVIDSIS
FT                   ESFSSLLNDLKNSSSRLTRSMSMGSGVWRMVFIALSVFFIIYTLYKFF"
FT   CDS_pept        1025157..1025570
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000201693" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19349530"
FT                   /locus_tag="CAGL0M10241g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="CAG62770.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG166121"
FT                   /db_xref="HOGENOM:HBG499844"
FT                   /db_xref="InterPro:IPR002784"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="UniParc:UPI00003B7195"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJ02"
FT                   /transl_table=1
FT                   /translation="MSSTTVRNSNWRLVEVGRVVLVKKGQSAGKLAAIVEIIDQKQVLI
FT                   DGPETGVPRQSINLGQVVLTPLTFTLPRGARTSIVSKKWAAAQVTESWKASSWAKKIAQ
FT                   RERRSALSDFERFQVMVLKKQKRYTVKKALAKA"
FT   CDS_pept        complement(1027450..1027902)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21045142"
FT                   /locus_tag="CAGL0M10263g"
FT                   /product="Similar to uniprot|P25565 Saccharomyces
FT                   cerevisiae YCL002c"
FT                   /protein_id="CAG62771.1"
FT                   /db_xref="HOGENOM:HBG124130"
FT                   /db_xref="UniParc:UPI00003B7196"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJ01"
FT                   /transl_table=1
FT                   /translation="MLAVSSIVFFNCGNTELLETLSNESLLLICIFLMILILSYFTYIC
FT                   AEYNLPERNNGRFGGYYIEYVNYLWVIGQFLSAVKYLPQISLNWMGISTKGLPPKYLKI
FT                   SIIATSVLQASNLRTFIDNLEFYQWSFNPTPRMVSFLQLIWLGIIY"
FT   CDS_pept        complement(1029427..1031250)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17440120"
FT                   /gene_name="BYE1"
FT                   /locus_tag="CAGL0M10285g"
FT                   /product="Transcription factor BYE1 "
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription "
FT                   /biological_process="transcription"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG62772.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006350"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0045449"
FT                   /db_xref="HOGENOM:HBG124131"
FT                   /db_xref="InterPro:IPR001965"
FT                   /db_xref="InterPro:IPR003618"
FT                   /db_xref="InterPro:IPR011011"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR019786"
FT                   /db_xref="InterPro:IPR019787"
FT                   /db_xref="UniParc:UPI00003B7197"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FJ00"
FT                   /transl_table=1
FT                   /translation="MESLRKSSRSTKGKNTYLEVLRRQEEEEYEQRVNRPKKEKVQEIV
FT                   HCSPCGTTDANYVEDEDPYGEMIQCDQCDTWQHINCMLQVKDIKVPKELENSDDVDSLS
FT                   KLLVNSEDKYYCDRCIYKSQLREERRAYKELNKSEMIGDNDILDEPKEHPDEYVDDQDE
FT                   DQDFILSKDTANIAEVDDDEFVENDDNRVKKDKRKRKPSNSAITTTKTVPKKKARVITD
FT                   DQTETETIPSEDSYAKVRTNARKMLVTLFKNYIIPDTLKNNVFEIVKGHDEQSISDEFA
FT                   EEMESKLFSHCRSISNYKTLISVYTEKVRVLFSNLKDPKNLSLKEAVINRQLDLEQLVS
FT                   MSATDLANPDLQSMKKKIDSQKIDSLVIPNQPLDKLKQDNSEDDHNSFEFTNPTFTKTF
FT                   NPKDIHESNSNNRPYTTDSPTNSYTDEPDSMKSDSNNGVDTNDQNILNVKFKLDYNEVD
FT                   LNVVGTFKFLGSTLLDENQEHKIYQAVVGDGKLIYEGRLHTKIATEYISEIKTTRAVLA
FT                   YQLLPSASHREKYEQLVEFMDDLDRVLGMKPRKPYVKNMYILSSLLGKLPDILQILTTD
FT                   ESIAKKRIDLSRINDNDKTLYLVVVVKPEIV"
FT   CDS_pept        1032001..1033347
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000196614" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18501707"
FT                   /locus_tag="CAGL0M10307g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /function="catalytic activity"
FT                   /cellular_component="membrane"
FT                   /protein_id="CAG62773.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG058159"
FT                   /db_xref="HOGENOM:HBG397262"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR016118"
