(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE130

CAGLA1_12.PE130      Location/Qualifiers
FT   CDS_pept        346435..347349
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000176611" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17436747"
FT                   /locus_tag="CAGL0M03047g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /protein_id="CAG62455.1"
FT                   /db_xref="HOGENOM:HBG191816"
FT                   /db_xref="HOGENOM:HBG627717"
FT                   /db_xref="InterPro:IPR003737"
FT                   /db_xref="UniParc:UPI00003B7060"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJW5"
FT                   /transl_table=1
FT                   /translation="MLKRPNTPTMKSIRNFPFSKLLFKLTKLTIIFQVLYIYFTPKVED
FT                   LNKENLTKLLPTHDNFGVLNLVIAHPDDEIMFFSPTILQLIDHVQELNVVCLSNGDADG
FT                   LGELRAKELKDAIGYLTVNRNLRNVSLNILDYTDGQNEVWSGVATDLKKYILTSEPGVK
FT                   QKDIILTFDREGISGHRNHIACNEGVISYLKTIKSNSFVFLELKSLSTWQIISKYSGVV
FT                   PKLLEIIYNKIRASNKTFVSYLPNRDSIATDSNVCFISTFDQYALSFAAMCYAHKSQMV
FT                   WFRYLWWSFSRYVFVNDLSRITV"
     atgctgaaga ggccaaatac accaacaatg aaatccataa gaaacttccc gttctcgaaa        60
     ctcctgttta agctgacgaa gctgacgata atctttcaag tactgtacat atacttcact       120
     cctaaggtag aagacctgaa caaagagaac ttgacgaaac tgctacctac ccatgacaac       180
     tttggtgtgt tgaatctggt gattgcacac ccagatgatg aaattatgtt cttttcccca       240
     actatactgc aactaatcga tcatgtccag gaactcaacg ttgtctgtct gtcaaatggt       300
     gatgccgatg gactcggcga actaagagcg aaagaactga aagacgctat cgggtatttg       360
     actgtaaaca ggaacctcag aaatgtgtcc cttaacatcc tcgattacac cgatggccaa       420
     aacgaagttt ggtctggtgt cgccacagat ttgaagaaat atatcttgac ctccgaacct       480
     ggtgtcaaac agaaagatat catcttgacc tttgataggg aaggtatctc tggtcacagg       540
     aatcacattg cctgtaacga aggcgttatc tcctacctca agaccatcaa atcaaacagc       600
     tttgttttct tggaattgaa atcattgtcc acatggcaaa tcataagcaa atactccggt       660
     gttgtcccaa aattgttaga aatcatctat aacaagatca gagccagcaa taaaaccttc       720
     gtgtcatact tacctaatag agattctatt gccacagaca gtaacgtgtg ctttataagc       780
     acttttgacc aatatgctct ctcctttgcc gcaatgtgct acgcccacaa atcccagatg       840
     gtctggttta ggtacttatg gtggtcattc tcaagatacg tatttgtgaa tgacctatca       900
     cgtatcactg tttag                                                        915
//

If you have problems or comments...

PBIL Back to PBIL home page