(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE136

CAGLA1_12.PE136      Location/Qualifiers
FT   CDS_pept        362253..364484
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000066085" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17437833"
FT                   /gene_name="IML2"
FT                   /locus_tag="CAGL0M03179g"
FT                   /product="Mitochondrial outer membrane protein IML2 "
FT                   /function="binding"
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="mitochondrial outer membrane "
FT                   /protein_id="CAG62461.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0005741"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG124036"
FT                   /db_xref="HOGENOM:HBG395662"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="InterPro:IPR019412"
FT                   /db_xref="UniParc:UPI00003B7066"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FJV9"
FT                   /transl_table=1
FT                   /translation="MFKVFGALSGKGSSDSNGNSTRSSINEKRTKLILKEANDFEIALR
FT                   AMDYVLDDRTEEGLALLRENEKVNGQNQTITVLARGVIEFLQATLSFEMEEIKNASNTL
FT                   AKAEQLSWKSRTEAQKSGIRNSSIYPPGTVYAVTYTESCLLHALLMLFTESMMDAAKAL
FT                   LKLRKAYSMLHEIMEVVKKSELSRKVSSSSAVSIQSNGSFVSEEATFVSADIPYQLSET
FT                   ESNDPELWAFAEKIYKMRKLRLSGAHIGNTPAISRLRSGLGLSASNKSEELANSEQSVL
FT                   SDEAAERQATIDEFIHSGVNLCYGILQVVLSLIPPAIGAVLSIVGFRGSREEGLRLIWK
FT                   ATKDRNVHGCIGLLGLMFYYDGPFQFTDVDFDIPPALSNTKTSDSDTDRDGSISIDEMD
FT                   GHALLHPGPILEEALLHARALFPNSALWLLNEARMLSSRGRLPEAIELLDSIDVESIHM
FT                   RQVKGLLVFDKAITLVHMQEYERAATNLLSLLKISDWSHAFYTYFAGCCYLENWRMAQM
FT                   GFIKDDKLEFYREKAEELIFSAPKLLGKKTFKSKNLPLDRFMLRKVEQFKATQKKLGVK
FT                   NILDAIGTSPIREITYFYNGYNRMSKSDLEIAQKMLTSYHNPAIDQHDPDQELIKNLLL
FT                   SLTMRRLGDVESGVKLLDEKVLPSIYYMQNGKVKYIKKTEDPWAYPTALYERALFTWKL
FT                   DGVDNLSECRHWLVTAQNYAGDYELSTRVGMKIKAALDRVEESLQHGTA"
     atgttcaaag tgtttggtgc actgtccggg aagggcagca gtgactccaa tgggaattcc        60
     accaggagta gtatcaatga gaagaggacc aaattgatcc tgaaggaggc taatgacttc       120
     gaaattgcgt tacgggccat ggactatgtt ctggatgaca ggactgagga aggccttgca       180
     ctgttgaggg aaaatgagaa ggttaatggg cagaatcaga ccattactgt cctcgccagg       240
     ggtgtcatcg aattcttgca agctacatta agtttcgaga tggaggagat caagaatgct       300
     tctaatacgc tggccaaagc ggagcaactg tcgtggaagt cccgtactga ggctcagaaa       360
     tcgggtatca ggaatagttc tatctaccca ccaggtactg tgtacgcagt cacttacact       420
     gagtcatgtc tcttgcatgc cctcttgatg ttgtttactg agagtatgat ggatgcagca       480
     aaagcattac ttaagctgag gaaagcatat tcaatgcttc atgaaataat ggaagtagtc       540
     aaaaagtcgg aattgtcaag aaaagtttca agttcctctg cagtgagtat tcaatcaaat       600
     ggtagttttg tttcagaaga agctacattt gtatctgcag atattccata tcagttatca       660
     gagaccgaat ccaatgatcc cgaactgtgg gcctttgcag agaagatata taagatgagg       720
     aaactgcggc tatcaggggc tcatatcggt aacacacctg ctatctcaag attaaggtca       780
     ggattaggac tatcagcttc aaataaatcg gaagagcttg caaatagtga acaatcagtt       840
     ctgtccgatg aagctgctga aagacaggct actattgatg aatttatcca ttcaggtgtc       900
     aacctgtgct acggtatttt gcaagttgtt ctatctttaa ttccaccggc tatcggagct       960
     gtactttcta tagttgggtt tagaggttca cgtgaagaag gtttaaggct aatttggaag      1020
     gctacgaaag acagaaatgt tcacggttgc attggtcttc ttggactaat gttttattat      1080
     gatggtccat tccagtttac cgatgttgat ttcgatatac cacctgctct aagtaatacc      1140
     aaaacttcag acagtgatac tgatcgtgat ggatctattt caatcgatga gatggatggg      1200
     catgcattat tacatccggg acctatcctc gaagaagcac ttttgcatgc aagagcatta      1260
     tttccaaaca gtgcattatg gttactaaat gaagctagga tgctatcaag tagaggtaga      1320
     cttcctgagg caattgaatt gctggattcc attgatgtag agtctatcca tatgagacaa      1380
     gtaaaaggtt tattagtatt tgataaagct atcacattgg ttcatatgca ggaatatgaa      1440
     agagcagcta caaatttgtt gtccttattg aaaatcagtg actggtctca tgcattttac      1500
     acttattttg ctggatgctg ttatcttgaa aactggagaa tggcgcagat gggatttatc      1560
     aaggatgata agttagaatt ttatagagaa aaggctgaag agctaatatt cagtgctcca      1620
     aaattacttg ggaagaagac gtttaagtcg aaaaatttgc cattggacag attcatgttg      1680
     agaaaggtag agcagtttaa ggctacacaa aagaagttag gcgttaaaaa tattcttgac      1740
     gctattggca cttctcctat tcgtgaaatt acttatttct ataatgggta taatagaatg      1800
     agtaagagtg atcttgaaat tgcacaaaag atgttgacat cttaccacaa tcctgctatt      1860
     gaccaacatg atcctgatca agaactgatt aaaaacctat tgttatcttt gacaatgaga      1920
     agactcggtg atgttgagag tggtgttaaa ctactcgatg aaaaagtgct accaagtatc      1980
     tactacatgc aaaatggtaa agtgaaatat ataaaaaaga ctgaagaccc ttgggcatat      2040
     ccaacagctc tttacgaaag ggcacttttc acctggaagc ttgatggtgt tgataatttg      2100
     tcagaatgta ggcattggtt agtaacagct cagaattatg caggcgacta tgaattgagt      2160
     accagagtgg gaatgaagat taaagctgcc ttagatcgtg ttgaagagtc tttacaacat      2220
     ggcactgcat ag                                                          2232
//

If you have problems or comments...

PBIL Back to PBIL home page