(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE121

CAGLA1_12.PE121      Location/Qualifiers
FT   CDS_pept        join(complement(321650..321739),complement(320283..320948))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000232073" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17436742"
FT                   /gene_name="RPS0"
FT                   /locus_tag="CAGL0M02849g"
FT                   /product="40S ribosomal protein S0 "
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="small ribosomal subunit"
FT                   /protein_id="CAG62446.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="GO:0015935"
FT                   /db_xref="HOGENOM:HBG481547"
FT                   /db_xref="HOGENOM:HBG736296"
FT                   /db_xref="HSSP:1VI6"
FT                   /db_xref="InterPro:IPR001865"
FT                   /db_xref="InterPro:IPR005707"
FT                   /db_xref="InterPro:IPR018130"
FT                   /db_xref="UniParc:UPI00003B7057"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FJX4"
FT                   /transl_table=1
FT                   /translation="MSLPATFDLTPEDAQLLLAANTHLGARNVQVHQEPYVFNARPDGV
FT                   HVINVGKTWEKLVLAARIIAAIPNPEDVVAISSRTYGQRAVLKFAAHTGATPIAGRFTP
FT                   GSFTNYITRSFKEPRLVIVTDPRSDAQAIKEASYVNIPVIALTDLDSPSEYVDVAIPCN
FT                   NRGKHSIGLIWYLLAREVLRLRGALTDRTQPWSIMPDLYFYRNPEEIEQQTAEEAAQEA
FT                   GEEEAKEEVTEEQTEAAEWAQENADNVEW"
     atgtctttgc cagctacttt tgatcttacc ccagaggacg cccaactttt gttggctgct        60
     aacacccacc taggtgctag aaacgttcaa gtccaccaag aaccatacgt cttcaacgct       120
     agaccagacg gtgtccacgt cattaacgtc ggtaagacct gggaaaagtt ggttttggct       180
     gctagaatca ttgctgccat tccaaaccca gaagatgttg tcgccatctc ctctagaacc       240
     tacggtcaaa gagccgtttt gaagttcgcc gctcacactg gtgctactcc aattgctggt       300
     agattcactc caggttcttt caccaactac atcacccgtt ctttcaagga accaagattg       360
     gtcattgtta ccgacccaag atccgatgct caagccatca aggaagcttc ttacgttaac       420
     atcccagtca tcgctttgac tgacttggac tccccatctg aatacgtcga tgtcgctatc       480
     ccatgtaaca acagaggtaa gcactctatc ggtttgatct ggtacttgtt ggccagagaa       540
     gtcttgagac taagaggtgc tttgactgac agaacccaac catggtctat catgccagat       600
     ttgtacttct acagaaaccc agaagaaatt gagcaacaaa ctgctgaaga agctgctcaa       660
     gaagctggtg aagaagaagc taaggaagaa gttactgaag aacaaaccga agctgctgaa       720
     tgggctcaag aaaacgctga caacgttgaa tggtaa                                 756
//

If you have problems or comments...

PBIL Back to PBIL home page