(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE131

CAGLA1_12.PE131      Location/Qualifiers
FT   CDS_pept        complement(347584..349230)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19348729"
FT                   /locus_tag="CAGL0M03069g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /protein_id="CAG62456.1"
FT                   /db_xref="HOGENOM:HBG124034"
FT                   /db_xref="UniParc:UPI00003B7061"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJW4"
FT                   /transl_table=1
FT                   /translation="MRKQVIGINNIFHLARIRSIPVHCHCKGPLYSYPVVSKTLFHTKN
FT                   VEVSKYSHVELRSLNEQIHSQLTSLTDLNKRQLLLVETLSRNNNLEKLLDYYEIDEGSV
FT                   EDAIQLLQDSNVSIQEFSSMIQPVLNRTNLVGKYHMGYLSKLMQIYISLTRTHNGGSVD
FT                   ALNKDDMNKFIKRFIEGSQLKRAQTALQFLLDGYKERGEDLLGPYGDKQTIAHFLMLRS
FT                   GALQDLWKIDVSNGNNKKQAFYKINGSHRNVKSTYNVLDSVKLFEIVRYILRYNDKDNH
FT                   SQPVYFDEGILKNVILCLGYVGQTTLIEDIINKIWELDSVSVPPKYNITVTSDLLTAIV
FT                   SAYSKCGKSIQPGLVIADKFFGKIPNIIVKDDFWINLQKWNIILPNKWRSTIDLSKRTW
FT                   ELMKSWRNSTNNGGFITANVEFLNLVYKVLSSDYIKLKDLEWIYDIFQHSLVTLYSKNS
FT                   LTVDEIKLLKKFQIFTIKKMVYFGHYSKCLQFIKEWSYDAANKQQLTNLFVVLRNRYLQ
FT                   KRGYNQEKEMTKVQKKYDEEEQEDMLLGGLW"
     atgagaaagc aggttattgg aattaataat atcttccatt tagcaaggat acgaagtata        60
     cctgtacatt gtcattgtaa aggtccatta tattcttatc cagttgtctc caaaaccttg       120
     tttcacacaa aaaatgtcga ggtgtcgaag tattcacatg tggagctcag atcactgaat       180
     gaacaaatac actctcaact tacatcatta actgatttga ataaacggca actgctcctt       240
     gttgaaacac tcagccgaaa taataactta gaaaagctct tagattacta cgaaattgac       300
     gaaggatcag ttgaagatgc tatacagctt ttgcaggata gtaatgtcag catccaggaa       360
     ttttcatcaa tgattcaacc ggtacttaat aggacaaacc tagttggtaa ataccatatg       420
     ggatacttat cgaaactaat gcaaatttat atctcactga caagaactca taatggtggg       480
     agtgttgacg ctcttaataa agatgatatg aacaagttca taaagcgctt tattgaagga       540
     agtcaattaa agagagctca gacggctctg cagtttttac ttgatggcta caaggaaaga       600
     ggagaagatt tgttgggacc ttatggtgat aaacaaacaa tagcacattt cctaatgcta       660
     agatccggtg ctttgcagga cctttggaaa attgatgtgt caaatggtaa caataaaaag       720
     caggcatttt acaaaataaa tggcagtcac agaaatgtta aatcaacata taatgttcta       780
     gatagtgtga agctttttga aatagttcgt tatatcttac gctacaatga taaagacaat       840
     cattcacaac ctgtttattt tgatgaaggt atactaaaga atgtcatact ttgtttaggc       900
     tatgttgggc agacaacatt gattgaggac attatcaaca agatatggga gttagactct       960
     gtctcagtac cgcccaaata taatataaca gttacaagtg atctcttaac tgccattgta      1020
     tcggcttact ctaaatgtgg taaaagtatt cagccaggtt tggtaattgc tgataaattt      1080
     ttcggtaaaa ttccaaacat aattgtgaag gatgatttct ggataaacct tcaaaaatgg      1140
     aatattatat tacccaataa atggcgttcc accatcgatc tttctaagag aacatgggag      1200
     ctgatgaaaa gctggagaaa ttcaaccaat aatggtgggt ttattactgc aaatgttgaa      1260
     tttctgaacc tagtatataa ggtcttaagc agcgactata tcaaactcaa ggatttggag      1320
     tggatttatg atatatttca gcactcacta gtgacacttt attcaaaaaa tagcttgacg      1380
     gttgatgaaa ttaaactctt gaagaagttt caaatattca ctataaaaaa aatggtgtat      1440
     tttgggcatt actcaaaatg tctccaattt ataaaagaat ggtcatatga cgcagcaaac      1500
     aagcagcaat taacaaatct atttgttgtt ctaagaaata gatacctaca aaagagagga      1560
     tataaccaag aaaaggaaat gactaaggtt caaaagaaat acgatgagga ggaacaggaa      1620
     gatatgctgt tgggaggact ttggtga                                          1647
//

If you have problems or comments...

PBIL Back to PBIL home page