(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE102

CAGLA1_12.PE102      Location/Qualifiers
FT   CDS_pept        280372..282942
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000206081" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21044350"
FT                   /locus_tag="CAGL0M02387g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /function="ATP binding"
FT                   /function="ATPase activity, coupled to transmembrane
FT                   movement of substances"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAG62426.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0042626"
FT                   /db_xref="HOGENOM:HBG524837"
FT                   /db_xref="HOGENOM:HBG557888"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010509"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017940"
FT                   /db_xref="UniParc:UPI00003B7043"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJZ4"
FT                   /transl_table=1
FT                   /translation="MDGIRVRNVLINVHRQCIGLDIERIAGKRYLGVLLKHLYYVARTG
FT                   STGYLDGHKRRARMILLVVVLMGVAGASGISWGVMRMLTRLRGWYLHSWKNRGRRPSMR
FT                   RTRSQTRLVDGGRIIYVPEDSIDGKPTSSKKNKKFLIPPTDNDIYEHDKFLFKNVESER
FT                   TRSSQLFYSKFLNQMSVISRILIPSFLDKNAILLSSQIFFLIMRTWLSLFVARLDGQIV
FT                   KDIIAGRGRRFLLDIGCWFLIAIPASYTNSAIKYLQRKLSLSFRTNLTRYIHDMYLDKR
FT                   LGFYKLLYDSKASTSVIKNIDNSITSDVTKFSDATCSVFANIAKPVIDLVFFSVYLRDN
FT                   LGTMGVAGIFVNYFITGYILKKYTPPLGELASSKSSAEGDYYNYQLNMINNNEEIAFYQ
FT                   GTEVEKTKVKELYENLMERTLLVDKRKFTYNMVEDYILKYTWSGLGYVFASIPIVVSTV
FT                   ASGINNEEVNMKEFIVNKRLMLSLADAGSRLMHSIKDISQLTGYTNRIFTLLCVLHRVH
FT                   STDFNYGANIEDKLQEISDALSSSSTLPNKTKVDIIRGTIQRNFNGVRFENIDVIIPSP
FT                   SGREGVKLINKLAFQIPPHIDFNMSHSNSILDITGSKDVNLPFLQGPGSSLLILGPNSC
FT                   GKTSIQRIIAEIWPIYNKKGLMSIPAQENLICIPQKPYFTRGGTLRDQLIYPMSSDEFF
FT                   DRGFKDKYLVQIMSEVKLDYLLKRGTGLSYLDTVADWKDVLSGGEKQRVNFARIMFHRP
FT                   LFVVLDEATNAISADMEDYLFNLLKRYRFNFITISQRPTLIKYHDLLLEISGKSSGSWH
FT                   LQTLGTDEAINSIEHEIEELEEKLENVKLWEIERDELIRKLSVV"
     atggatggta tacgtgtgcg gaatgtgctg atcaatgtgc acaggcagtg catcggtctg        60
     gatatagaga ggattgccgg gaagcggtat cttggggtgt tgctgaagca tctctactat       120
     gttgcgcgga cggggtcgac tgggtactta gacggccaca agcggagagc taggatgata       180
     ttgctggtgg tggtactgat gggtgtcgct ggtgcgagcg ggatcagctg gggtgttatg       240
     cggatgctga ctcgactacg gggctggtac ctgcatagct ggaaaaacag aggcaggcgg       300
     ccctcgatgc ggaggaccag gtctcagaca cggctggtgg atggtgggag aatcatatac       360
     gttcccgagg acagtattga tgggaaacct acatcctcta agaagaataa gaagtttctc       420
     attccaccaa cagataatga catatacgag catgacaagt tcttgttcaa aaatgttgaa       480
     tccgagagaa ctaggtcctc ccagctattc tattctaagt tcttgaacca gatgagcgtg       540
     atctcaagga tactgattcc ttctttccta gacaaaaacg ccatactttt atcctcacag       600
     attttctttt taattatgag aacttggctt tccttatttg tcgcaagact agatggtcaa       660
     attgtgaaag acatcattgc cggccgtggc aggaggttct tgcttgacat agggtgctgg       720
     tttttaatcg ctattcctgc atcatataca aatagtgcga tcaaatatct ccaacgcaaa       780
     ttgagtctga gcttcagaac gaacttgaca agatacatac atgacatgta tctagacaag       840
     cggctaggat tctacaaatt gctctatgac tcaaaggctt ccacttctgt catcaaaaac       900
     atagataact cgataacaag cgacgtcacc aagttttcag atgccacatg ctcagtattc       960
     gcaaacatag ccaaacctgt tattgacttg gtatttttct cagtgtactt gagagataat      1020
     ttaggaacta tgggagttgc tggtattttt gtaaactact tcattactgg gtacattttg      1080
     aaaaaataca ccccaccttt aggtgaatta gctagctcta aatcatcagc agaaggtgac      1140
     tattacaact accagctaaa catgatcaat aacaatgaag agattgcatt ttatcagggt      1200
     actgaagtcg agaagacaaa agtaaaagaa ttatacgaaa acctgatgga aagaactctg      1260
     cttgttgata agagaaaatt cacttataac atggttgaag actatatttt aaaatatact      1320
     tggtcaggtc ttggatatgt atttgcttca atcccaatag tggttagtac agttgcttcc      1380
     ggtatcaata atgaagaggt gaatatgaaa gagtttattg tgaacaaaag attgatgctg      1440
     tcgctagccg atgcgggctc acgtctaatg cattcaatca aagatatttc acaattgaca      1500
     ggatacacaa acagaatctt taccctcttg tgtgtgcttc accgtgttca ttctacagat      1560
     ttcaactatg gtgcaaacat tgaagataaa ctacaagaaa taagtgatgc tttgagctca      1620
     tcgtcaacct taccaaacaa aacaaaggtt gacattatta ggggtactat tcaacgtaac      1680
     tttaacggtg tcagattcga aaatatcgac gtcattatac cttctcctag cggtagagaa      1740
     ggtgtaaagc taataaataa acttgctttc caaattcctc ctcacattga ctttaatatg      1800
     tctcattcta actcgatttt ggatataact gggtctaagg atgttaattt accatttttg      1860
     caaggtccag gctcaagttt gttgattcta ggccctaata gttgtggtaa gacatccatt      1920
     caaagaataa ttgccgagat atggccaatt tataataaaa aaggtttaat gtctattcca      1980
     gctcaagaga atttaatttg tatcccacag aaaccttatt ttacaagggg tggtacattg      2040
     agagatcaac ttatttatcc tatgtcctcc gatgaatttt ttgacagagg attcaaggac      2100
     aaatatcttg ttcaaattat gtctgaggtt aagttggatt atttgctaaa aagaggaact      2160
     ggtctttcat atttagacac tgtagctgat tggaaagatg ttttgagtgg tggtgagaag      2220
     caaagagtaa atttcgccag aatcatgttc catagaccac tttttgttgt tctggatgaa      2280
     gccaccaatg cgattagtgc tgatatggaa gattatttat tcaatttgtt aaaaagatac      2340
     agattcaact tcatcactat ttctcaaaga ccaacattaa tcaaatacca tgatttgctg      2400
     cttgagatat caggcaagtc ttctggatca tggcatttac aaactttagg tactgatgaa      2460
     gcaataaatt caatagaaca tgagatagag gaactggagg aaaaacttga aaatgtgaag      2520
     ctatgggaga tagagaggga tgagttgatt agaaaattat ccgttgttta a               2571
//

If you have problems or comments...

PBIL Back to PBIL home page