(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE11

CAGLA1_12.PE11       Location/Qualifiers
FT   CDS_pept        complement(40767..46181)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000093241" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17435642"
FT                   /gene_name="IML1"
FT                   /locus_tag="CAGL0M00352g"
FT                   /product="Vacuolar membrane-associated protein IML1 "
FT                   /cellular_component="vacuolar membrane"
FT                   /protein_id="CAG62336.1"
FT                   /db_xref="GO:0005774"
FT                   /db_xref="HOGENOM:HBG058122"
FT                   /db_xref="HOGENOM:HBG395415"
FT                   /db_xref="InterPro:IPR000591"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR022046"
FT                   /db_xref="UniParc:UPI00003B6FEB"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FK84"
FT                   /transl_table=1
FT                   /translation="MFSALRSKNQSNKRSNDDSINSRKDVNELSLGAGGTSTSTNTNHN
FT                   DSPSIKNKNKNKNKNKTENENIYKLTISSGRSRGTASNTTNANTLVLNAGVAIVGKAPI
FT                   ASSQNEIQTISGQSLQSGIDTNLMTAGFGRSAGIDSTTTVSHDANSVKSRLQRLPTITT
FT                   SYKEINNGNKPVQVEPQDDSHYTSSLLVDTDPRSNNQPQSISSNAVANVEINRTLQLDL
FT                   VYHESRVSEKLVMLDLKKLPHIKEGQLCELRTYRKRKSTSARSNKNSRDKKLYFIAHDF
FT                   DEETRKRCHKFGNISVALGQLQLLLDLPPRSRVWIKPKRKEDTAADLIELHIKDILVNR
FT                   GDMWCMSSELVDTCVFTGQRIMFLDSIRTTVNGIYKNGKKVLSGYINDNTKIVFRSESS
FT                   RLLFIIQITNEMWSFDESGEQMFQKMINSFFPKIFNKWKDIETHHSITIAFAISMDMST
FT                   SSYKDLKPGQRIKNTTDYYRIVVDQVSVIYWVEIMESLRKEFMEITRELLSRKSDDKKD
FT                   NELSVIKGRFAPVIKSNILELINFAATTIVDPFRQLDLRHTSTHVMIISPGKGLYDVDY
FT                   DLLQLSCKKLLSLELTMDLICLSNPPLHVVPLFRYIDYENKLHHCIPPWLNIFFWNDKT
FT                   KDTNKWTPRCQIYDLQMMGLTDTELVQELELDYLNPSDDINDLQTFLKDYDRDIFLPIS
FT                   TANFKAENISSDPDEEDLKELKKINDKTTTIHKSSTSRNTLTKSQRTNSEENNSIRSRK
FT                   GDTIIKDPQFVGKISNSSRNNPPYDLSDKSTFEKQFKPKTTFHPSAMIKKTPENMKKLT
FT                   NPVFQQQYFDIQTDNGLTGNSKNLLIKNTKYLTPIIDEPQTPLVTGNLYRTRFESQSND
FT                   NELNENSKLPERGGGTDERRNVSAADTLKDVTKKSSIKDFTQRIFTKFLATTKQSNFNS
FT                   DGINSSAITEDAVLISDDTDGKTNNNNDFAVYPSSVADGDVSGDNQHRLNNKDSFTSIL
FT                   KPIPRPQLGVKIFKSDINNLSSNENVNSETKQNLLGTRNTINRKQFTASPHFTSSTKNS
FT                   VSNHSRFIKFDSMDDWIEILEDSIPSYSFLGDDLLPTRWRDVWPKNVFRKYSKWKSFTS
FT                   PAELPITLKRFPSKYELENNFMLRNHSVTQNWEQEQYKLTTKDLLRNMIYLRLLVGFQI
FT                   CTSSTIEEVESARKGDRDVFAIHKYLRGDLTGTFKIYMLMGSEIHRLHYDNSGTINVER
FT                   YIEKSERNVFDQVPSYTSFVKTRYDSNYRKTDVDPIHTKRSEFNWNLLDQLLAGYSDPY
