(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE10

CAGLA1_12.PE10       Location/Qualifiers
FT   CDS_pept        39196..40284
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000024037" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20195207"
FT                   /locus_tag="CAGL0M00330g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /function="NADP or NADPH binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="cellular amino acid metabolic process "
FT                   /protein_id="CAG62335.1"
FT                   /db_xref="GO:0006520"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0050661"
FT                   /db_xref="HOGENOM:HBG252503"
FT                   /db_xref="HOGENOM:HBG477935"
FT                   /db_xref="InterPro:IPR001342"
FT                   /db_xref="InterPro:IPR005106"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR019811"
FT                   /db_xref="InterPro:IPR022697"
FT                   /db_xref="UniParc:UPI00003B6FEA"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FK85"
FT                   /transl_table=1
FT                   /translation="MSNKSVNVAIIGTGVVGSSFLDQIVAMKSNITYNIIYVAELSKAL
FT                   ISEDYSPLALGSDWAKAVNGANQGPLALEKLVDFLKKSPIPVILVDNTSSAAIASFYPT
FT                   FVENGISIATPNKKAFSSDLATWDSLFSGKPTNGLVYHEATVGAGLPILGFLREIIQTG
FT                   DEIEKIEGIFSGTLSYIFNEFSTTTTNDVKFSDVVKVAKQLGYTEPDPRDDLNGLDVAR
FT                   KVTIVARISGVKVESPTSFPVQSLIPKPLESVESVDEFLQKLPEYDDELTQLKKEAAEE
FT                   NKVLRFIGKVDVATGKPSVGIEKYDHSHPFASLKGSDNVISIKTKRYTNPVVIQGAGAG
FT                   AAVTAAGILGDVIKAAQRLVGA"
     atgtctaaca agagtgttaa tgttgctatt atcggtactg gtgttgttgg ttcctctttc        60
     ttggaccaaa tcgtggctat gaagtccaac atcacctaca atatcatata tgttgcagaa       120
     ttgagcaagg ctttgatatc tgaagactac agcccattgg cattgggttc tgactgggct       180
     aaggctgtta acggtgcaaa ccagggccct cttgctctgg agaaactggt tgatttcttg       240
     aaaaagtctc caattcctgt cattttggtt gataacacat ccagtgctgc cattgcaagc       300
     ttctatccca cctttgtaga gaatggtatc tctattgcca ctccaaacaa gaaagctttc       360
     tcttccgatc tagctacttg ggattctcta ttctcaggta agccaactaa cggtttggtg       420
     taccatgaag ccactgtcgg tgctggtctt cctattttgg gcttcttgag agaaattatt       480
     caaactggtg acgaaattga aaagattgaa ggtatctttt ccggtacttt gtcgtacatt       540
     ttcaatgaat tttccacaac cactacaaat gatgttaagt tctctgatgt tgttaaagtg       600
     gctaaacagt tgggttacac cgaacctgat ccaagagacg atttgaacgg tctagacgtt       660
     gccagaaaag tcaccatcgt tgctagaatt tctggtgtta aagttgaatc tccaacttct       720
     ttcccagttc aatctctaat cccaaagcca ttggaatctg tagaatctgt ggatgaattt       780
     cttcaaaaat tgccagagta cgacgatgaa ctaactcaat tgaagaaaga ggctgccgag       840
     gaaaacaagg ttttgagatt cattggtaaa gtcgatgtgg ctactggtaa gccatctgtt       900
     ggtattgaaa agtatgacca ctcacaccca tttgcttcat taaagggttc tgataatgtt       960
     atttctatta agactaaacg ttacactaac ccagttgtta ttcaaggtgc tggtgctggt      1020
     gctgccgtta ctgctgcggg tattttgggt gatgttatta aggctgctca aagactggtc      1080
     ggtgcataa                                                              1089
//

If you have problems or comments...

PBIL Back to PBIL home page