(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE135

CAGLA1_12.PE135      Location/Qualifiers
FT   CDS_pept        358599..361211
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17437832"
FT                   /gene_name="IRS4"
FT                   /locus_tag="CAGL0M03157g"
FT                   /product="Increased rDNA silencing protein 4 "
FT                   /function="calcium ion binding"
FT                   /biological_process="lipid metabolic process"
FT                   /protein_id="CAG62460.1"
FT                   /db_xref="GO:0005509"
FT                   /db_xref="GO:0006629"
FT                   /db_xref="HOGENOM:HBG124035"
FT                   /db_xref="HSSP:1EH2"
FT                   /db_xref="InterPro:IPR000261"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="UniParc:UPI00003B7065"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FJW0"
FT                   /transl_table=1
FT                   /translation="MHMRLNKRRRNHVQEQMSELPQDAKNDSLAAAQVIFKRHADNANS
FT                   TPPSPVGLDSAGHLDKQADTAQRVHKVGTPSGTSSSHNSGNEGMHKVTKPLGENTATTA
FT                   PIAIKQPVRVVRASPTAIVSPTSHTPLDAATAAANVVAEKSKIRTTQQQLQDKKRRDIE
FT                   NAHHAASAAAVTSSNLAVGSPPSQYIPSVPTLNVTSPQMRNSSQNIDRRSKSNEEAHNG
FT                   HEKMMNSRSNSINSSTIKGSVSEPNTVTPLRQNSPSNMDDIIQKMEAVDIDEGRKNSFV
FT                   MNGSGDSVDSLKPNVVRRPMRTPSGRRVRPPSPIDKIGSIQEPHLESTGFNDQNDFSEM
FT                   SSLIDGSSSEDITKIRGSGIRERSPVDGVEHGGMSVNIPMQRSLSSDVLSPSQQAAMVA
FT                   ATKLSPSTQTLPVEELEYLASTGDVSAYKALNKINGTNMAYKGTIPDLIPSRARAQKTS
FT                   KLKFKIFGGGKNSDRRNNATPIGYDPVMNISTDFGGKKVVESNQNNVKFKTTMRSQKYL
FT                   GNDNLDDNDLRTQYIDDDDDDDDYDSAYEDLDYSRDDSEAMYKGDRESSNPRSNSLLQS
FT                   SSYSGKVGFNSNANSGTSINNSGNVSNLDYSLRDGVAEKKKSRRDKIKKKLKSTASVVP
FT                   YYPHYALTHLASGVSTVNSNLNNSNKNTKWFNEDKPWKSHKDVGFVTSQERKRYEAMWV
FT                   TNRYLYLNLLPWWPKEEVEKDEDDSASNLNSNASTNVGGVLSDGDNEEDDVTRFLLSLP
FT                   ADGLMLNLVAKDIWERSNLPNDLLKQIYDLVDTRKDGTLNRESFLVGMWLVDQCLYGRK
FT                   LPQELDPKIWDSVDRWVLNVVNSTMMTALERKQKKKMMKKELKNIKREQKQAIAEQHN"
     atgcatatgc ggctaaataa acggaggagg aaccatgtgc aggagcagat gtctgagctc        60
     ccgcaagatg ccaagaacga ttcacttgcg gcagcgcagg ttatcttcaa acggcatgca       120
     gataatgcga acagtacacc accgtcgccc gtagggctag attctgctgg gcacctggat       180
     aaacaggctg ataccgcaca gagagttcac aaggtcggca ctccaagtgg tacatctagc       240
     agccacaata gtgggaacga gggtatgcac aaggtgacaa agccattggg agaaaatacg       300
     gcaactacag ctcctatagc aataaaacaa ccagtgcgtg tggttagggc atcgccaaca       360
     gcaatagtat cacctacttc ccatactccg cttgatgcag ccactgccgc agctaatgta       420
     gtggcagaga agtccaaaat cagaacaact caacagcaat tacaggataa gaaaaggaga       480
     gatatagaaa atgcgcacca tgcagcttct gcagccgcag tcacttcctc taatctggct       540
