(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE109

CAGLA1_12.PE109      Location/Qualifiers
FT   CDS_pept        complement(295156..296529)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18500882"
FT                   /locus_tag="CAGL0M02563g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /protein_id="CAG62434.1"
FT                   /db_xref="HOGENOM:HBG058424"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="UniParc:UPI00003B704B"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJY6"
FT                   /transl_table=1
FT                   /translation="MTVDTEIASNKLRNEEFKIWKKTIPLLYQHISTMKPKYANASKGT
FT                   IKDVPCCLTFSDEVIPNKANGTLSTVIYYGIGNEIYSLDCDLPLGLHLQKDTLQPNEKL
FT                   QLPQFDQIVSRIQSEDLSPKWRAAANCNIYKIKCVGNGKVVALLDSGAIVWFQESTESP
FT                   VSMVDGGAKIIPNKYELEEDFVNDSLNKIDFDFDLSLNGEKIIVSQAVLNEDRTVIKVF
FT                   SNIDKDLGKLLISLDLPGTKSVHNIKFYNDNIFGFCDNSGNLYFYDSRNLATPIWKIEN
FT                   EHILSFAFSPLVETLLITGGANGIINFWDVKRLTVKTATTGGDKRQESLLSLSNHVEEP
FT                   ISSVEFSASSPSEFITVGISGSIYHWDVFNYFEKVSELFSEGGDQSAIDSLDTEEIQAE
FT                   SLTFYHTGGSRRHLGKSTKKNSVSVHPIIEGLIGTIDTDGLITVYKPFTGVLPEAEDS"
     atgacagttg atacagaaat tgcaagcaac aaacttcgca atgaagagtt caaaatttgg        60
     aagaagacta ttccgcttct ttaccagcat atttccacca tgaagccgaa atatgctaat       120
     gcaagtaaag gcacaatcaa ggatgttcca tgttgtttga ctttttctga tgaagtaata       180
     ccaaacaagg ccaatgggac gttgtcgaca gttatatact atggtatcgg taatgagatt       240
     tacagcctag attgtgactt acccttgggt ctacatttac aaaaggatac ccttcaaccc       300
     aatgaaaagt tacagttgcc ccaatttgat caaatagtta gcagaataca atcggaggat       360
     ctatctccca aatggagagc tgcagctaat tgtaatatat ataaaatcaa gtgcgtcgga       420
     aatggcaaag tagtggcact gctggacagt ggtgctatcg tatggttcca ggagagcact       480
     gaatccccag tgtccatggt cgatggtggt gccaagataa tacctaacaa atatgagctg       540
     gaagaagatt ttgttaatga tagcctgaac aagattgatt tcgactttga cttatcattg       600
     aatggcgaga agattatcgt tagccaggca gtactaaatg aagacaggac agttatcaaa       660
     gtattttcca atatcgataa ggacttagga aagctcctaa ttagtcttga tttgccaggg       720
     accaagtctg tccataacat caaattctac aatgacaata tctttgggtt ttgcgataac       780
     tctggcaact tatactttta cgactcaaga aatctagcta cacctatttg gaaaattgag       840
     aatgagcaca ttctctcatt tgccttttcc ccattggtag aaactttact aataacagga       900
     ggtgcgaacg gtatcattaa cttctgggat gtgaagagac taactgtgaa gactgcaacc       960
     actggaggcg acaaacgtca agaatcactt ttatcactca gtaaccacgt agaagagccc      1020
     atttcaagcg ttgaattctc agcaagttct ccttctgagt tcataaccgt aggtatatca      1080
     ggaagcatat atcactggga tgtctttaac tatttcgaga aagtttcaga gctgttcagt      1140
     gagggaggtg accagagcgc aatagactcc ctagataccg aggaaataca ggccgaatct      1200
     ctgacatttt accatactgg aggttcccgc agacatttgg gaaaatccac aaagaagaac      1260
     agcgtttccg ttcaccctat aattgagggt ctcataggaa ctatagacac tgacggtctg      1320
     ataaccgtat ataagccatt cacaggtgta ttgcctgaag cagaggacag ttag            1374
//

If you have problems or comments...

PBIL Back to PBIL home page