(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE138

CAGLA1_12.PE138      Location/Qualifiers
FT   CDS_pept        complement(366828..370457)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000246781" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18501142"
FT                   /locus_tag="CAGL0M03223g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /function="RNA binding"
FT                   /protein_id="CAG62463.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="HOGENOM:HBG057930"
FT                   /db_xref="HOGENOM:HBG395610"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR004088"
FT                   /db_xref="InterPro:IPR018111"
FT                   /db_xref="UniParc:UPI00003B7068"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJV7"
FT                   /transl_table=1
FT                   /translation="MSLTFATEKELAVDNTPAESSLDSLDGTTFDSDEESKPVEEAPKP
FT                   EPKPLPSLKDLPSLVDSNSFKPATKVEWGPNMKPAAISSSVSPSMSRSASATSAGRMRS
FT                   NNIQETFTLDLQSQLSVTKLELSRILQTVKQANNVSVESTLSRNSRTFLISGPAPKVKE
FT                   AKRELIKMLTRPITENIEVPSRCKAVIIGSGGKNIREISDRYDVKIHISKEPKPDSYNE
FT                   DLDDDLSDISIFGDFESVKQAKAKILSIVNEDLKNITARLSVEDSTLGSFVNVKEVSSD
FT                   DVKVQYYQDTGSFTITGSLDDIKNAKTKIKDYLQKLSNELAEENVKIPSKFQFLIDADE
FT                   VKDRFGVIVKFPKSSSDETVQFAGLKDKVAEAISFARTSSKQYIVDSLDISKAHNKNLD
FT                   HAKRLVIYFQKYNVLDKVAEEFPDVKYVLPSIEDLQNAKEVFIYLSAKNDKTSEIKAAR
FT                   REIIAIVNDITPAETLVIDDLDYELFHRNIKHILLGHESEAKFIQIGDYFKGDDSVVLF
FT                   ATSTDEDFKPSTDEIKESLEKVNANLNDLRKKQNSLEVATYDLESEKQDEFFGKDSVAL
FT                   KLILEDISGDDGHIQIKLHSPEKNKMTLRGDERAVKKANKDIKSIVENPSTTAKITVEV
FT                   PVASVSRLIGNKGANLQKLRNKYNCSIDIPQQGESDQDKTVEITIKGLQFIIEHAKKDI
FT                   ANEAKRLADIVTKELVAQAKYHRNLSGPQGMYRTRLQEKYNVFINFLKENNTITIKGPS
FT                   RGVNKAYDELKALLDFEMENGHKTIVNVPVEHMSRIIGKNGDTINGLSDEFGVELDFLQ
FT                   KSDDPKAVETGVVELEITGNRNAIKEASTKIAAIVSEAADHVTEKLDIDRKYHKTIVGA
FT                   GGHTLREIISNAGGDEVRGRAVDIPNADSESSIITIQGPKKFVSNVVKAINKIVEESQN
FT                   SITKKIEVPGERLGALIGPGGIVRKQLESEFNIQLYVPKRDEEETRVSLTGLPENIEKA
FT                   EKKIFTEIIRDNFDLEIMVPANVQNYVSDRGNLPQRLRLEKFVNVRYGNATKKANNLNR
FT                   TPVDIPYEKVAGAEGEKVKFTVEETGPSVVENVDGEIPWRLIYEPIDFDSILDEENGEK
FT                   KEASVDENKKQQLLKEAKEIIENRINDAPNATYSGYVWTSDPSKFFKVVGMGGSNVKKI
FT                   RESTNCIVYVPKKSDKINNVIFIKGAKENVEKAGEAIIKSLKQ"
     atgtcattga cctttgctac tgagaaagaa ttggctgtgg ataacacacc agctgagagt        60
     tctttggatt ctcttgacgg cactactttt gactctgatg aggagtcaaa gcctgtcgaa       120
     gaagctccaa agcctgagcc aaaacctttg ccttctttga aggatttacc atccttggta       180
     gatagcaact ccttcaaacc agctaccaaa gttgaatggg gtcctaacat gaaacctgca       240
     gccatttctt cttccgtcag tccatcaatg tcccgttctg ctagcgccac cagcgctggt       300
     cgtatgagat caaacaatat tcaggaaact tttaccctag acctgcaatc tcaattgtct       360
     gtgactaaat tggaactgtc caggatctta caaactgtta agcaggctaa caacgtctct       420
     gtcgagtcta ccttgtcaag aaactcccgt actttcttga tctctggtcc agcaccaaaa       480
     gttaaggagg ctaagagaga attgataaag atgctaacca gacctataac ggaaaacatc       540
     gaggttccat caagatgcaa agccgtcatc attggttctg gtggtaagaa cattcgtgag       600
     atctctgaca gatacgatgt caaaatccac atcagcaaag aaccaaaacc agactcctac       660
     aatgaagatc tagacgacga cttgagcgat atctccatat tcggtgactt tgaatctgtt       720
     aagcaagcca aggccaaaat cttgtccatt gtaaacgagg atctgaagaa tatcactgct       780
     agactatctg tagaggattc cactttggga tcattcgtta atgtcaagga agtctcttca       840
     gatgatgtca aagtgcaata ctatcaagat accgggtctt tcacaattac gggtagttta       900
