(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE146

CAGLA1_12.PE146      Location/Qualifiers
FT   CDS_pept        complement(385581..387701)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000175159" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17437835"
FT                   /gene_name="GLC3"
FT                   /locus_tag="CAGL0M03377g"
FT                   /product="1,4-alpha-glucan-branching enzyme "
FT                   /EC_number="2.4.1.18"
FT                   /function="1,4-alpha-glucan branching enzyme activity "
FT                   /function="cation binding"
FT                   /function="hydrolase activity, hydrolyzing O-glycosyl
FT                   compounds"
FT                   /biological_process="glycogen biosynthetic process "
FT                   /protein_id="CAG62470.1"
FT                   /db_xref="GO:0003844"
FT                   /db_xref="GO:0004553"
FT                   /db_xref="GO:0005978"
FT                   /db_xref="GO:0043169"
FT                   /db_xref="HOGENOM:HBG021253"
FT                   /db_xref="HOGENOM:HBG302308"
FT                   /db_xref="InterPro:IPR004193"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR006048"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniParc:UPI00003B706F"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FJV0"
FT                   /transl_table=1
FT                   /translation="MSLTKIPENVQGAVSIDPWLEPFADVLSERRYLADKWLYDIKHAT
FT                   PDGSEQSLVDFARNAYKTYGLHANQQTKEIVYREWAPNAQRAFLVGEFNNWNEESHEMK
FT                   HKDEFGVFSITLAPLENGDFAIPHDSKIKVMFVLPDGSKVYRIPAWITRATQPSKETAQ
FT                   KYGPTYEGRFWNPPNSYQFKHQRPKFNLANDSIKIYEAHIGISSPEPKVASYKEFTQNV
FT                   LPRIKHLGYDAIQLMAIMEHAYYASFGYQVTNFFAISSRYGTPEDLKELIDTAHSMGIL
FT                   VLLDVIHSHASKNSEDGLNMFDGSDHQYFHSLTSGRGEHPLWDSRLFNYGSFEVQRFLL
FT                   ANLAYYIDVYQFDGFRFDGVTSMLYLHHGVGAGGAFSGDYNEYLSRDRSGVDHEALAYL
FT                   MLANDLVHDLLPESAVTIAEDVSGYPTLCLPRTAGGGGFDYRLAMALPDMWIKLLKTKQ
FT                   DDDWDMGHIVHTLTNRRHGEKVVAYCESHDQALVGDKTLAFWLMDAAMYTDMTVLKEPT
FT                   LVIDRGIALHKMIRLITHSLGGEAYLNFEGNEFGHPEWLDFPRVGNNDSYHYARRQFNL
FT                   VDDDLLRYRHLNEFDAAMQNCESKHQWLNTPQAYVSLKHEVDKVIAFERNGHLFVFNFH
FT                   PTQSFTDYRIGVDVAGTYKIVLNTDRAEFGGHNRIDEAQEFFTTDLEWNNRRNFIQVYI
FT                   PSRTAIVLTRQM"
     atgagtttga ctaagattcc tgaaaatgtc cagggagcag tttccattga cccatggtta        60
     gaaccatttg ctgatgttct ttctgagcga aggtaccttg ctgataaatg gctatatgac       120
     atcaagcacg ccacacctga tggctctgag caaagtttgg ttgatttcgc aagaaacgca       180
     tataagacct atggtctgca cgccaaccag caaactaaag aaattgttta cagagaatgg       240
     gctccaaatg ctcaacgtgc tttcctagtc ggtgagttca acaactggaa cgaagagtct       300
     catgaaatga agcataagga tgaatttggt gtatttagca tcactctagc acctttggag       360
     aacggcgatt ttgccatccc tcatgattcc aagatcaaag ttatgtttgt cttgccagat       420
     ggctcaaaag tttacagaat tccagcatgg attacaagag ccactcaacc aagcaaagaa       480
     accgctcaga aatacggtcc aacatatgag ggtagattct ggaacccacc taactcttac       540
     cagtttaaac accaaagacc taagttcaat ttggctaacg actcaattaa aatttatgaa       600
     gctcacattg gtatctcttc tccagagcca aaagttgcct cctacaaaga attcactcaa       660
     aacgttctac ctagaattaa gcatctaggt tacgatgcta tccaattgat ggctattatg       720
     gagcacgctt actatgcttc gtttggttac caagttacca acttctttgc tatcagttct       780
     cgttatggta ccccagaaga tttgaaagag ttaatcgata ctgcccatag catgggtatc       840
     ttggttctac tagatgtcat tcacagtcac gcatctaaga atagtgaaga tggtttgaac       900
     atgttcgatg gttctgacca ccaatacttc cattccttga cttctggtag aggtgagcat       960
     ccattatggg attcccgttt attcaattat ggtagctttg aagtgcaaag attcttgctt      1020
     gccaacttgg cttactacat tgacgtttac caattcgatg gtttcagatt tgatggtgtc      1080
     acctctatgc tttacttaca ccatggtgtc ggtgctggtg gtgctttcag cggtgactac      1140
     aacgagtatt tgtcccgtga cagatctggt gttgaccatg aagccctggc ttacttgatg      1200
     ttggcaaatg acctagtcca tgacttgcta ccggaatccg ctgttactat tgctgaagat      1260
     gtttctggtt atccaactct gtgtctacca agaactgcag gcggtggtgg ttttgactac      1320
     agattggcta tggctctccc agatatgtgg atcaagcttc taaagaccaa acaagatgat      1380
     gactgggata tgggtcacat tgttcacaca ttgactaaca gacgtcatgg tgaaaaggtt      1440
     gttgcctact gtgaatccca cgatcaagct ctagtcggtg acaagactct tgccttctgg      1500
     ctaatggatg ctgccatgta caccgacatg accgttttga aggagccaac attggttatt      1560
     gaccgtggta ttgctctaca caaaatgatt agattaatca cccactctct aggtggtgag      1620
     gcttatctaa acttcgaggg taacgagttc ggccatcctg aatggttaga cttcccaaga      1680
     gttggtaaca atgacagtta ccattatgca agaagacaat tcaacttggt tgatgatgat      1740
     ttattgcgtt acaggcattt gaacgagttt gatgctgcaa tgcaaaactg tgaatccaaa      1800
     caccaatggt tgaatactcc tcaagcatat gtctctttga agcacgaggt tgacaaagtt      1860
     atcgccttcg aaagaaatgg ccatttgttt gttttcaact tccatccaac tcaaagtttc      1920
     actgactaca gaattggtgt cgatgttgct ggtacttaca aaattgtact aaatactgat      1980
     agagcagaat ttggtggcca caatagaatt gatgaggctc aagaattttt caccactgac      2040
     ttggaatgga acaacagaag gaacttcatc caagtataca ttccaagcag gactgctatc      2100
     gttttgaccc gtcaaatgta g                                                2121
//

If you have problems or comments...

PBIL Back to PBIL home page