(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE100

CAGLA1_12.PE100      Location/Qualifiers
FT   CDS_pept        278407..279219
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17436729"
FT                   /gene_name="ATG5"
FT                   /locus_tag="CAGL0M02343g"
FT                   /product="Autophagy protein 5 "
FT                   /biological_process="autophagy"
FT                   /biological_process="protein transport"
FT                   /cellular_component="cytoplasm"
FT                   /cellular_component="membrane"
FT                   /protein_id="CAG62424.1"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006914"
FT                   /db_xref="GO:0015031"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG190234"
FT                   /db_xref="InterPro:IPR007239"
FT                   /db_xref="UniParc:UPI00003B7041"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FJZ6"
FT                   /transl_table=1
FT                   /translation="MGDSKELVWNGSINVQIKLDSRLLVDGVPEGRRLVNIRVPRESHI
FT                   AIYTPLVLERLRNVLRSDIEELLPKVWYSYKDISLPWSIPFGTLFDIYNGAHKGISGSR
FT                   DNYINVWKLNLVTDEKFPINVIPIIEGQDQLRKFMMQSWKQCCFILNGSSKRVMSLSLQ
FT                   DSLEVWEGVTERDYAKYSGVIKRILPRTPRRIPVAIHAANGGPIVQTTEPTLTDTSFSQ
FT                   AVEGIVKADFVVCQGIVMYLRDFSDTSLYDVYDKLHSIDGYLHLIANL"
     atgggtgata gcaaagaatt ggtctggaac ggcagcataa atgtacaaat caaacttgat        60
     agtcgattac tggtagatgg cgttcctgaa ggtcgacggt tagtgaatat tagagtacct       120
     agagaatctc atatagccat ctacacacca ctagtactag aaaggcttcg aaacgttctt       180
     agatcagata ttgaagaact cttaccaaag gtatggtata gttacaaaga tattagcctg       240
     ccgtggtcga taccctttgg gactttgttt gacatataca atggagctca taaaggtatt       300
     agtgggagtc gagataacta tatcaatgta tggaaattaa acctagttac agatgagaag       360
     ttcccaatca atgtgattcc cataatagaa ggacaggatc aattaaggaa atttatgatg       420
     cagagttgga agcaatgctg tttcattctg aatgggtcat ctaaaagagt tatgtctttg       480
     tccttacagg actccctaga agtatgggaa ggcgtaacgg agcgggacta tgcaaagtac       540
     agcggtgtaa tcaaaaggat attgccgagg actcccagaa gaatacctgt cgctatccat       600
     gcggcgaatg gtgggccgat tgtacaaact acagaaccga cattgacaga cactagtttt       660
     tctcaagcgg ttgagggaat tgtaaaagca gacttcgtcg tttgccaagg gattgtaatg       720
     tacttaaggg acttctcaga tacctcacta tacgacgttt acgataagct tcacagcatt       780
     gacgggtacc tccatctaat agccaatttg tag                                    813
//

If you have problems or comments...

PBIL Back to PBIL home page