(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE106

CAGLA1_12.PE106      Location/Qualifiers
FT   CDS_pept        join(289221..289239,290018..290322)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000195636" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17436732"
FT                   /locus_tag="CAGL0M02497g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="CAG62430.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG211000"
FT                   /db_xref="HOGENOM:HBG539420"
FT                   /db_xref="InterPro:IPR001780"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR018266"
FT                   /db_xref="UniParc:UPI00003B7047"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJZ0"
FT                   /transl_table=1
FT                   /translation="MAESHRLYVKGKHLSYQRSKSVNNPNVSLLQIEGVANPQEAQFYL
FT                   GKRVAYVYRASKEVRGSKIRVMWGKITRTHGNSGVVRAKFRNNLPAKTFGASVRIFLYP
FT                   SNI"
     atggctgaat ctcatagatt gtacgtcaaa ggtaagcact tatcctacca aagatccaag        60
     agcgttaaca acccaaacgt ctctttgctt caaatcgaag gtgtcgctaa cccacaagaa       120
     gctcaattct acttgggtaa gcgtgtcgct tacgtctaca gagcttccaa ggaagttaga       180
     ggttccaaga tcagagttat gtggggtaag atcaccagaa ctcacggtaa ctccggtgtc       240
     gtcagagcta agttcagaaa caacttgcca gccaagactt tcggtgcttc cgtcagaatc       300
     ttcttgtacc catctaacat ttaa                                              324
//

If you have problems or comments...

PBIL Back to PBIL home page