FT                   LYDEWHGFRSKYVILPAEIPSNTFSMVVNGKNETLTTEEIRVEGLRKLIASITRLKLLS
FT                   VEESKIQKDRKTEIQPEVIFYTGSLFDFLNEQQAQLDSSTLNFKDSIFGDVTKKLNKNI
FT                   DLKNLAQELQMGENKLNLVTRKWHWKRHANCFVGSEMVNWLIRNFSDIDTRSTAISYGQ
FT                   KLMNDGLFIHVLDKHSFLDGNYFYQISPEFIINMNTVERTNSKNSNTSDNNTLKKTTSR
FT                   NSTESNLTPLSMRNKVSTMDDDSTQLANTTSANSYKEKKTVVLSNSMLINVDPSSKSYK
FT                   EELCTVHFDRVHNPEHCFHIRLEWLTTTPKLIDNMLGNWARICEKYGLKLIEIPWNELC
FT                   TIPSVDPFHTFVQLHLVINPWEDPEFNDPELFAVSKFYYHIHLLKMSGFLLDNRASRFF
FT                   QRDDADFEIMYSWGKPQFKYAQYIHTTGAYIAEMRENGNIFLAPNNVYMSRVNRANVIS
FT                   KTRSSPTFTVDSRKVVIEFSRTCYSYAKLRAVFLDAKEKWLSNKTVED"
     atgttttcgg ctttacggag caaaaaccag tctaataaga gatctaacga tgatagtatc        60
     aatagtagaa aagatgttaa tgaattaagt cttggtgcag gtggcaccag tactagtact       120
     aataccaatc acaatgacag tcccagtatt aaaaataaga ataagaataa gaataagaat       180
     aagactgaga atgaaaatat atataaacta actatatcgt caggacgttc aagaggaact       240
     gcatccaata caacaaatgc taatacgttg gtattaaatg ctggtgtagc tatagtcggg       300
     aaagcaccca tcgcatcatc ccagaatgag atacaaacca tcagtggaca atcattgcag       360
     agtggtatag atacaaatct aatgacagct ggatttggtc gctctgctgg tattgactcc       420
     acaacaacag tttctcatga cgcaaattcc gttaaatcga gattacaaag actaccaaca       480
     attactacta gttataaaga aatcaataat ggaaacaaac ctgttcaagt agaaccacaa       540
     gacgatagtc actatacctc atctttactg gtagatacag acccacgttc gaataatcaa       600
     ccccaatcaa tttcatctaa tgctgtagca aacgtagaaa taaacaggac attacaatta       660
     gacctggtat accacgaatc tagagtgtct gaaaaattgg tcatgctaga tttaaagaaa       720
     ctaccccata ttaaagaagg acaactttgc gaactgagga catatcgtaa acgtaaatct       780
     acttctgcaa gaagcaataa aaactctaga gacaaaaaat tatatttcat tgcccatgat       840
     tttgatgaag aaaccaggaa aagatgtcac aagtttggaa atatctcagt ggctttgggt       900
     caattacaat tactcctaga cttaccacca agatcccgtg tatggattaa acccaagaga       960
     aaagaagaca ctgctgccga tttgatagaa ctgcatataa aagatattct tgtgaataga      1020
     ggtgatatgt ggtgcatgtc ttctgaattg gtagatactt gtgttttcac cggacaacga      1080
     attatgtttt tagattctat cagaaccact gtcaacggaa tctataaaaa tggtaagaaa      1140
     gtactatcgg gatacataaa tgacaatact aagatcgttt tcagatccga gtcatcacgg      1200
     cttttgttta ttatacaaat tactaatgaa atgtggagtt tcgatgaatc tggcgaacaa      1260
     atgtttcaaa aaatgatcaa ctcctttttc cccaaaatct tcaacaagtg gaaggatatt      1320
     gagacccatc atagcataac catcgcgttt gcaatatcaa tggacatgtc tacatcttct      1380
     tacaaggatt taaaacctgg ccaaagaatc aagaacacaa cagattatta cagaatcgtt      1440
     gtagatcaag ttagtgttat atattgggtt gaaatcatgg aaagtctgag aaaagaattt      1500
