(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE112

CAGLA1_12.PE112      Location/Qualifiers
FT   CDS_pept        303016..303657
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000069228" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17436736"
FT                   /gene_name="ISU1"
FT                   /locus_tag="CAGL0M02629g"
FT                   /product="Iron sulfur cluster assembly protein 1,
FT                   mitochondrial"
FT                   /function="2 iron, 2 sulfur cluster binding"
FT                   /function="iron ion binding"
FT                   /biological_process="iron-sulfur cluster assembly "
FT                   /cellular_component="mitochondrial matrix"
FT                   /protein_id="CAG62437.1"
FT                   /db_xref="GO:0005506"
FT                   /db_xref="GO:0005759"
FT                   /db_xref="GO:0016226"
FT                   /db_xref="GO:0051537"
FT                   /db_xref="HOGENOM:HBG281533"
FT                   /db_xref="HOGENOM:HBG584215"
FT                   /db_xref="InterPro:IPR002871"
FT                   /db_xref="InterPro:IPR011339"
FT                   /db_xref="UniParc:UPI00003B704E"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FJY3"
FT                   /transl_table=1
FT                   /translation="MGVCVFFPLCLPCPGALTYIREAQFISSWTPADPRHKQLKMFLQR
FT                   FVTVGGAAIGARSTMGAMGAIGAIGAKGTMNNIGRRMYHPKVIEHYTHPRNVGSMDKTL
FT                   PNVGTGLVGAPACGDVMRLQIKVNDKTGVIEDVKFKTFGCGSAIASSSYMTELVHGMTL
FT                   DDAAKIKNTTIAKELSLPPVKLHCSMLAEDAIKAAIKDYKSKRTSTTTLH"
     atgggggtgt gtgtcttctt cccactgtgt cttccatgcc caggggctct cacatatata        60
     agagaagcac aattcatttc atcttggacc ccggcagacc ccagacacaa gcaactaaaa       120
     atgtttttgc agagatttgt gacagtaggc ggtgctgcca ttggagctag aagtactatg       180
     ggtgccatgg gtgccatagg tgccataggt gccaagggca ctatgaacaa tatcggaagg       240
     aggatgtatc atcccaaggt tatagagcat tacacgcacc ctaggaatgt ggggtctatg       300
     gacaagacgc ttcctaatgt gggtactggt ctggttggtg cgcctgcgtg tggcgatgtg       360
     atgagactgc agatcaaggt taatgacaag acgggcgtga tagaggacgt gaagttcaag       420
     acgttcgggt gcggttccgc gatcgcttcc tcctcgtata tgactgagct agtgcacggc       480
     atgaccttgg atgacgccgc caagatcaag aacacaacca tcgcaaagga gttgagtctg       540
     ccacctgtca aactgcactg ctctatgcta gcagaggacg ctatcaaggc agcaattaag       600
     gactacaagt ctaagagaac atctacgaca acactgcact ag                          642
//

If you have problems or comments...

PBIL Back to PBIL home page