(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE118

CAGLA1_12.PE118      Location/Qualifiers
FT   CDS_pept        complement(312153..313730)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000066020" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17436739"
FT                   /locus_tag="CAGL0M02761g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /function="telomeric DNA binding"
FT                   /biological_process="regulation of transcription "
FT                   /biological_process="telomere maintenance via telomerase "
FT                   /cellular_component="chromosome, telomeric region "
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG62443.1"
FT                   /db_xref="GO:0000781"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0007004"
FT                   /db_xref="GO:0042162"
FT                   /db_xref="GO:0045449"
FT                   /db_xref="HOGENOM:HBG058413"
FT                   /db_xref="HOGENOM:HBG203887"
FT                   /db_xref="InterPro:IPR001005"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012287"
FT                   /db_xref="InterPro:IPR013867"
FT                   /db_xref="InterPro:IPR014778"
FT                   /db_xref="InterPro:IPR017930"
FT                   /db_xref="UniParc:UPI00003B7054"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJX7"
FT                   /transl_table=1
FT                   /translation="MTGDIQMASSDTEDVNRFANIIEDLPVKTRLTLSTLSLLNDVSTQ
FT                   LLRFLISNAHTPNVIAVISNKENYISTGESEMFHTLVRIFKNIRDVYESRTPLLNVNNV
FT                   APGLWLLNMPPPTILKGHEAYIISTIRKANLVTFILTVINCLPYGFDFLQKVYLDVFCP
FT                   NTILTDQTNGDQVSKFLKPQAIIYLDLKTHAYISSIRDHLGANEQIPDAEKRILLDTIF
FT                   PDNIAMRLVNRKIVAPNEKKILTPSEKEFVGRCERRKETLIKFTNYTDLLNSYDWTFFV
FT                   KELLEYCGKNMNLIVWGKKGRSKTALLEFNPSDFDPQILFATGSHLTTDLAVNSHDPSP
FT                   IGNTFDTGNKEKLIDANELRPLTDAESESINNEIQSALQNESGQGMQKNFMDDAHMSGG
FT                   ENVHSQLVDSNNSILSDVISKSPSVKVVKAKRTWSKEEEKTLITGLIDLGPAWAKILDL
FT                   YGPGGKINENLKNRTQVQLKDKARNWKLHYLKTGKPLPEYLNRVTGNLDKIAKTKRRGS
FT                   KEGSIPPN"
     atgacaggtg atattcagat ggcgtcttcg gatactgaag acgttaatag gtttgctaat        60
     ataatcgaag acttaccggt aaagacgaga ctcacgctct ctacattatc gcttttaaat       120
     gatgtctcaa cacaactgtt aagatttctg atatcaaatg ctcacactcc caatgttatt       180
     gcagtcatct caaacaagga gaattatatc tcaacaggtg aatcggagat gttccacacg       240
     ctggtgagga tcttcaaaaa tatccgtgac gtttacgagt caagaacgcc gctattgaat       300
     gtgaacaacg ttgctcctgg tttgtggctt ttgaatatgc ctccaccaac tatacttaaa       360
     gggcacgaag cttatatcat atctactata cggaaggcca atttggtaac attcattctc       420
     acggtaataa actgcttgcc ctatggtttt gatttcttac aaaaagttta cttggacgtt       480
     ttttgcccta atactatcct aacagatcaa actaatggtg atcaagtctc aaaattttta       540
     aaacctcaag ctatcatata tctagactta aagactcatg cgtacatttc ctcgatccgg       600
     gaccacctgg gcgccaatga acaaataccc gatgccgaaa aaagaatcct actggatact       660
     atcttccctg ataatattgc catgagactt gtgaatagaa agattgttgc cccaaatgag       720
     aaaaagattt tgacgccatc tgagaaagaa tttgttggca gatgtgaacg taggaaagaa       780
     acactaatta agtttaccaa ctacacagac ttattaaata gctatgactg gacatttttt       840
     gtcaaagaat tgcttgaata ttgtggcaag aatatgaact tgattgtttg gggtaagaaa       900
     ggcagatcta aaactgccct tttggagttt aatccatctg acttcgaccc acagattctg       960
     tttgctactg gtagccacct gaccaccgat ttagcagtaa attctcatga tcctagtcct      1020
     attggaaata catttgatac tggaaataaa gaaaagttaa ttgacgccaa tgaacttcga      1080
     ccacttactg atgcagaaag tgagagcatt aataatgaga ttcaatctgc attacagaat      1140
     gagagtggtc aaggaatgca gaaaaatttt atggatgatg cacacatgag tggtggagag      1200
     aatgttcatt ctcagttagt ggattcgaat aattccattt tatctgatgt tatcagtaag      1260
     tctccttcag tcaaggtggt gaaggccaaa agaacatggt caaaggagga agaaaaaact      1320
     ttgatcacag gtttaatcga tctgggacct gcttgggcta agattttaga tctttatggc      1380
     cctggtggta aaatcaatga aaatctgaaa aatcggacac aagtacaact gaaggataaa      1440
     gcaagaaatt ggaagttaca ttatttaaag accggtaagc cgctgccaga atatttgaat      1500
     agagttacag gtaatctaga taaaattgca aagacgaaaa gaagaggaag taaggagggg      1560
     agtattcccc caaattga                                                    1578
//

If you have problems or comments...

PBIL Back to PBIL home page