     gttgggtccc ctccatctca atatattcct tcggtgccaa cattgaatgt aacatcccca       600
     caaatgagga atagtagcca gaatatagat aggagatcaa aaagtaatga agaagcacat       660
     aatggtcatg agaagatgat gaattcgaga tctaattcga taaactcgag cactattaag       720
     ggatctgtgt ccgaacccaa tacggtgaca ccattaagac agaactcccc cagtaatatg       780
     gacgatatta ttcaaaaaat ggaagcagtt gatattgatg agggtcggaa aaacagtttt       840
     gttatgaatg ggtctggtga cagtgtggat agccttaaac ctaacgttgt tagacggcct       900
     atgagaacac catcaggaag gcgagtacga cccccatcac caatagataa aataggtagt       960
     attcaggagc cgcatttaga aagtaccggt ttcaatgatc aaaacgactt ctctgaaatg      1020
     tcatctctta ttgacgggtc ctcatcagaa gatatcacaa aaataagagg cagtggtatc      1080
     cgagagaggt caccagttga tggagtggaa catggaggta tgtcagtaaa tataccaatg      1140
     cagagatcct tatcgtccga tgtcctttca ccttcacaac aagcagcaat ggtagcggcg      1200
     accaaactat cgccgagtac gcagactctc cctgttgaag aactagagta tcttgcttcc      1260
     actggtgatg tttctgctta taaggctcta aataagatta atggaactaa tatggcttat      1320
     aagggaacta ttccagacct aataccaagt cgtgcaaggg ctcagaagac aagtaaattg      1380
     aaatttaaaa tattcggtgg tggaaaaaat agtgatagaa gaaataatgc tacacctatt      1440
     ggatatgacc ctgtaatgaa tatcagcacc gattttggag gtaaaaaagt ggttgaatca      1500
     aaccagaata atgttaaatt taaaactacg atgcgcagcc agaaatattt aggaaatgat      1560
     aatcttgatg acaatgatct caggacccag tatattgatg acgatgacga tgatgatgat      1620
     tatgatagtg cttatgaaga tttggattat tctcgagatg atagtgaggc tatgtataaa      1680
     ggcgacaggg aatcgtcgaa ccctcgaagt aacagtttgt tgcaaagcag tagttattct      1740
     ggtaaggttg gttttaatag taacgcaaac agcggtacat caattaacaa ttctgggaac      1800
     gtaagcaatt tggattattc attgagagat ggtgtagcgg agaagaagaa aagtcggaga      1860
     gataaaatca agaaaaaact gaaaagcacg gcatcagttg tgccatatta ccctcattat      1920
     gcgctgacgc atttagcaag tggagtaagc actgtaaaca gtaatttaaa caatagtaac      1980
     aagaacacta aatggttcaa tgaggacaag ccatggaagt cgcacaagga tgttggcttt      2040
     gtcacaagtc aagaaaggaa aaggtatgaa gctatgtggg ttactaacag atatctatat      2100
     ttgaatcttt tgccctggtg gccgaaggaa gaagtagaga aagatgaaga tgatagtgct      2160
     agtaacttaa atagtaatgc tagcaccaat gttgggggtg tattgagtga tggtgataat      2220
     gaagaagacg atgtcacccg attcttactt tccctgccgg ctgatggact gatgctaaat      2280
     ctagtggcta aggacatctg ggaacggtct aacttgccca atgatctgtt gaaacagatc      2340
     tatgaccttg ttgacacccg aaaggatgga accttgaaca gagaatcctt cctagtagga      2400
     atgtggctcg tagaccaatg tctatacgga cgcaaactgc cacaggagct agacccgaag      2460
     atatgggaca gcgtggaccg ctgggtgctc aacgttgtga actctaccat gatgaccgcg      2520
     ctcgagagaa agcagaaaaa gaaaatgatg aagaaagagc tgaagaacat caaaagagaa      2580
     caaaaacaag ccatcgcaga acagcataac taa                                   2613
//

If you have problems or comments...

PBIL Back to PBIL home page