(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE142

CAGLA1_12.PE142      Location/Qualifiers
FT   CDS_pept        complement(376045..376164)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21044612"
FT                   /locus_tag="CAGL0M03305g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /protein_id="CAR58073.1"
FT                   /db_xref="HOGENOM:HBG398760"
FT                   /db_xref="InterPro:IPR012589"
FT                   /db_xref="UniParc:UPI00017BD8B2"
FT                   /db_xref="UniProtKB/TrEMBL:B4UN57"
FT                   /transl_table=1
FT                   /translation="MLPGGPIVVLILVGLAACIIVATIIYRKWQERQRALARF"
     atgctacctg gtggacccat cgttgtgctg atccttgttg gtttagcggc ctgcattatc        60
     gtcgctacca ttatctatag aaaatggcag gaaagacaga gagctctagc cagattctga       120
//

If you have problems or comments...

PBIL Back to PBIL home page