     atggaaatca caagagaatt attgtctcgt aaatctgatg ataaaaagga taatgaactt      1560
     tcggttatta agggcagatt tgctcctgtg atcaaatcaa atatccttga actaatcaat      1620
     tttgctgcga ctacaatagt tgatcccttc agacagcttg atctcagaca tacgtccacc      1680
     catgtgatga ttatcagtcc gggaaaaggt ttatatgatg tcgattacga tctgttacaa      1740
     ctatcttgta aaaaattatt atctctagaa ctaacgatgg atttgatttg tctttctaac      1800
     cctcctttac atgtcgtacc actatttcga tacattgatt atgaaaataa gctacatcat      1860
     tgcataccgc cttggctgaa tatttttttc tggaatgata aaacgaagga taccaataag      1920
     tggactccaa gatgccaaat ttatgatcta cagatgatgg gtttgacaga tacagaattg      1980
     gttcaagaac tagaactaga ttatttaaac ccttctgatg atattaatga tttacaaaca      2040
     ttcctcaaag actatgacag agatattttt ttgcccatat ctactgctaa tttcaaagcg      2100
     gaaaacattt cttccgatcc tgacgaggaa gatcttaaag aactaaaaaa aatcaatgat      2160
     aaaacaacta ccatccataa atcctccacg tcaagaaata ctctgacaaa atctcaaagg      2220
     actaatagtg aagaaaacaa ttcaattcga tcacgaaagg gcgatacaat aatcaaagat      2280
     cctcaatttg tagggaaaat tagtaattca tctagaaata acccgccata tgacctatct      2340
     gataaatcta cctttgaaaa acaatttaag ccgaagacaa cattccatcc cagtgctatg      2400
     attaagaaaa ctcccgaaaa tatgaaaaag ctaacaaatc ctgtatttca acagcaatac      2460
     tttgatatac aaactgataa tggattaaca ggaaatagca aaaacctatt aatcaaaaat      2520
     acaaaatatt tgacgccgat tatcgatgag ccacaaactc ctttggtaac gggtaatcta      2580
     tatcgtaccc gtttcgaaag ccaatccaat gacaatgagt tgaacgagaa ttcgaagtta      2640
     cctgaacgtg gaggaggaac tgacgaaaga agaaatgttt cagctgcaga tacactgaaa      2700
     gatgttacta agaaatcatc catcaaagat tttactcaaa gaatattcac gaaatttctg      2760
     gctaccacta aacaaagcaa ctttaattct gatggaataa actcaagtgc aataactgaa      2820
     gatgccgttt taataagtga tgataccgat ggaaagacaa acaataataa cgatttcgct      2880
     gtttacccat cctctgtagc agatggagat gtgagcggtg acaaccaaca tagattgaac      2940
     aataaagatt cttttacgag catattgaaa cctattccaa gaccacaact tggagttaag      3000
     atcttcaagt ctgacataaa caatttatct tcaaatgaaa atgtcaattc tgaaacaaaa      3060
     cagaatttgc ttggaacgag aaatactata aatagaaaac aattcacagc aagccctcat      3120
     tttacctcca gtacaaaaaa ttcggtatca aaccatagcc gtttcatcaa gtttgatagc      3180
     atggatgatt ggattgaaat cttagaagac tcaataccat catatagttt tcttggcgat      3240
     gacttgttac ctacgagatg gagagacgta tggcctaaaa atgtttttcg aaaatacagc      3300
     aaatggaaat cctttacttc tcctgctgag cttccaatca ctttgaaacg ttttccatct      3360
     aaatacgagc tagagaataa tttcatgctg agaaatcact ctgttactca aaactgggag      3420
     caagaacaat ataaattgac cacgaaggac cttttacgta atatgatata cctgagatta      3480
