(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE14

CAGLA1_12.PE14       Location/Qualifiers
FT   CDS_pept        complement(55412..55675)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000115758" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21044075"
FT                   /gene_name="TIM8"
FT                   /locus_tag="CAGL0M00418g"
FT                   /product="Mitochondrial import inner membrane translocase
FT                   subunit TIM8"
FT                   /function="metal ion binding"
FT                   /biological_process="protein import into mitochondrial
FT                   inner membrane"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="mitochondrial inner membrane "
FT                   /cellular_component="mitochondrial intermembrane space
FT                   protein transporter complex"
FT                   /protein_id="CAG62339.1"
FT                   /db_xref="GO:0005743"
FT                   /db_xref="GO:0042719"
FT                   /db_xref="GO:0045039"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG163129"
FT                   /db_xref="HOGENOM:HBG603145"
FT                   /db_xref="InterPro:IPR004217"
FT                   /db_xref="UniParc:UPI00003B6FEE"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FK81"
FT                   /transl_table=1
FT                   /translation="MSNLNPGELGDLTDASKKEIAAYLDAENSKQKVRTSINQFTDICF
FT                   KKCISRVDNGNLSSQEEECLASCVNRFLDTNIRVVRGLQNSQ"
     atgtctaact taaatcctgg tgagcttggc gatttgacgg acgcttcaaa gaaagagatt        60
     gctgcttatc ttgatgctga gaattctaag cagaaagtta ggacatcgat taaccaattc       120
     acagatattt gtttcaagaa atgtatctcc agagtcgata acggaaatct gagctctcag       180
     gaggaagaat gtttggcctc ttgcgtcaac agatttctgg atactaatat aagagtggtc       240
     agaggattgc aaaactctca atga                                              264
//

If you have problems or comments...

PBIL Back to PBIL home page