(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE104

CAGLA1_12.PE104      Location/Qualifiers
FT   CDS_pept        complement(285179..286495)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000197950" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17436731"
FT                   /locus_tag="CAGL0M02431g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /biological_process="steroid metabolic process "
FT                   /protein_id="CAG62428.1"
FT                   /db_xref="GO:0008202"
FT                   /db_xref="HOGENOM:HBG053829"
FT                   /db_xref="HOGENOM:HBG677053"
FT                   /db_xref="InterPro:IPR000648"
FT                   /db_xref="InterPro:IPR018494"
FT                   /db_xref="UniParc:UPI00003B7045"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJZ2"
FT                   /transl_table=1
FT                   /translation="MSGYASSSAWTSFLKSVSTFNGDLSSLVAPPFILSPVSLSEFSQY
FT                   WAEHPDLFLEPSFINEANFKTKCTEDPNVESPEMARMLSVTKWFISTLKSQYCSRDETM
FT                   GSEKKPLNPFLGELFVGKWDNKDHPEFGETVLLSEQVSHHPPITAYTIFNDKNKVKLQG
FT                   YNQVKTGFTKTLMLSVKQYGHTLLEVNKESYLITPPPLHIEGILMAAPFVELEGRSYLQ
FT                   SSTGLLCVVEFSGRGYFSGKKNSFKARIYKSAADSADKNKAIYTISGQWSGSSKISKLN
FT                   PATGYSDEIGTFYEAERVPVSHLSVKPIDKQHPLESRKAWKEVAEAIKAGDMDLITKTK
FT                   SDLEQKQRDLRKEEEAKGICWERRWFKDFDYSDAPGKDYLVPEKDDIFLQLAKAMDLSI
FT                   KNVPSGTLNGEKEDKKEDLTSIHWRFDRKLWDEEKEVVL"
     atgtcaggat acgccagttc ttctgcatgg acttctttct tgaagtctgt ctccactttc        60
     aatggtgatc tatcctcttt ggttgcccca ccatttattc tatccccagt ttccttgtct       120
     gagttctcgc agtactgggc tgaacatcct gatttgttcc tggaaccatc tttcatcaat       180
     gaggccaact tcaagaccaa atgtaccgaa gaccctaacg tcgagagccc tgaaatggct       240
     agaatgctgt ctgtcaccaa atggttcatt tccactttga aatctcaata ctgttctcgt       300
     gacgagacca tgggttctga gaagaagcca ttgaaccctt tcttgggtga actgttcgtc       360
     ggtaaatggg ataacaagga ccaccctgag ttcggtgaga ccgtgcttct atccgaacaa       420
     gtctctcacc accctcctat caccgcttac actatcttca atgacaagaa caaagtcaag       480
     ttgcaaggtt acaaccaagt gaagaccggt ttcacaaaga ctctaatgct ttctgtcaag       540
     caatatggtc atacactact ggaagttaac aaagaatcct acctaatcac tccaccacct       600
     ttacatatcg aaggtatcct gatggctgcc ccatttgtgg aactagaagg caggtcctac       660
     ctacaatcct ccaccggcct actatgtgtt gtcgagttct ctggtagagg ttacttctcc       720
     ggtaagaaga actcttttaa agccagaatc tacaagagcg ctgccgacag tgccgacaag       780
     aataaggcta tatataccat ttctggccaa tggtctggct catccaagat ttccaagcta       840
     aatccagcta ctggttacag cgacgaaatt ggcactttct atgaagccga aagggtacct       900
     gtctctcatt tgagcgtaaa gccaattgat aagcaacatc cactagagag caggaaagca       960
     tggaaggaag tagctgaagc cattaaggct ggtgacatgg acctaattac aaagaccaag      1020
     tctgaccttg agcaaaaaca aagagacttg agaaaggaag aagaagcgaa aggcatctgc      1080
     tgggaaagaa gatggtttaa ggatttcgac tacagcgacg ctccaggcaa ggattaccta      1140
     gtacctgaaa aggacgatat cttcctccaa ctagccaaag ctatggactt atccataaaa      1200
     aatgttccaa gtggtacctt gaacggtgag aaggaagaca agaaagaaga tttgacctca      1260
     attcactgga gatttgatag aaagctatgg gatgaggaga aggaggttgt tttgtaa         1317
//

If you have problems or comments...

PBIL Back to PBIL home page