(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE140

CAGLA1_12.PE140      Location/Qualifiers
FT   CDS_pept        complement(374158..374958)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000837" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19348983"
FT                   /locus_tag="CAGL0M03267g"
FT                   /product="Similar to uniprot|P38632 Saccharomyces
FT                   cerevisiae YEL019c MMS2 DNA repair protein "
FT                   /protein_id="CAG62465.1"
FT                   /db_xref="HOGENOM:HBG124038"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="UniParc:UPI00003B706A"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJV5"
FT                   /transl_table=1
FT                   /translation="MDSVALPEALPIHKDQRDNFHDLRECYISSELSTIEKQYEKTINQ
FT                   LTTYIDLLEEDQILQCVNKLTESYKDTLAQKEQADQLDNQLESLKQDYLRISDHSPATD
FT                   IDSFREYTNGTVGIDSFQKYFTEGIVDQKPTIPRNNVRRKPNTYEKLLKALPYIIRDPT
FT                   CVIPDEDQEEDDIQIEGGKIELNCPITCKPFENPMISKACNHVFDKVGIQMYFDTPDKK
FT                   KCPQGACGHELTARDFIPDNIMMLRCKINNRKKNDQARNMLDVL"
     atggatagcg ttgcacttcc ggaggcgctg ccgatacata aagatcaaag agataacttc        60
     catgatctgc gagagtgcta tatatcttct gagttaagta cgattgagaa acaatacgaa       120
     aaaaccatca accagctgac tacatacatc gatctactgg aagaggatca gatactacag       180
     tgcgtgaaca agcttactga gagttacaaa gataccttag cgcaaaaaga acaggcggac       240
     caattggata accaactgga gtccttaaaa caagattatc tgagaatatc tgatcattca       300
     ccagcgactg atattgatag cttcagagaa tatactaatg gtacggtcgg cattgacagt       360
     tttcagaaat atttcaccga gggcatagta gaccagaaac ctaccatacc tcgaaacaac       420
     gtgagacgaa agccaaatac atatgagaag ttacttaaag cactaccata cataatcaga       480
     gacccaactt gtgtgatacc cgatgaggac caagaagaag acgatattca aattgaaggt       540
     ggtaaaatcg aattgaattg ccccattact tgcaaaccgt ttgagaaccc aatgatctcc       600
     aaagcttgta atcacgtatt tgacaaagtg ggtatccaga tgtactttga tacaccagat       660
     aagaagaaat gtccccaagg agcgtgtgga catgagctga ctgcgcgtga ttttatccca       720
     gacaacatta tgatgctcag atgcaagatt aacaatagaa agaaaaacga tcaggctaga       780
     aacatgctag atgtgttatg a                                                 801
//

If you have problems or comments...

PBIL Back to PBIL home page