(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE129

CAGLA1_12.PE129      Location/Qualifiers
FT   CDS_pept        complement(341849..345613)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000111315" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17436746"
FT                   /locus_tag="CAGL0M03025g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /function="DNA binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG62454.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG058307"
FT                   /db_xref="HOGENOM:HBG203520"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniParc:UPI00003B705F"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJW6"
FT                   /transl_table=1
FT                   /translation="MVSNADETFVAPRLIRVAGGGDDDVHGSGSGAGPANGNSVSGSNT
FT                   GSRGSTPTYRVAQACDRCRLKKTKCDGKIPQCSQCALVGFECKISDRLNRKSFPRGYTE
FT                   TLEERVRELETENKRLMALCNSDLGSNTRSDGLEKQSPSKRKRSPSMERDSERGFTENM
FT                   ELQLQQSCSSCGNSDPNHRCVHLKPVVSNIIVDSNTDVSFEQNVAPGLPAVKALNSMAE
FT                   REESAQLAMLVSLALPRSTEEILFIPQLMANIQKTFGFSSKQSLYTVSLLSSLKKNLPT
FT                   PNSNSSDENLSPNYYVSEDFRPFFYEVLKFDILGETETENGSNRNESPDSTIPNSRSDD
FT                   LLSWMEIQRLVDVYFECWSNTIPIFSRKLFIKQMKAFKTEVDKFGDRLFEVYKTEQIKI
FT                   NFLKIFATVLAVMCQMALLSRLKQLEATTQELECKRTQNLIAHYNQLIEKIHLDSFFQD
FT                   MSTTTVQSLQLLSFISFYFLNVGDIPRLYQLRGTVISMAQQLRLHRCPSAVLLSASGST
FT                   MQKFEQGERRLLFWAIYYLDVFYSLQLGVPRLIKDHEIECALPVSEEEDSQLEGRVSDF
FT                   SLAVIRYAKVLGNILDSIFKRNMMSEAATESMAFVHEKALDIWKNRLPEKYGFRLEANG
FT                   LFNFDELTVVKNSEKDLIEKSSILLFYFLAKCMIHLPVIATRSASLEQQLQPGTSSDTS
FT                   ETPKESQNKTPTRVCPSYILMQKAASTMLQVMHYTSEYYLPSPINISRTKARFALLTAC
FT                   SAVEYLKGGSLYVETKNLLENLIIKLELERKLDLPGIISWHSLKLLDMALMLLLQSPTT
FT                   KMEKLDKLVQKKINHYNRQMGIPAMKLSNSRKNNKKIKLENESSQLSSTSNPIAKGELK
FT                   SDSVVCEEDDNVNDNEVTTTAKLEENNEFINPNKIEQGVTSNTLAFSFSSTDLSALFNA
FT                   PESLFKVPNENTQYNQQHEMHNNSISSSHSKEPVNKERDSDKQELNAIFNETQNRSTSF
FT                   AKLMLLLNNEHKSLSSSLENDVRNVGNKLSSENAGQLPSHGATSGLNSKGNEFLSMNTL
FT                   YGGDNDFIIDASLGLAPLLSENNEIHRQHEGTQVQAGNNDILSTRIGFNGKDDYSNSRS
FT                   FTNEMFGGSDTKRTRSDTTALLTANSELTHDSQDGNVNFGSTNSELHERLNNNHFDAAT
FT                   SYLPEQKSEYGSSFGNKNTVKSLSPSTSFLDDDTLSLSFGDYSTQRRPRRYPNYNNTLG
FT                   KDSLAMKTEINGGRNQGNLHDLFQWQNSK"
     atggtgtcta atgctgatga aacttttgtg gcgcctaggt tgattcgggt agctggcggg        60
     ggagatgatg atgtgcacgg gagtgggtct ggtgcgggcc ctgctaatgg gaactcagtt       120
     tctgggagta acacaggtag tcgagggtct acacctacat atagagtggc acaggcttgt       180
     gatcgttgcc ggttgaagaa gaccaagtgt gatgggaaga taccgcagtg ttcgcagtgc       240
     gcgctggtcg ggtttgagtg taagattagc gataggctca atagaaaatc cttcccaagg       300
     ggatatactg agacactaga ggagcgtgtt cgggagctgg aaactgaaaa caagcgttta       360
     atggccttgt gcaactctga cctgggaagc aacacgagaa gtgatggttt agagaagcaa       420
     tcgccctcaa aaaggaagag atcaccatct atggaacgag atagtgagcg cggattcact       480
     gaaaacatgg aattacaatt gcagcagagc tgctctagct gcggaaactc agaccctaat       540
     catagatgtg ttcatctgaa gcctgttgtt tcgaacatca ttgtggattc aaacaccgat       600
     gtgtcttttg aacaaaatgt agcaccagga ctgccagcag taaaagcatt aaattccatg       660
     gctgagagag aggaaagtgc acagttggct atgttagtat cattagccct gcctagatcg       720
     acagaggaaa ttctattcat accacaatta atggctaata tacaaaagac cttcggattt       780
     tcatcgaagc agtcattata tactgtatca ttgctgtcat cattgaagaa gaatctgcca       840
     acacctaata gtaattcatc ggacgagaat ctatcaccta actattatgt ttcagaggat       900
     tttcgcccat tcttttatga ggttttgaag tttgatatac ttggagaaac agaaactgaa       960
     aatgggtcaa atagaaacga atctcctgat agtactatac ctaatagtag aagtgatgat      1020
