(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE101

CAGLA1_12.PE101      Location/Qualifiers
FT   CDS_pept        complement(279263..279721)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000115674" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18500881"
FT                   /gene_name="PPT2"
FT                   /locus_tag="CAGL0M02365g"
FT                   /product="Mitochondrial holo-[acyl-carrier-protein]
FT                   synthase"
FT                   /EC_number="2.7.8.7"
FT                   /function="holo-[acyl-carrier-protein] synthase activity "
FT                   /function="magnesium ion binding"
FT                   /biological_process="fatty acid biosynthetic process "
FT                   /biological_process="macromolecule biosynthetic process "
FT                   /biological_process="protein-cofactor linkage"
FT                   /cellular_component="mitochondrion"
FT                   /protein_id="CAG62425.1"
FT                   /db_xref="GO:0000287"
FT                   /db_xref="GO:0005739"
FT                   /db_xref="GO:0006633"
FT                   /db_xref="GO:0008897"
FT                   /db_xref="GO:0009059"
FT                   /db_xref="GO:0018065"
FT                   /db_xref="HOGENOM:HBG124027"
FT                   /db_xref="HOGENOM:HBG203879"
FT                   /db_xref="InterPro:IPR008278"
FT                   /db_xref="InterPro:IPR016614"
FT                   /db_xref="UniParc:UPI00003B7042"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FJZ5"
FT                   /transl_table=1
FT                   /translation="MSVLGVGCDVVHLPRMHRLLTKYDAGSRGFQRVVSKFMHPTERIA
FT                   LGVDGASLSAGQIRYIAGTWALKEAALKALHCAAPLHTVLPPAMFIYTKLLYRQRRSNG
FT                   VPQLLLDNEALRLDQLQFLRQAKFLSTLSHDNEYLVAYTTLIDTKNLV"
     atgagcgttc ttggagtagg gtgcgacgtc gtgcatctgc cgcgtatgca tcggctgctg        60
     acgaagtatg atgcgggctc gagagggttc caacgtgtcg tatcgaagtt catgcaccca       120
     accgagcgta ttgcgttggg tgtggacggt gcctctctgt cagcgggtca gataaggtac       180
     atagccggca catgggcttt gaaagaggcc gcgctcaaag cgctgcattg cgcagcgcct       240
     ctacacacgg ttctgccacc tgcaatgttc atatatacaa agctgctcta tcgacaacgg       300
     cgtagcaatg gtgtgccaca gcttctgctt gataacgagg ccttgcgact ggatcaattg       360
     caattcctca gacaggcaaa gttcctatcg actttgtcgc acgataacga atacctggta       420
     gcgtatacaa cactaataga taccaaaaac cttgtatag                              459
//

If you have problems or comments...

PBIL Back to PBIL home page