FT                   /db_xref="UniParc:UPI00003B7198"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FIZ9"
FT                   /transl_table=1
FT                   /translation="MFLKVRDWFLKDRPANHSATDLEYGWNPMESVRYLRSQYRHYKAN
FT                   PHLLSYKDVCHYTFMGSVWLFVLIMNPAPMVLKLLFYAFLTLLFLVPITSQFFFNALPI
FT                   LTWLALYFTSSYLKADIRPPITVKALPAIETVLYGDNLSDILATSTNPVLDIFAWIPYG
FT                   LFHFGAPFVVALILFLFGPPTILKGYAFAFGYMNLIGVMIQNFFPAAPPWYKILYGLES
FT                   ANYTMKGSPGGLARIDELLHINLYSNAFANSSVIFGAFPSLHSGCATMEALFFSYCFPF
FT                   LRPLFIFYVCWLWWSTMYLTHHYFVDLMAGSVLSYVIFQYTKYYHLPVVNTSYLTRWAY
FT                   PSVSKYDFKTSDPLNTDSEMHVENIPLRTYDETMSIDSRSNSNGRLELELDMDMDNMRT
FT                   VSSNTSTPASVFDRMESLSRSSATSNTSLGNLSTTDLTDPPVARKPSAF"
FT   CDS_pept        complement(1033952..1034308)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000206672" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17440121"
FT                   /locus_tag="CAGL0M10329g"
FT                   /product="Similar to uniprot|P28778 Saccharomyces
FT                   cerevisiae YKL003c MRP17"
FT                   /function="rRNA binding"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="CAG62774.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="GO:0019843"
FT                   /db_xref="HOGENOM:HBG313666"
FT                   /db_xref="HOGENOM:HBG756716"
FT                   /db_xref="InterPro:IPR000529"
FT                   /db_xref="InterPro:IPR014717"
FT                   /db_xref="UniParc:UPI00003B7199"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FIZ8"
FT                   /transl_table=1
FT                   /translation="MLYELIAMVRILQPKHQMQQEAKELATTIGRMIIENRGVVRKIMP
FT                   MGKTMLPRVITKDQERHFQAFKFLMLFDSSIPVQSQILRTLRKDPRVIRSSIVKINTEK
FT                   ELASLSSIEKSQGL"
FT   CDS_pept        1035054..1036229
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000065964" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17440122"
FT                   /gene_name="MAF1"
FT                   /locus_tag="CAGL0M10351g"
FT                   /product="Repressor of RNA polymerase III transcription
FT                   MAF1"
FT                   /function="transcription regulator activity"
FT                   /biological_process="negative regulation of transcription
FT                   from RNA polymerase III promoter"
FT                   /biological_process="transcription"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG62775.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006350"
FT                   /db_xref="GO:0016480"
FT                   /db_xref="GO:0030528"
FT                   /db_xref="HOGENOM:HBG190111"
FT                   /db_xref="HOGENOM:HBG512112"
FT                   /db_xref="InterPro:IPR015257"
FT                   /db_xref="InterPro:IPR017152"
FT                   /db_xref="UniParc:UPI00003B719A"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FIZ7"
FT                   /transl_table=1
FT                   /translation="MKFIDELDIERVNQVLNFETIDCKIVGGCDIFTTKAVASDRKLYK
FT                   TIDHHLDTILQDNESYNLALQQQIALDAEDKNERSMSPGGQRRDSSSFWEQKRRMSVSD
FT                   SPIYLQHINGNLNESNGAQGEIVADLVPPIIKTSKLNDHNLKELVSNYEAGYSSSSSVE
FT                   SLTHKNKERRTSSLSSTGGKVDKLRADSSTANDITARSVLNDTSRTLNLGPFGPINEPS
FT                   SRRTFAYLIAILNASYPDHDFSLLEPTDFKRSSIKSFIAKFENSMYSLGRKPEEWIWEV
FT                   INSHMTLSDCVLYQYCPTQSFLDDEPGHLWSLIGFFFNKKRKRVAYVYLLASRLQLAVN
FT                   NAIGTPDEMQNEDGTFRNNNTTSFDNNNTQFEGEYDLTYEENAIVDDDDEE"
FT   CDS_pept        complement(1036696..1038096)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000141828" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17440123"
FT                   /locus_tag="CAGL0M10373g"
FT                   /product="Similar to uniprot|P25301 Saccharomyces
FT                   cerevisiae YDR004w RAD57"
FT                   /function="ATP binding"
FT                   /functio