     gacgacatta aaaacgctaa aaccaagata aaggattact tacaaaagct atccaatgaa       960
     cttgctgaag aaaatgttaa gattccatca aaattccaat tcctaattga tgcggacgaa      1020
     gttaaggaca gatttggtgt tattgtcaag ttcccaaaga gctcctctga tgaaactgtc      1080
     caatttgctg gattaaaaga caaagtagct gaggctatta gttttgctag gacttcctct      1140
     aagcaataca tcgtcgactc acttgacatt tcaaaagcac acaacaagaa tcttgaccat      1200
     gctaagagac tagtcatcta cttccagaag tacaacgtct tggataaggt tgcagaggaa      1260
     ttcccagatg tcaaatacgt tttgccatcc atcgaagatt tgcaaaatgc caaagaagtt      1320
     ttcatttact tgagtgcaaa gaatgataag acttcagaaa taaaggctgc tcgtagagag      1380
     attattgcga ttgtgaatga catcactcca gctgaaacac tggtcatcga tgacctagat      1440
     tacgaactat tccacagaaa tattaagcac atcttactag gccatgaatc agaagctaag      1500
     ttcatccaaa ttggtgacta cttcaagggt gatgactctg ttgttttgtt tgctacctca      1560
     acagatgaag acttcaaacc atcaactgat gaaataaagg aaagcttgga aaaagtcaac      1620
     gcaaatctaa atgatctacg taagaagcaa aactccctag aagttgctac ttatgatctt      1680
     gaatctgaaa agcaagatga gttttttgga aaggactctg tggctctaaa attgatctta      1740
     gaagatattt ccggcgatga cggccacatt caaattaaat tacactctcc tgaaaagaat      1800
     aagatgactt tgagaggtga cgaaagggct gttaagaagg caaacaaaga tattaaatct      1860
     attgttgaga acccatctac tactgcaaag ataaccgttg aagttcctgt cgcttccgtt      1920
     tccagattga ttggtaacaa aggtgctaat ctacaaaagt tgagaaacaa gtacaactgt      1980
     tctattgata ttcctcaaca gggtgagtct gaccaagata agactgttga aattaccatt      2040
     aagggtttgc aatttatcat tgaacatgct aagaaggata ttgcaaatga agctaagaga      2100
     ttagcagata tcgtcacaaa ggaacttgtt gcacaggcta aataccaccg taatttaagt      2160
     ggtcctcaag gtatgtaccg tactcgtcta caagagaagt acaatgtctt cattaacttc      2220
     ctaaaggaaa ataacaccat taccattaag ggtccatcaa gaggtgttaa caaagcttac      2280
     gatgaattga aagcccttct tgatttcgaa atggaaaatg gtcataagac tattgtcaat      2340
     gttccagtcg agcatatgtc tagaatcatt ggtaagaatg gtgacaccat caacggtctt      2400
     tctgatgaat ttggtgttga actagatttc ttacagaaga gtgatgatcc gaaggcggta      2460
     gaaactggtg ttgttgagct tgaaatcact ggtaacagaa atgccatcaa ggaagcctct      2520
     actaaaattg cagctattgt ttctgaagct gcagaccacg ttactgagaa acttgacatc      2580
     gaccgcaaat accacaagac aattgttggg gctggtggtc acactttaag agaaatcatc      2640
     agtaatgctg gtggtgatga agttagagga agagctgttg atattccaaa tgctgactca      2700
     gagtcttcca ttatcacaat tcaaggtcca aagaagtttg tttccaacgt ggttaaggca      2760
     attaacaaga ttgttgaaga aagtcaaaac agcattacca agaagatcga agttccaggt      2820
     gaaagattgg gtgcattgat tggcccaggt ggtattgtca gaaagcagct agaatctgag      2880
     tttaacatcc aactttatgt tcctaagagg gacgaagaag agactcgtgt ttctctaaca      2940
     ggtttgccag aaaacatcga gaaagctgag aagaagatat tcacagagat catcagagat      3000
     aactttgatt tggagatcat ggtcccagca aatgttcaaa actatgtatc cgatcgtggt      3060
     aaccttccac aaagactaag acttgaaaag tttgtgaacg ttagatacgg taacgccacc      3120
     aagaaggcca acaatctaaa cagaacgcct gtagatattc cttatgaaaa ggttgctgga      3180
     gctgaaggtg agaaagtcaa gttcactgtt gaagaaaccg gaccatctgt tgttgaaaat      3240
     gtagatggtg aaataccatg gagactaata tacgagccta ttgactttga tagcatttta      3300
     gatgaagaaa atggtgagaa gaaggaagct tctgttgacg aaaacaagaa gcagcaatta      3360
     ttgaaggagg ccaaggaaat aattgaaaac agaatcaacg acgctccaaa tgccacttac      3420
     tctggatatg tctggacatc tgacccaagc aagttcttca aggttgttgg tatgggtggt      3480
     tccaacgtca aaaaaattcg tgaatctacc aactgtattg tttacgttcc aaagaaatct      3540
     gataagatca acaacgtaat tttcatcaag ggtgctaagg aaaatgttga gaaggcaggt      3600
     gaagccatca tcaaatcttt gaaacaatga                                       3630
//

If you have problems or comments...

PBIL Back to PBIL home page