     ttattgtcat ggatggaaat acaacgtcta gttgatgtgt actttgaatg ttggtcaaat      1080
     acgataccga tattcagtag aaaattattc ataaagcaga tgaaggcttt taagacagaa      1140
     gttgacaaat ttggtgatag actctttgaa gtctacaaaa ccgaacaaat aaagattaat      1200
     tttctaaaaa tttttgctac agtcttggcc gttatgtgcc aaatggcttt gctgtctagg      1260
     ttgaaacaat tggaagctac gacgcaagaa ttggagtgca aaagaactca aaacctaata      1320
     gcgcattata accagcttat agaaaaaatc catttagact ctttcttcca ggatatgtcg      1380
     accacaactg tgcaaagtct tcagctgctg tcgtttattt cgttttactt cttgaatgtt      1440
     ggtgacattc cgcggttgta tcagttaaga ggaacagtaa tatctatggc tcaacaattg      1500
     agattacata gatgtccaag tgctgtgttg ctttcagcat cggggtcgac aatgcaaaag      1560
     tttgaacaag gtgaaaggag attattattc tgggcaatat actatttaga tgtattttac      1620
     tccctacagt tgggtgtacc gcggctaatt aaagatcacg aaattgaatg tgccttaccc      1680
     gtctctgaag aagaagatag tcagctagaa ggtcgagttt ctgacttttc tctagcggtt      1740
     atcagatatg ccaaggtctt gggtaatatt ctagattcta tattcaagag aaatatgatg      1800
     tccgaagcgg caactgaaag tatggccttt gttcatgaga aggcgcttga tatttggaaa      1860
     aatcgtctgc ctgaaaagta tggtttccgg ttagaggcaa atgggctttt caactttgat      1920
     gaattgactg ttgttaagaa ttccgaaaag gatttgatcg agaagtcgtc aatattatta      1980
     ttttatttct tggcgaagtg tatgattcat ttgcctgtaa tcgcaacaag gtcggcctca      2040
     ttagagcagc aacttcaacc agggacgtct tctgacacat ctgaaactcc aaaagaaagt      2100
     caaaataaga caccaacgag agtttgtcca tcttatattc taatgcaaaa agcagccagt      2160
     accatgcttc aggtaatgca ttatacttca gaatactatt tgccttcacc gatcaatatc      2220
     tctaggacaa aggccaggtt tgcattgttg actgcctgta gcgctgtaga atatctgaag      2280
     ggtggttcgt tatatgtgga aacaaaaaac ctccttgaga acctaataat taagctggag      2340
     cttgagagga agctggattt accaggaata atatcttggc atagtttgaa attattagat      2400
     atggctttga tgttactgct acaatctccg acaactaaga tggaaaaact agacaaacta      2460
     gtccaaaaga aaattaacca ttataatagg caaatgggta ttccagctat gaagctctcc      2520
     aacagcagga agaataataa aaaaatcaaa ttagaaaatg agtctagcca gctttccagc      2580
     actagtaacc ccatagcaaa gggagaatta aagagtgatt cagttgtttg tgaagaagat      2640
     gataatgtga atgataatga agttacaact actgctaagc tagaagaaaa taatgaattt      2700
     ataaacccca ataaaattga acaaggagtt acttctaaca cacttgcctt ttcatttagt      2760
     agtactgatt tatcggcttt atttaatgca ccagaaagct tgtttaaagt acccaatgag      2820
     aatactcagt ataatcaaca gcatgagatg cataataata gtatttctag ttcccattca      2880
     aaagagcctg taaataagga aagggatagt gataaacagg aactaaacgc cattttcaat      2940
     gagactcaaa atagaagtac aagttttgct aaactaatgc tactcctcaa taatgagcat      3000
     aaatcacttt catcatctct tgagaatgac gttagaaatg taggcaacaa actttcaagt      3060
     gagaatgctg ggcagttacc atcacatggt gccacttcgg gcttaaattc gaaaggtaat      3120
     gaatttttgt caatgaatac actttatgga ggagataatg atttcattat tgatgcgtct      3180
     cttggtttgg cacctttgct atctgaaaat aatgaaattc atagacagca tgaaggaacc      3240
     caagttcaag ctggaaataa tgatatatta tctacaagga taggttttaa tggtaaggat      3300
     gattattcga attctcgaag cttcacaaat gaaatgtttg gtggttcgga cactaagcga      3360
     acaagatctg atacaactgc tctcttgacc gcaaattcag aattgacgca tgactcacag      3420
     gatggtaatg tcaattttgg gtcaacaaat tcagaattac atgagaggtt gaataataat      3480
     cactttgatg ccgcaacttc atatcttcct gaacagaaga gtgaatatgg atcctcattc      3540
     ggcaataaaa atactgtaaa gagtttgagc cctagtacta gctttctaga tgacgataca      3600
     ttgagtttat cctttgggga ttacagtact caaaggaggc caagaagata ccctaattat      3660
     aacaatacac tagggaagga ttcattggcc atgaaaactg aaattaatgg cggtagaaat      3720
     caaggaaatc tgcatgattt gttccagtgg caaaattcga aatag                      3765
//

If you have problems or comments...

PBIL Back to PBIL home page