(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE117

CAGLA1_12.PE117      Location/Qualifiers
FT   CDS_pept        join(310925..310933,311165..311881)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000176324" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18500885"
FT                   /locus_tag="CAGL0M02739g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG62442.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="HOGENOM:HBG055834"
FT                   /db_xref="HOGENOM:HBG329099"
FT                   /db_xref="InterPro:IPR005033"
FT                   /db_xref="InterPro:IPR016665"
FT                   /db_xref="UniParc:UPI00003B7053"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJX8"
FT                   /transl_table=1
FT                   /translation="MVASTKRTIRIKTEQHILPDVPPVENFPVRQWSIEIALLDEEGKE
FT                   MPATIFDKVVYHLHPTFANPNRTFNEPPFKIVEQGWGGFPLDISLYFLEKGGERKISHD
FT                   LNFLQESYEVDHVIQVPLNKPTLTAELAKSGFTEDTSSGSKRKMTGSNTGAESKTKKAK
FT                   TTTASTIKGNVDLEKLAFGLTKLNEDDLVGVVQMVTDNKTPEMNVTNNVEEGEFIIDLY
FT                   SLPEGLLKSLWEYVKKNTE"
     atggtagcat cgactaagag aacaataaga atcaagacag aacaacacat tctgcccgat        60
     gttcctccgg tagagaattt tccagtgcgc caatggagta ttgagattgc actattagat       120
     gaagagggca aagagatgcc tgccactatt ttcgataaag tggtttacca tttgcatcca       180
     acatttgcaa acccaaatag aacatttaat gaacctcctt tcaagattgt agaacaaggt       240
     tggggtggtt tcccgttaga tatcagttta tacttcctgg agaaaggtgg tgagagaaag       300
     atatctcacg acttaaactt cctgcaggaa tcatacgaag tagaccatgt tatccaggtt       360
     ccactgaata aaccaacttt gactgctgaa ttagccaaaa gtggatttac agaagataca       420
     agttctggct caaagagaaa gatgacaggc tcaaatactg gagccgaatc caaaacgaaa       480
     aaggcaaaga ctactactgc atctacgata aaaggtaatg ttgacttaga gaagctggct       540
     ttcggtttga caaaattgaa cgaagatgac ttagttggcg tagtccagat ggttacagac       600
     aacaagactc cagagatgaa tgtgacgaat aatgtagaag aaggtgagtt tatcatcgat       660
     ttatacagtc ttcctgaagg attactaaag agtctgtggg aatacgtcaa gaaaaatacc       720
     gaataa                                                                  726
//

If you have problems or comments...

PBIL Back to PBIL home page