(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE128

CAGLA1_12.PE128      Location/Qualifiers
FT   CDS_pept        complement(337942..339618)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000174951" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18500887"
FT                   /locus_tag="CAGL0M03003g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="CAG62453.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG176437"
FT                   /db_xref="HOGENOM:HBG325775"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI00003B705E"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJW7"
FT                   /transl_table=1
FT                   /translation="MVLIVTHNMTSEKNNPKSEKTNYDGVVTKSIAFDGCEECSSSDEC
FT                   QSNSDQLSVTSKGCICSVDDCHENDSPFQNPEYFETGFKEVMFIISCMVAQLLNQAGQT
FT                   QSLSTMNVLADYFKSNSSKQPWLMASFPLVSGSFILISGRLGDIYGLKKALSVGYIIMT
FT                   LWSIICGLAKYTNSDAFFIVCRSFQGLGIAFILPNIMGLVGNIYKVGTLRKNIVISCIG
FT                   CMAPAGAALGALFGGLIVTEDAEQWPWVFYAFGIASFVNMLLALYSIPNNVPTNLNNLN
FT                   MDWIGSLLGVSGLLLLNIVWNQAPIVGWGEAYIIVLLIISIILLLIFVVYEIKYATSPL
FT                   LPPSVLENKKILMILAALFFGWGSFGIWTYYYYAFQLNLRKYTPLWAGGTHFMFVIWGT
FT                   VAAFVVALTIKKVGPAVLLCFSMVAFDCGSIMLSVTPVHQTYWRMNVGMQIILSFGMDL
FT                   SFPASSIILSDFLPMQYQGMAGSLVNTVVNYSTSLCLGMGNTVEQQYNAHGADLLKGYR
FT                   SALYLAIGLASAGVCVSLVFLVTDIIAKRHRKRIESECESC"
     atggtgctta ttgttactca taatatgact tcagaaaaaa ataatccaaa atcagaaaaa        60
     actaattatg atggtgtggt aactaaaagc attgcctttg atggctgtga ggagtgcagt       120
     agttcagatg aatgccagtc caactcagat caattgtcag ttacttcaaa aggatgtatt       180
     tgttctgtgg atgactgtca cgagaatgac agcccatttc aaaatcctga atattttgag       240
     actggattta aagaagtaat gttcatcata tcatgtatgg tagcacagtt gttgaatcaa       300
     gcaggacaaa cacagtcctt atctacaatg aacgttttag cagactattt caaatcgaat       360
     agtagtaaac aaccttggtt aatggcctca tttcctttgg tgtcaggctc atttatccta       420
     attagtggta gattaggcga tatttatggc cttaagaaag ccctttccgt cggttatatc       480
     attatgacat tgtggtctat aatatgtggc cttgcaaaat atactaacag cgatgcattt       540
     tttatagtat gtagatcgtt tcaaggattg gggattgcat ttatattacc gaatatcatg       600
     ggtttggttg ggaacatcta caaagttgga acactcagaa aaaatatagt aattagctgt       660
     attggttgta tggcacctgc tggagccgca ttaggtgcac tatttggagg attaatagta       720
     actgaagatg cagaacaatg gccttgggta ttttatgctt ttggaattgc ttcattcgtt       780
     aatatgttat tagcactcta ttcgatacca aataatgttc ccactaatct gaacaatctg       840
     aacatggatt ggattggatc acttctaggt gtttcaggtt tactattact caatatcgtt       900
     tggaatcaag caccaatagt tggttgggga gaggcatata ttattgtgct cctaatcata       960
     tcgataatct tgctattaat atttgtggtt tacgaaataa aatatgcaac ctcaccatta      1020
     ttgccaccct cagtactcga aaacaaaaag attttgatga ttcttgctgc gcttttcttt      1080
     ggctggggct catttggtat ctggacatac tattattacg catttcagtt gaatctcaga      1140
     aaatatactc cattgtgggc aggtggtact cattttatgt ttgtcatatg gggaactgta      1200
     gctgcttttg ttgtggcatt aacaattaaa aaagtaggac ctgctgtgtt gctttgtttc      1260
     tcaatggtgg catttgattg tgggtcaatc atgctcagcg taacacccgt tcatcaaaca      1320
     tattggagaa tgaatgtggg tatgcaaatc atattaagtt ttggcatgga tttatctttt      1380
     ccagcatcct ccataatatt aagtgatttt ctaccaatgc agtatcaagg aatggctggt      1440
     tcattagtga atactgtggt aaactattcg acttctttat gtcttggtat gggtaatact      1500
     gttgaacagc aatacaatgc acatggagca gatttgttaa aaggctaccg ttctgctctg      1560
     tatcttgcta ttggtttagc atcagctggt gtatgcgtca gccttgtatt tttagttacc      1620
     gatataatag ctaagcgcca tagaaagaga attgaaagtg aatgtgaaag ctgctaa         1677
//

If you have problems or comments...

PBIL Back to PBIL home page