(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE113

CAGLA1_12.PE113      Location/Qualifiers
FT   CDS_pept        complement(304583..305971)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000164620" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18500883"
FT                   /locus_tag="CAGL0M02651g"
FT                   /product="Similar to uniprot|P19541 Saccharomyces
FT                   cerevisiae YPL133c"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="signal transducer activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG62438.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0004871"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG058418"
FT                   /db_xref="HOGENOM:HBG398051"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="UniParc:UPI00003B704F"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJY2"
FT                   /transl_table=1
FT                   /translation="MEEPAAKKQKKLYKSCIFCRRSHVNCDHQRPCSRCIKREIGHLCV
FT                   ADENVSNIQSQYQYKNSMSPIGSTEIPNAEINIGDETRAIQGSNSSVYGTETPISSSNN
FT                   NLLLPPQPNFVSENVGSEFSSLNEFLMMLENPIPGESENTSQSNKEQERTAHSNMEDSI
FT                   ENTQEQTDNNEGIIGSVSVNQEISQDINEASSKANGTKTVNDGQGQEQDQEHNRQKLNK
FT                   QESSNSKAQSDKYDDTPTSKEQFFLTAADPSTEMNPVDRLKLVINAKLEAGLLKPYDYA
FT                   KGYARLQEYMDKYMNDTNKQRILKPLMSIRPAFRTIAKSLKDVDLVLVEESFERMLLSY
FT                   DRVFTSMSMPACLWRRTGEIYRANKEFASLVDCTVDDLRDGKLAIYELMTEESAVNFWE
FT                   KYGSIAFDKGQKAVLTSCSLRTKDGLKKRPCCFSFTIRRDRYNIPICIVGNFIPLSPTR
FT                   DHSN"
     atggaagaac cagcagccaa gaagcagaag aagctgtaca aatcatgcat attttgccgc        60
     aggtcgcatg tgaattgtga tcatcagcga ccttgttcgc ggtgtatcaa gagggagata       120
     ggccatttat gtgttgctga tgagaatgtc tctaatatac aaagccaata ccaatataag       180
     aatagtatgt cgccaatagg gagcacagaa atcccaaatg ctgagatcaa tataggtgat       240
     gaaacccgtg caattcaggg ctcgaatagc agcgtatatg gtacagaaac accaatatca       300
     tcctctaaca ataacctatt attaccccca caaccaaact ttgtatcgga aaatgtagga       360
     tccgagttta gttcactcaa tgaattcctg atgatgttgg agaatccaat accgggtgaa       420
     tcagaaaata ccagccaaag taataaagag caagaacgta cagctcactc caacatggaa       480
     gatagcatag agaatacgca agagcagacc gataacaatg aaggtattat aggaagtgtt       540
     agtgtgaacc aggaaatctc gcaggatata aacgaagcaa gtagtaaagc taacggtacc       600
     aagacagtca atgatggaca agggcaagaa caagaccagg agcataatag acaaaaactg       660
     aataaacaag agagcagcaa ttctaaagct caaagtgaca aatatgacga tacacccaca       720
     tcaaaggaac agttcttcct aaccgctgct gatccgtcca ccgaaatgaa tcccgtagac       780
     agactgaagc tagttatcaa cgcgaagcta gaagcagggc tattaaaacc atatgactac       840
     gccaaagggt acgcaagatt acaagaatat atggataagt acatgaacga cacgaataag       900
     caaagaattt tgaaaccatt aatgagcata cgacctgcat ttaggaccat agccaagtcg       960
     ttaaaggatg tagacttggt tttagtagag gagagctttg agaggatgtt actatcatat      1020
     gatcgagtat tcacttcgat gagtatgcct gcatgcctct ggagacgtac tggtgaaata      1080
     tatagggcca acaaagagtt tgcatcgctg gtagactgca cggtggatga tctgcgcgat      1140
     ggtaaacttg ccatttacga gttgatgact gaagaaagcg cagtaaattt ctgggagaag      1200
     tatggttcca ttgcctttga taagggccaa aaagctgtac tcaccagttg ctcgctgaga      1260
     accaaagacg gcttgaagaa aaggccttgt tgtttcagtt tcacaattag acgtgatcgg      1320
     tacaacatcc ccatctgcat tgttggtaac tttatcccac tatctcctac aagagatcat      1380
     tccaactaa                                                              1389
//

If you have problems or comments...

PBIL Back to PBIL home page