(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE145

CAGLA1_12.PE145      Location/Qualifiers
FT   CDS_pept        382549..384297
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000177331" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17437834"
FT                   /gene_name="VAC8"
FT                   /locus_tag="CAGL0M03355g"
FT                   /product="Vacuolar protein 8"
FT                   /function="binding"
FT                   /cellular_component="vacuolar membrane"
FT                   /protein_id="CAG62469.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0005774"
FT                   /db_xref="HOGENOM:HBG055740"
FT                   /db_xref="HOGENOM:HBG327627"
FT                   /db_xref="InterPro:IPR000225"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI00003B706E"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FJV1"
FT                   /transl_table=1
FT                   /translation="MGGCCSCFRDSSDDVSVLPITDNEREAVTLLLGYLEDKDRLDFYS
FT                   GGPLKALTTLVYSDNLNLQRSAALAFAEVTEKYVRQVSRDVLEPILILLQSQDPQIQVA
FT                   ACAALGNLAVNNENKLLIVDMGGLEPLINQMMGTNVEVQCNAVGCITNLATRDDNKHKI
FT                   ATSGALVPLTKLAKSKHIRVQRNATGALLNMTHSEENRRELVNAGAVPVLVSLLSSNDP
FT                   DVQYYCTTALSNIAVDEANRKKLAQTEPRLVSKLVSLMDSPSSRVKCQATLALRNLASD
FT                   TSYQLEIVRAGGLPHLVNLIQSESVPLILASVACIRNISIHPLNEGLIVDAGFLPPLVK
FT                   LLDYRDSEEIQCHAVSTLRNLAASSEKNRKEFFESGAVKKCKELALDSPVSVQSEISAC
FT                   FAILALADVSKQDLLDADILQALIPMTFSTNQEVSGNAAAALANLCSRIDNYSKIISSW
FT                   DQPKEGIRGFLKRFLQSNYATFEHIALWAILQLSESHNDKVIYLIKNDKEIINSVRKMA
FT                   DVTYDRLQKSGVDVNKNGNSEERGDNEDHQSNNDRNLANSTSSDQYEDASMELYNITQQ
FT                   ILQFLD"
     atgggtgggt gttgtagttg ttttagggac tcttctgatg atgtcagtgt gctgcctata        60
     acagacaatg aacgcgaggc tgtgaccttg ttgttaggat atttggagga taaggacaga       120
     ctagacttct acagtggtgg acctttgaag gcattgacta cattggttta ctctgacaac       180
     ttaaatttac aaagaagtgc tgctttggcg tttgcagaag taactgaaaa atatgttaga       240
     caagtgtcta gagatgtttt agagcccata ctaattcttt tgcaaagtca ggaccctcag       300
     attcaggtgg ctgcatgcgc tgctttgggt aacttggcag tcaataatga aaataaacta       360
     ctaatagtag atatgggcgg tttggaacca cttattaacc agatgatggg tacaaatgtc       420
     gaagttcaat gtaacgctgt cggttgtata actaacttgg ctacaaggga tgataataaa       480
     cataagattg ccacatcagg tgccctcgta cctttaacaa agttagctaa gtcaaagcat       540
     atccgtgtac aaagaaatgc cactggtgct ttgttgaata tgacacactc agaggaaaat       600
     agaagagaat tggtcaatgc tggcgctgta ccagttctag tgtcattact gtcttctaat       660
     gaccctgatg ttcaatatta ttgtacaact gctctatcta acattgcagt tgatgaagct       720
     aacagaaaga aacttgccca aactgagccc agactggtat caaagttggt atcgttgatg       780
     gattcacctt catcaagagt taaatgtcaa gctacattag cgttgagaaa cttagcatcc       840
     gatacaagtt atcaattaga gatagttaga gctggtggtc taccacattt ggttaattta       900
     attcaaagcg agtcagtgcc tctaatcttg gcgagcgttg catgcataag aaacatatcc       960
     attcatccat tgaatgaagg cttaatagtt gatgcaggtt tccttccacc tttggtgaag      1020
     ttactagatt atagagattc tgaagaaatt caatgtcatg cagtatctac tttaagaaat      1080
     cttgctgctt cttcagaaaa gaaccgcaaa gagtttttcg aaagtggagc ggtaaagaag      1140
     tgcaaagagc tcgctctgga ctcaccagtt agtgttcaaa gtgaaatctc agcttgtttt      1200
     gcaattttag cacttgctga tgtttctaaa caagatttat tggatgccga tattttacag      1260
     gcattgatac ctatgacatt ctcaaccaat caagaagttt ctggtaatgc ggcagcggct      1320
     ttagcaaact tgtgctccag aattgacaac tattccaaga taatatcgtc atgggaccaa      1380
     cctaaggaag gtattagagg tttcttaaaa agatttttgc aaagcaatta tgcaaccttt      1440
     gagcatatag ctctatgggc tattttgcaa ctatcagaaa gccataacga caaagttatt      1500
     tacttaatca aaaacgataa agaaataata aacagcgtaa ggaaaatggc tgatgtaaca      1560
     tatgatcgtt tgcagaaatc tggtgttgat gttaataaaa atggaaatag cgaagaaaga      1620
     ggagataatg aggaccatca gagcaacaat gatagaaact tggctaattc aacttcctca      1680
     gatcaatatg aagatgcaag catggaatta tataatataa cacaacagat tcttcaattc      1740
     cttgattga                                                              1749
//

If you have problems or comments...

PBIL Back to PBIL home page