(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE147

CAGLA1_12.PE147      Location/Qualifiers
FT   CDS_pept        complement(389650..390294)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000233452" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20195766"
FT                   /locus_tag="CAGL0M03399g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /function="small conjugating protein ligase activity "
FT                   /biological_process="post-translational protein
FT                   modification"
FT                   /biological_process="regulation of protein metabolic
FT                   process"
FT                   /protein_id="CAG62471.1"
FT                   /db_xref="GO:0019787"
FT                   /db_xref="GO:0043687"
FT                   /db_xref="GO:0051246"
FT                   /db_xref="HOGENOM:HBG492183"
FT                   /db_xref="HOGENOM:HBG756483"
FT                   /db_xref="InterPro:IPR000608"
FT                   /db_xref="InterPro:IPR015581"
FT                   /db_xref="InterPro:IPR016135"
FT                   /db_xref="UniParc:UPI00003B7070"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJU9"
FT                   /transl_table=1
FT                   /translation="MSGNSKRRIETDVMKLLMSDHEVELVEDSMQEFHVKFYGPKDTPY
FT                   EGGVWRLHVELPDNYPYKSPSIGFVNKIFHPNIDIASGSICLDVINSTWSPLYDLLNIV
FT                   EWMLPGLLKEPNGSDPLNNEAANLQLKDKKVYEEKVREYIDKYATKERYESQFGTPEDD
FT                   EDDGDDAEMKDEDGDDDIDEPVSDLEDISDDNADPSEELSDISDIELSDED"
     atgagtggga attcaaagag acgtatagag acggatgtga tgaagcttct catgagtgat        60
     catgaggttg agctggtgga ggatagcatg caggagttcc atgttaagtt ttatggtcct       120
     aaggacacac catatgaagg aggtgtttgg agattgcacg tagagctgcc agacaactac       180
     ccttataaat cgccaagtat tgggtttgta aacaagatat tccatcctaa tatagatatt       240
     gcgtcagggt ctatctgttt agatgtcatc aactctacat ggtcaccact atatgatcta       300
     ctgaacattg tagagtggat gttgccagga ctgctgaagg aacctaatgg gagcgatcca       360
     ttgaacaatg aggcagctaa cttacaactg aaggataaaa aagtatacga ggagaaagtg       420
     cgggaataca tagataagta tgccacaaag gagagatatg agagtcagtt tggaacacct       480
     gaggatgatg aagatgacgg tgatgatgca gaaatgaaag atgaggatgg agatgatgat       540
     atagatgaac cggtcagtga tttggaagat ataagcgatg ataatgcaga cccaagcgaa       600
     gagctcagtg acatcagcga tatagagtta agcgatgagg attag                       645
//

If you have problems or comments...

PBIL Back to PBIL home page