(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE133

CAGLA1_12.PE133      Location/Qualifiers
FT   CDS_pept        352552..354423
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000000807" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21044352"
FT                   /gene_name="EXO70"
FT                   /locus_tag="CAGL0M03113g"
FT                   /product="Exocyst complex protein EXO70 "
FT                   /biological_process="exocytosis"
FT                   /biological_process="protein transport"
FT                   /cellular_component="cellular bud neck"
FT                   /cellular_component="exocyst"
FT                   /protein_id="CAG62458.1"
FT                   /db_xref="GO:0000145"
FT                   /db_xref="GO:0005935"
FT                   /db_xref="GO:0006887"
FT                   /db_xref="GO:0015031"
FT                   /db_xref="HOGENOM:HBG059390"
FT                   /db_xref="HOGENOM:HBG202183"
FT                   /db_xref="InterPro:IPR004140"
FT                   /db_xref="InterPro:IPR016159"
FT                   /db_xref="UniParc:UPI00003B7063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FJW2"
FT                   /transl_table=1
FT                   /translation="MNEIDVDEADILVLSQGLEKTSRLTHQVNKSLAKISKTSAQSSQL
FT                   FGPILARNNVLKTLQRNIDSTLNSVASVKDLANEASKHEVLLRKGIASLGLKPFTVELH
FT                   KLEDMYQDMSVGNSRHTENAEFHGILKHLKEMITSSEEQLELEFIQILKRIEPFDPQIN
FT                   MEKKIPFPYYSDEDISQMLIIFNYFYVKSEDSRMQDIFIRERGDQMLKSMAFMEPFAKK
FT                   VTSSKNAPYEKGSSGFINYTEAVLGFIANERSLIDDVFSQFAEIKPRVLRNILDPIVAA
FT                   FCKVLMSDLIFVKSNIDNAGLFSFELTECISGVQKSVKGMNLKNQMQLIDADKQVKDVT
FT                   RSLFKDTVDRIKSKTNQMTTIPSDNGVTEATVDTMSRLRKFSEYKTGCLAAMESISRDV
FT                   WLSKSFREKEYTIQSAAIADNETAASLLSCFLSDCIDTLVANLERRAQTILMPNQEPDV
FT                   ANPNSARNKFKQRIGFLVLMNMTLVEQIVEKSELSVMLGNLGKARIEKLKKRYVNYLVA
FT                   DWKDLTVNLMDTVVIDSVGKKSKDKEQIKEKFRRFNEGFEDLISRTKQYKLSDPALKRL
FT                   LKSEIVALLMPMYDRFYGRYKDSFKNPRKHIKYTPDDITNVISQTLR"
     atgaacgaga tagatgtcga tgaagccgat attcttgttc tttcgcaagg gctagagaaa        60
     actagtaggc ttacacatca ggtaaataag tcattagcga agatatcgaa gacttcggct       120
     caatcgagtc agctatttgg cccgatacta gcaagaaata atgttctcaa aacattacaa       180
     agaaatatcg atagtaccct gaactcggtg gcatcagtaa aagatttggc aaatgaagca       240
     tcaaaacatg aggttctgtt aaggaaaggt attgcgagct taggtttgaa accatttacg       300
     gtcgaactac acaaattaga agacatgtac caggacatga gtgtaggaaa ttcgaggcat       360
     actgaaaatg cagagtttca tggtattttg aaacacttaa aagaaatgat aacatcgtca       420
     gaggaacagt tagaattgga atttattcaa atactgaaaa gaatagaacc atttgatcca       480
     cagataaata tggagaagaa gataccattt ccttactatt cagatgaaga tatatcacag       540
     atgttaatta tttttaacta cttttatgtg aaatcagaag actcaagaat gcaggatatt       600
     tttatcagag agagaggaga ccaaatgctg aagtcaatgg cttttatgga accattcgca       660
     aaaaaggtaa cttcaagcaa aaatgctcct tatgagaaag gtagtagtgg tttcattaac       720
     tacactgagg ccgtacttgg atttattgct aatgaaaggt ccctaataga tgatgttttc       780
     tcacaatttg cagaaataaa acctagagtc ctaagaaata ttttggatcc aatagttgca       840
     gcattttgca aggttttgat gagtgactta atatttgtca agtcaaacat cgataatgct       900
     gggttgttca gttttgagct tactgagtgc attagtggag tccaaaaaag tgttaaaggg       960
     atgaacttaa aaaatcaaat gcaattgatt gatgctgaca agcaagtcaa agatgtaaca      1020
     agatctttgt ttaaagatac agttgataga attaaatcaa aaacgaacca gatgacaact      1080
     atcccttcag acaatggtgt tactgaagct actgttgaca caatgtcgag gttgagaaag      1140
     tttagcgaat ataaaacagg atgcttggca gcaatggaaa gcatatcgcg agatgtgtgg      1200
     ctgtctaaat cgttcagaga aaaagagtat acgatccaaa gtgctgctat tgcagataat      1260
     gaaacagcgg cttcactttt atcatgtttt ttaagtgatt gtattgacac tcttgtagca      1320
     aatcttgaaa gaagagcaca gactattttg atgccaaatc aagaaccaga tgttgctaat      1380
     ccaaatagtg ccagaaataa gtttaaacaa aggataggtt tcttagtatt gatgaacatg      1440
     acattagttg agcaaatagt cgaaaaatca gaactaagcg taatgcttgg taatttaggc      1500
     aaagccagaa tagaaaaact aaaaaagaga tatgtcaact acctagtcgc agattggaag      1560
     gacttaactg tcaacttaat ggataccgtt gttattgata gtgtaggtaa aaaatcgaaa      1620
     gacaaagaac aaattaaaga aaagtttagg aggtttaatg aaggttttga agacttgata      1680
     tcaagaacca aacaatataa actctctgat ccagcattga aacgcctact caaaagtgaa      1740
     attgtggctt tattgatgcc aatgtatgat agattctatg gccggtacaa ggactcattc      1800
     aaaaacccta gaaagcatat taaatataca ccagacgata ttacgaacgt catttcgcaa      1860
     actttgaggt ag                                                          1872
//

If you have problems or comments...

PBIL Back to PBIL home page