(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE137

CAGLA1_12.PE137      Location/Qualifiers
FT   CDS_pept        complement(364771..366252)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000233340" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19348982"
FT                   /gene_name="ARP4"
FT                   /locus_tag="CAGL0M03201g"
FT                   /product="Actin-related protein 4 "
FT                   /biological_process="DNA repair"
FT                   /biological_process="chromatin modification"
FT                   /biological_process="regulation of transcription "
FT                   /biological_process="transcription"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG62462.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006281"
FT                   /db_xref="GO:0006350"
FT                   /db_xref="GO:0016568"
FT                   /db_xref="GO:0045449"
FT                   /db_xref="HOGENOM:HBG345785"
FT                   /db_xref="HOGENOM:HBG559892"
FT                   /db_xref="InterPro:IPR004000"
FT                   /db_xref="InterPro:IPR020902"
FT                   /db_xref="UniParc:UPI00003B7067"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FJV8"
FT                   /transl_table=1
FT                   /translation="MSNSALQVYGGDEITAVIIDPGSYTTNIGYAGTDCPQSILPSSFG
FT                   EIHEAEESTSEDNTEKTRKTRKVFSEQSIPIPRPDYEVKRVVENGQVCDWDSAVEQWSW
FT                   ALRNELHIESNRGIPAMLTEPLWNSKENRSKSLEILLEGMEFEACYLTATSTAVSFATG
FT                   RPNSLIVDIGHDIASVTPVIDGMSLSKSTRCNHFAGRFLNKLLTDYLKPREIIPLFEVE
FT                   QRKPEFKRRSFSYSVADSLYDYANSRGFFQECKETIFQVATTPIAQEKNNQATSTGRTI
FT                   ESPWNEVIEFESNDRYQFAEQLINPLKESVPDDWPVNVAGVVETWRNDYVPMKRNKVGS
FT                   GNNKEKEGTKESTPLDSNTATPLPESSSTTNENGKRTAEDIKREELPGIVDLISSSISS
FT                   CDVDIRASLAHNLVITGGSSTIPGLSDRILNELNMKFPALKFRVLATGQSIERQYQSWL
FT                   GGSILSSLGTFHQLWIGKKEYEEVGSERLLHDRLR"
     atgtcaaact cggctttgca agtatacggt ggtgatgaga taaccgcagt tatcatcgat        60
     cctggttcat atactaccaa tattggttat gctggaactg attgcccgca gtccattcta       120
     ccatccagtt tcggtgaaat acatgaagca gaagaaagta ctagcgagga caacacagaa       180
     aaaacaagga aaaccagaaa agtgttttct gaacagtcaa ttcctatccc aagacctgac       240
     tatgaagtaa agagggttgt cgagaatggg caggtatgcg attgggattc tgccgttgaa       300
     cagtggtctt gggcattgag aaatgaactt cacatagaat cgaatagagg aatccctgca       360
     atgttaacag aaccactatg gaatagtaag gaaaatagat caaagtctct ggaaatacta       420
     ttagaaggga tggaatttga agcatgctat ttgactgcaa cttctaccgc tgtgtctttc       480
     gcgacaggac ggccaaatag tttgattgta gatattggcc atgatatcgc atctgttaca       540
     ccagtaatag atggtatgtc gctttccaaa tctacaagat gtaaccattt cgctggtaga       600
     ttcctcaaca aattactgac tgattatttg aaacccagag agataatacc tttatttgaa       660
     gttgaacaac ggaaaccaga attcaagagg aggagctttt catattcggt tgcagattcg       720
     ttatatgatt atgccaactc tcgtggtttt ttccaagagt gcaaggaaac tatatttcaa       780
     gtggctacaa cacctattgc acaagagaaa aacaatcaag ctacttccac tggtagaaca       840
     attgaatctc cttggaatga agttattgaa ttcgaaagta atgacagata ccaatttgca       900
     gaacaactga taaatccctt aaaagaatct gtgccagatg actggcctgt caatgttgca       960
     ggtgttgtag aaacttggag aaacgactat gtacctatga aacgtaataa agtaggaagt      1020
     ggtaacaata aagaaaaaga aggaaccaaa gagtcaacac ccttggatag taatactgca      1080
     acaccattgc ctgaatcgtc aagtaccact aatgagaatg gtaaaagaac ggcggaagat      1140
     attaaaagag aagaattacc tggcatagtg gatctgatat catcttccat atcatcatgc      1200
     gatgtagata ttagagcttc actagcacac aatcttgtaa taacgggagg ttcctcaact      1260
     atacctggac taagtgacag aatcctaaat gaacttaaca tgaaatttcc agctttaaaa      1320
     tttagagttt tagccacggg ccaaagtata gaaagacaat atcaatcctg gctaggtggc      1380
     agcattttat ctagtctggg cacctttcac caattgtgga ttgggaaaaa agagtacgaa      1440
     gaagtcggtt cagaaagatt gcttcatgac agacttcgtt aa                         1482
//

If you have problems or comments...

PBIL Back to PBIL home page