(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE122

CAGLA1_12.PE122      Location/Qualifiers
FT   CDS_pept        324009..325811
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000718" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17436743"
FT                   /locus_tag="CAGL0M02871g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /protein_id="CAG62447.1"
FT                   /db_xref="HOGENOM:HBG190107"
FT                   /db_xref="HOGENOM:HBG204123"
FT                   /db_xref="InterPro:IPR022751"
FT                   /db_xref="UniParc:UPI00003B7058"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJX3"
FT                   /transl_table=1
FT                   /translation="MVSMRLLMNSLRKRKLLVAIQVVVLFLIFSHSFGTDYLIPYNSNT
FT                   EYASSAARVQPMQLPDPVAKKTLIGNVLRAALDAKPSPFKLDRDALKTSSCPKKGDVSS
FT                   GGIDQFHWTSAKNLKACLNLDDYAIKTLSEAHSRYMKTLFNDKGEFAISKSDFKKLYPN
FT                   EKGIVTLGGGRYTILAMLMIETVRRHGSTLPVEVMFPPEDEGEFDFCNNWLPKHNGRCV
FT                   MMSQEVPFEILQKDKEVRFKSYQIKSLALLLTSFKQFVFIDADNNAMKNIDHIFDTEAF
FT                   KTHGLILWPDLWKRFTNPGFYDIAGVKYDLGKRVRNVNDDASPPETYDPNHSIYTTHDL
FT                   KQREEIAKHLYEDVSLADLDGTIADTTTESGQMMVDNKKHLSTLLLALYYNIYGPDLYY
FT                   YMMSMGTAGEGDKETFISAAHVLHLPYYQVKTNIGFDGYVNDVDNQFKGVGLMQTDFEQ
FT                   DYQRHKQVLKELATEKPLEPVKYQLPNHFQDKMKNPDGTSLDIMFLHASFHKFDPADLA
FT                   KSKQYFKQNGEQVRGYNRIDAYKNFDFELFSFKKLYDNLCTSDHISFKSLKKHEGTEFW
FT                   TSMCSYFKQRVDFLTKTKPANAFI"
     atggtatcaa tgcgactatt gatgaatagt ctacgaaaga ggaagctact cgtggctatc        60
     caagtggtag tgttgtttct tattttcagc cactcttttg gtactgatta tttgatacca       120
     tacaacagca acacagaata tgcatcttct gccgcgcgtg tccagccgat gcagctgcct       180
     gatccagttg ctaaaaagac tcttatcgga aacgtgttga gggctgccct agacgctaag       240
     ccatcgccat ttaagctaga tagagatgct ttgaagacca gcagttgccc aaagaaaggt       300
     gatgtctcat cgggaggtat tgaccaattc cactggacgt ccgcaaagaa cctgaaggcg       360
     tgcttgaacc tggatgatta cgccatcaaa acattgtctg aagcccactc aaggtacatg       420
     aagactctct ttaacgataa aggtgagttt gccatctcaa aatccgactt taagaagctg       480
     tatcctaatg agaaaggtat agtcacgctt ggtggaggta gatatactat cctggccatg       540
     ctaatgatcg aaactgtgag acgccatgga tctacactac cagttgaagt gatgttcccg       600
     cctgaagacg aaggtgaatt tgatttctgt aacaattggc taccaaaaca caacggtagg       660
     tgtgttatga tgagtcaaga agtcccattt gaaattctcc aaaaggacaa agaggttaga       720
     ttcaagagtt accagattaa gtcattggcc ctgctcttaa catcttttaa gcagtttgtg       780
     ttcatcgatg ccgacaacaa cgccatgaag aacatagatc acatcttcga taccgaggca       840
     ttcaagaccc acggtttgat tttatggcct gatttgtgga agaggttcac caatccaggc       900
     ttctacgata ttgccggtgt aaagtatgac ttgggtaaga gagtaagaaa cgttaacgac       960
     gatgcatccc ctccagaaac ctatgatcct aaccattcca tctatactac acacgaccta      1020
     aagcaaagag aagaaatcgc aaaacactta tatgaggatg tatcccttgc cgacctggat      1080
     ggtacaatag ctgataccac cacagagtct ggacagatga tggttgacaa caagaagcat      1140
     ttgtcaactc tattgttggc cctttattat aacatttatg gccctgatct ttactattac      1200
     atgatgtcaa tggggactgc tggtgagggt gacaaagaga catttatttc tgctgctcat      1260
     gtactacatc ttccatatta ccaagtcaaa actaacatag gcttcgatgg atatgttaac      1320
     gatgttgata atcaattcaa aggtgttggc ttgatgcaaa cagattttga acaagattac      1380
     caaagacaca agcaagtatt aaaggagttg gccactgaaa aaccattaga acctgtgaag      1440
     taccaacttc caaatcattt ccaagataaa atgaagaatc cagatggaac ttccttggat      1500
     ataatgtttt tgcatgccag tttccacaag ttcgatcctg ctgacctggc aaaatcgaag      1560
     caatacttca agcaaaacgg ggagcaagtc cgtggttata atagaatcga tgcgtacaaa      1620
     aacttcgatt ttgagttatt tagcttcaag aaattgtacg ataacctttg tacctctgat      1680
     cacatatctt ttaaatcatt gaagaaacat gagggcacgg aattctggac ttctatgtgc      1740
     agttacttca aacaaagggt tgacttttta actaaaacta agcctgccaa tgcattcata      1800
     tga                                                                    1803
//

If you have problems or comments...

PBIL Back to PBIL home page