     ctggttggct tccaaatttg taccagtagc accatcgaag aagtggaatc ggctcgtaaa      3540
     ggagatcgag atgtttttgc tattcataaa tacctgagag gcgatctgac aggcactttc      3600
     aaaatatata tgttaatggg ctctgagatt cataggttac attatgacaa cagtggaact      3660
     attaatgtcg aaaggtacat agaaaaaagt gagcgtaatg tctttgatca ggtacctagt      3720
     tacacttctt ttgttaaaac cagatacgac agtaactata gaaagactga tgttgatccc      3780
     atccacacga agagatcgga gtttaattgg aatttgttag atcaactatt ggcaggttac      3840
     tctgatccat atctctacga tgaatggcac ggattcagat caaagtatgt tatattgcct      3900
     gcagaaatcc cgtcaaatac tttttccatg gttgttaacg gcaaaaatga gacacttaca      3960
     actgaggaaa ttagagtaga gggattgagg aaactaatcg catcaataac taggcttaag      4020
     cttttatctg ttgaagaatc caagattcag aaggatagaa aaacggagat acaaccagag      4080
     gtaattttct atacaggatc actatttgat ttcttgaatg aacaacaagc tcaacttgat      4140
     agctcgactt taaatttcaa ggattcaatt tttggtgatg ttacaaaaaa attgaataag      4200
     aacattgact tgaaaaacct tgcacaagag ttacagatgg gtgaaaacaa acttaactta      4260
     gtaacaagga aatggcattg gaaaagacat gctaactgtt ttgttgggtc tgaaatggtg      4320
     aactggttga tacgtaactt ctcagatatt gatacaagat caacggcaat aagctatggc      4380
     caaaaattga tgaatgacgg actgttcatt catgtcttgg ataaacatag ttttttggat      4440
     ggtaattatt tttatcagat atcaccagaa ttcattatca acatgaatac ggttgagaga      4500
     actaatagca aaaactcaaa cacatctgat aacaatactt tgaagaagac aacatctcgt      4560
     aattcaactg aatcgaatct gactccacta agtatgagaa ataaagtatc caccatggat      4620
     gatgactcaa ctcaacttgc gaatacaact tctgccaact cttataaaga aaagaaaacc      4680
     gtggttctaa gtaactcaat gctcatcaat gttgacccta gctcaaagtc atataaagag      4740
     gagctatgca cagtccactt tgatagagtt cataaccctg aacattgttt ccatatcaga      4800
     ctagaatggc tgacaactac tccaaaacta atcgataata tgcttggaaa ttgggcaaga      4860
     atctgtgaga aatacggttt aaagctaata gagatcccat ggaatgaact ctgcacgatt      4920
     ccatctgtgg acccattcca tacttttgta caattacatc tggttatcaa tccttgggag      4980
     gatccagagt tcaatgaccc agaacttttc gccgtgagta aattctatta tcatattcat      5040
     cttttgaaaa tgtctgggtt cttacttgat aacagagcct ctagattctt tcaaagagat      5100
     gacgctgact ttgaaataat gtactcgtgg ggtaaacccc aattcaaata tgcgcaatac      5160
     attcacacga ccggagcata catcgccgaa atgagagaaa atggtaatat cttcctggct      5220
     ccaaataatg tctacatgtc aagagtaaac agagctaacg ttatcagtaa gacacgctcc      5280
     agccccactt ttacagtaga ctccagaaaa gttgtgatag aattttcaag gacttgttac      5340
     agctatgcca aattacgcgc cgtcttcctt gacgcaaaag aaaaatggtt gagtaacaaa      5400
     actgtcgaag actga                                                       5415
//

If you have problems or comments...

PBIL Back to PBIL home page